2I1BA

Crystallographic refinement of interleukin-1 beta at 2.0 angstroms resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
153
structure length
153
Chain Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic refinement of interleukin 1 beta at 2.0 A resolution.
pubmed doi rcsb
molecule keywords INTERLEUKIN-1 BETA
molecule tags Cytokine
source organism Homo sapiens
total genus 28
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1990-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2i1bA00
1TFMB 3VT2A 4JKQA 4KEKA 1JT5A 4EFPA 1S0CA 1SZ6B 3BAVA 4I4XA 3E8LC 3HALA 1NUNA 1IHKA 2NTDA 2NP0A 5HPZA 3OJMA 2KKIA 4Q9PA 1JLXA 3BAOA 1FV2A 2KI4A 1G82A 5BP5C 3CRGA 1EYLA 1F31A 3RMXA 1FV3A 3B9UA 1BFFA 3WO3A 1ITBA 1SR4A 4QBVA 5E24E 4G6MA 4QD2C 1ISWA 5BVPI 5BQUA 2BEBA 3CA3A 4Z8SB 4QKRA 3OJ2A 3O3QA 8I1BA 2X2SA 3PG0A 3BA5A 2L5XA 2Z49A 1V6VA 3V79C 4I2SA 3O44A 3SNVA 1TWMA 1I1EA 3UJ0A 1HWOB 1IRAX 2VXRA 3ZXGA 1AVUA 4I0YA 1CE7B 3HN1A 4I6IA 9ILBA 4IY9A 4Z9WB 4G9MA 3I2XA 1XHBA 3FGMA 5F8SA 4JAWA 1TOOA 1JT4A 3OBRA 2HWAA 2MIBA 1K5VA 4LO1A 2RSTA 1IILA 3RTIB 1RZOB 4P6AA 4XFSA 2Q3NB 4I4RA 1WD3A 3AKIA 3R4SA 1JT3A 4PC4A 2IWTB 1DZDA 2FO1A 3FUQA 3OGFA 1CVSA 4LO0C 4EKXB 7I1BA 3AKFA 1ISVA 3O4BA 4P0KA 3UDAA 2D22A 3BRDA 3O4AA 31BIA 3JRRA 3PMEA 1DZCA 4XFUA 3NBDA 2AXMA 1NZKA 1A8DA 3O49A 1P63A 4GP0A 1WBCA 2VU9A 3AKGA 1Z4SA 3UD8A 2YUGA 1KNMA 3H6QA 4GAIA 4KEIA 3UJ4A 3CRIA 1K5UA 4JRAA 1HIBA 1QXMA 3FJCA 3O4DA 3WA1A 1IT0A 1FMZA 3AH1A 3FJFA 4KEJA 5BP5A 4P0LA 1BFBA 1S0LA 2Y9GA 3FJKA 3O4CA 4KC3A 3IM7A 4R6UB 5GAQA 4ZOTA 3BADA 4FVVA 4JP0A 2I1BA 4L4IA 3FJBA 3WMUA 2XOAA 4OEEA 1JTCA 5DSSB 4D0TA 4ZFUB 4HJJA 2K4AB 2R9KB 1G9BA 3K1XA 1AVAC 3VSZA 3VWCA 3TC2A 3D7WB 3VEQA 3V0AA 3IIRA 4ZLBB 4JQ0A 4LO3C 1ABRB 3UD9A 3EF2A 2BEAA 3FUOA 2BFHA 2NM1A 2Y9XE 3VT1A 1G9CA 4F83A 2NYYA 5D61A 5JLVA 2K8RA 21BIA 4F34A 2NZ9A 3A23A 3F62B 3FJ8A 3IM6A 4LO2A 3WINC 4I4UA 5BXRA 1II4A 1YXWA 2GZBA 1YF8B 5FNXA 5F8YA 4I7IA 1FWVA 2NVHA 2QN4A 4I4QA 1FQ9A 5DZUA 1W3AA 4LO7C 2D1ZA 3BA4A 3BA7A 5DVHA 4CJMA 4ENDA 1FGAA 2KH2A 2WBCA 3I2AA 41BIA 4ZBVB 3C9ZA 1WD4A 2E4MC 3AH4A 3ZC8A 2KI6B 4H9WA 4AN7B 4IYBA 3V0BA 3VT0A 1RG8A 4LO0A 3FFZA 1QQLA 3MPPG 2RQ9A 1ISXA 4DEPA 3S8KA 1AF9A 2F2FC 4OWKA 4HA2A 3AKHA 3KMVA 4LO2C 3QR5A 1PC8B 2Y9WC 4USOA 4QD2B 1G9DA 3H6SE 3BAQA 3RMYA 4I8MA 2D24A 2VLCA 5BXSA 2HWMA 1PUMB 1HCDA 3CAHA 4IONA 1DJSB 2AQZA 3V0AB 4WBCA 3WO2A 2VXTI 1EPWA 1RMLA 2D7IA 4AN6A 2MC2A 4I4PA 4ISRA 1ILR1 3NJ5A 2AFGA 2QYIB 3F1RA 4ZFWB 3BB2A 5G00A 2ZR1B 3CRHA 3FJ9A 1FN0A 2VSAA 5JMCA 3QYDA 4OEGA 2MLLB 4ZFYB 1S0FA 4HR6C 3WMVA 2VUAA 4IZEA 3A22A 5I1BA 2DREA 3BAGA 5EC5A 2LIQA 3N0KA 3MALA 4I3NA 4ZGRB 1S0GA 2HZ9A 3VSFA 4P0JA 5BXPA 1I1BA 1E0OA 3N7KA 1MC9A 3HSMA 4EFQA 3BTAA 4LO3A 1FMMS 2ET2A 5F8WA 1T4QA 1EVTA 5FZUA 1Z2VA 3BRGC 3V0BB 4I96A 5B2HA 3HOMA 1YTOA 2DS0A 1EV2A 3ZXDA 3POKA 1DIWA 3RTJB 4YOLA 3WINA 1BLDA 4J2KA 4FGFA 4J23B 1BLAA 6I1BA 2ESUA 1Q04A 1UPSA 2ZQNA 1S0DA 1V6XA 4I4OA 2DRZA 1D0HA 5FZYA 1ONKB 1T9FA 1HCEA 4QKSA 1TP0A 3BAHA 1DLLA 2Z48A 1ISYA 3BRFA 1AFCA 2E4MA 3VUOA 3OGGA 3CQAA 4IY8A 5EHAA 1V6UA 3AZVA 1ISZA 4H04A 4IQPA 1OQLB 5BOWA 4QO3A 2F2FA 3AJ6A 1DQOA 4XFTA 4DCKC 3PHZA 2X2TA 1IOBA 3FJDA 5BXTA 3ZX7A 3CA5A 4I4SA 2D44A 4X38A 3CA0A 1IJTA 3T8SA 1IRPA 1R8NA 2Y9FA 4J2SA 1XZZA 2HW9A 5D63A 3AZWA 4A7KA 3OJVA 1HWMB 4A7YA 1YYNA 3NBCA 3FJJA 1XYFA 2DRYA 2K43A 1BASA 1TIEA 2LIEA 3H6RA 3P53A 4D8HA 4EB2B 1M16A 2ZQOA 5F90A 4D0ZA 1PZZA 1G9AA 3W9TA 3CA1A 4ZA3B 2KLLA 4IZXA 3CA6A 3HBWA 3NBEA 4LO8B 1W3GA 1V6WA 1DQGA 1JQZA 1XG6A 3I29B 2WRYA 3NBNA 1HKNA 1DFQA 3FJEA 1L2HA 3AJ5A 3N7MA 3N7JA 1M2TB 1PUUB 2VSEA 3ILAA 1FWUA 2M49A 1HWNB 4LO7B 1BFGA 4TLPA 1DFCA 4OUJA 4JKXB 4X37A 2D23A 1WBAA 4KBBA 4GOYA 1TWEA 1YBIA 4J2XA 3N7LA 2P39A 5DUYA 1GGPB 4L4HA 4X39A 4DENA 1SR4C 2P23A 3P6JA 5FNWA 2Q9XA 3A21A 4II0A 4J2YA 4OEFA 3ZC9A 1AVWB 3Q7XA 4GP3A 2FGFA 1JY0A 5BQUC 1AXMA 2UUSA 4QC4A 4Q9GA 1J0SA 4USPA 3Q7YA 1W3FA 2FFVA 4EFRA 1AVXB 3JUTA 3O4OA 4A7ZA 1JLYA 2RG9B 2ERMA 1Q03A 2J3PA 3O5WB 1RY7A 3RSJA 4X3AA 3FJHA 3S8JA 1S0BA 2D43A 4QALA 2GO2A 4GAFA 4ZKTB 4I4VA 4OWLA 3H6RB 3P6IA 1Z0HA 4OWJA 1HWPB 4QBCA 4I37A 5EG6C 5FZZA 4I1EA 3PUBA 4OW4A 2D7RA 4LO1C 3R4UA 3Q7WA 3BX1C 4JPZA 1BA7A 4G6JA 2F8XC 1BARA 3AH2A 4G1RA 1TTUA 3A07A 4I1BA 3BAUA 3FJAA 3IAGC 3FJIA 1N4KA 3WO4A 1QQKA 3LTQA 3OBTA 1MD6A 4ISQA 4G9NA 4IHZA 1R8OA 2D20A 3CA4A 3HMYA 2FDBM 2FFUA 1Q1UA 3CU1B 4XKIA 1PWAA 4EEEB 3IM5A 2IHOA 3UD7A 4I4YA 1BFCA 1VCLA 2AAIB 3LLPA 5D62A 1S0EA 4GOVA 4Q91A 1JT7A
chains in the Genus database with same CATH superfamily
1TFMB 3VT2A 4JKQA 4KEKA 1JT5A 4EFPA 1S0CA 1SZ6B 3BAVA 4I4XA 3E8LC 3HALA 1NUNA 1IHKA 2NTDA 2NP0A 5HPZA 3OJMA 2KKIA 4Q9PA 1JLXA 3BAOA 1FV2A 2KI4A 1G82A 5BP5C 3CRGA 1EYLA 1F31A 3RMXA 1FV3A 3B9UA 1BFFA 3WO3A 1ITBA 1SR4A 4QBVA 5E24E 4G6MA 4QD2C 1ISWA 5BVPI 5BQUA 2BEBA 3CA3A 4Z8SB 4QKRA 3OJ2A 3O3QA 8I1BA 2X2SA 3PG0A 3BA5A 2L5XA 2Z49A 1V6VA 3V79C 4I2SA 3O44A 3SNVA 1TWMA 1I1EA 3UJ0A 1HWOB 1IRAX 2VXRA 3ZXGA 1AVUA 4I0YA 1CE7B 3HN1A 4I6IA 9ILBA 4IY9A 4Z9WB 4G9MA 3I2XA 1XHBA 3FGMA 5F8SA 4JAWA 1TOOA 1JT4A 3OBRA 2HWAA 2MIBA 1K5VA 4LO1A 2RSTA 1IILA 3RTIB 1RZOB 4P6AA 4XFSA 2Q3NB 4I4RA 1WD3A 3AKIA 3R4SA 1JT3A 4PC4A 2IWTB 1DZDA 2FO1A 3FUQA 3OGFA 1CVSA 4LO0C 4EKXB 7I1BA 3AKFA 1ISVA 3O4BA 4P0KA 3UDAA 2D22A 3BRDA 3O4AA 31BIA 3JRRA 3PMEA 1DZCA 4XFUA 3NBDA 2AXMA 1NZKA 1A8DA 3O49A 1P63A 4GP0A 1WBCA 2VU9A 3AKGA 1Z4SA 3UD8A 2YUGA 1KNMA 3H6QA 4GAIA 4KEIA 3UJ4A 3CRIA 1K5UA 4JRAA 1HIBA 1QXMA 3FJCA 3O4DA 3WA1A 1IT0A 1FMZA 3AH1A 3FJFA 4KEJA 5BP5A 4P0LA 4H75A 1BFBA 1S0LA 2Y9GA 3FJKA 3O4CA 4KC3A 3IM7A 4R6UB 5GAQA 4ZOTA 3BADA 4FVVA 4JP0A 2I1BA 4L4IA 3FJBA 3WMUA 2XOAA 4OEEA 1JTCA 5DSSB 4D0TA 4ZFUB 4HJJA 2K4AB 2R9KB 1G9BA 3K1XA 1AVAC 3VSZA 3VWCA 3TC2A 3D7WB 3VEQA 3V0AA 3IIRA 4ZLBB 4JQ0A 4LO3C 1ABRB 3UD9A 3EF2A 2BEAA 3FUOA 2BFHA 2NM1A 2Y9XE 3VT1A 1G9CA 4F83A 2NYYA 5D61A 5JLVA 2K8RA 21BIA 4F34A 2NZ9A 3A23A 3F62B 3FJ8A 3IM6A 4LO2A 3WINC 4I4UA 5BXRA 1II4A 1YXWA 2GZBA 1YF8B 5FNXA 5F8YA 4I7IA 1FWVA 2NVHA 2QN4A 4I4QA 1FQ9A 5DZUA 1W3AA 4LO7C 2D1ZA 3BA4A 4MZHA 3BA7A 4UY4A 5DVHA 4CJMA 1FGAA 4ENDA 2KH2A 2WBCA 3I2AA 41BIA 4ZBVB 3C9ZA 1WD4A 2E4MC 3AH4A 3ZC8A 2KI6B 4H9WA 4AN7B 4IYBA 3V0BA 3VT0A 1RG8A 4LO0A 3FFZA 1QQLA 3MPPG 2RQ9A 1ISXA 4DEPA 3S8KA 1AF9A 2F2FC 4OWKA 4HA2A 3AKHA 3KMVA 4LO2C 3QR5A 1PC8B 2Y9WC 4USOA 4QD2B 1G9DA 3H6SE 3BAQA 3RMYA 4I8MA 2D24A 2VLCA 5BXSA 2HWMA 1PUMB 1HCDA 3CAHA 4IONA 1DJSB 2AQZA 3V0AB 4WBCA 3WO2A 2VXTI 1EPWA 2NS2A 1RMLA 2D7IA 4AN6A 2MC2A 4I4PA 4ISRA 1ILR1 3NJ5A 2AFGA 2QYIB 3F1RA 4ZFWB 3BB2A 5G00A 2ZR1B 3CRHA 3FJ9A 1FN0A 2VSAA 5JMCA 3QYDA 4OEGA 2MLLB 4ZFYB 1S0FA 4HR6C 3WMVA 2VUAA 4IZEA 3A22A 5I1BA 2DREA 3BAGA 5EC5A 2LIQA 3N0KA 3MALA 4I3NA 4ZGRB 1S0GA 2HZ9A 3VSFA 4P0JA 5BXPA 1I1BA 1E0OA 3N7KA 1MC9A 3HSMA 4EFQA 3BTAA 4LO3A 1FMMS 2ET2A 5F8WA 1T4QA 1EVTA 5FZUA 1Z2VA 3BRGC 3V0BB 4I96A 5B2HA 3HOMA 1YTOA 4MZGB 2DS0A 1EV2A 3ZXDA 3POKA 1DIWA 3RTJB 4YOLA 3WINA 1BLDA 4J2KA 4FGFA 4J23B 1BLAA 6I1BA 2ESUA 1Q04A 1UPSA 2ZQNA 1S0DA 1V6XA 4I4OA 2DRZA 1D0HA 5FZYA 1ONKB 1T9FA 1HCEA 4QKSA 1TP0A 3BAHA 1DLLA 2Z48A 1ISYA 3BRFA 1AFCA 2E4MA 3VUOA 3OGGA 3CQAA 4IY8A 5EHAA 1V6UA 3AZVA 1ISZA 4H04A 4IQPA 1OQLB 5BOWA 4QO3A 2F2FA 3AJ6A 1DQOA 4XFTA 4DCKC 3PHZA 2X2TA 1IOBA 3FJDA 5BXTA 3ZX7A 3CA5A 4I4SA 2D44A 4X38A 3CA0A 1IJTA 3T8SA 1IRPA 1R8NA 2Y9FA 4J2SA 1XZZA 2HW9A 5D63A 3AZWA 4A7KA 3OJVA 1HWMB 4A7YA 1YYNA 3NBCA 3FJJA 1XYFA 4MZFB 2DRYA 2K43A 1BASA 1TIEA 2LIEA 3H6RA 3P53A 4D8HA 4EB2B 1M16A 2ZQOA 5F90A 4D0ZA 1PZZA 1G9AA 3W9TA 3CA1A 4ZA3B 2KLLA 4IZXA 3CA6A 3HBWA 3NBEA 4LO8B 1W3GA 1V6WA 1DQGA 1JQZA 1XG6A 3I29B 2WRYA 3NBNA 1HKNA 1DFQA 3FJEA 1L2HA 3AJ5A 3N7MA 3N7JA 1M2TB 1PUUB 2VSEA 3ILAA 1FWUA 2M49A 1HWNB 4LO7B 1BFGA 4TLPA 1DFCA 4OUJA 4JKXB 4X37A 2D23A 1WBAA 4KBBA 4GOYA 1TWEA 1YBIA 4J2XA 3N7LA 2P39A 5DUYA 1GGPB 4L4HA 4X39A 4DENA 1SR4C 2P23A 3P6JA 5FNWA 2Q9XA 3A21A 4II0A 4J2YA 4OEFA 3ZC9A 1AVWB 3Q7XA 4GP3A 2FGFA 1JY0A 5BQUC 1AXMA 2UUSA 4QC4A 4Q9GA 1J0SA 4USPA 3Q7YA 1W3FA 2FFVA 4EFRA 1AVXB 3JUTA 3O4OA 4A7ZA 1JLYA 2RG9B 2ERMA 1Q03A 2J3PA 3O5WB 1RY7A 3RSJA 4X3AA 3FJHA 3S8JA 1S0BA 2D43A 4QALA 2GO2A 4GAFA 4ZKTB 4I4VA 4OWLA 3H6RB 3P6IA 1Z0HA 4OWJA 1HWPB 4QBCA 4I37A 5EG6C 5FZZA 4I1EA 3PUBA 4OW4A 2D7RA 4LO1C 3R4UA 3Q7WA 3BX1C 4JPZA 1BA7A 4G6JA 2F8XC 1BARA 3AH2A 4G1RA 1TTUA 3A07A 4I1BA 3BAUA 3FJAA 3IAGC 3FJIA 1N4KA 3WO4A 1QQKA 3LTQA 3OBTA 1MD6A 4ISQA 4G9NA 4IHZA 1R8OA 2D20A 3CA4A 3HMYA 2FDBM 2FFUA 1Q1UA 3CU1B 4XKIA 1PWAA 4EEEB 3IM5A 2IHOA 3UD7A 4I4YA 1BFCA 1VCLA 2AAIB 3LLPA 5D62A 1S0EA 4GOVA 4Q91A 1JT7A
chains in the Genus database with same CATH topology
1TFMB 3VT2A 4JKQA 4KEKA 1JT5A 4EFPA 1S0CA 1SZ6B 3BAVA 4I4XA 3E8LC 3HALA 1NUNA 1IHKA 2NTDA 2NP0A 5HPZA 3OJMA 2KKIA 4Q9PA 1JLXA 3BAOA 1FV2A 2KI4A 1G82A 5BP5C 3CRGA 1EYLA 1F31A 3RMXA 1FV3A 3B9UA 1BFFA 3WO3A 1ITBA 1SR4A 4QBVA 5E24E 4G6MA 4QD2C 1ISWA 5BVPI 5BQUA 2BEBA 3CA3A 4Z8SB 4QKRA 3OJ2A 3O3QA 8I1BA 2X2SA 3PG0A 3BA5A 2L5XA 2Z49A 1V6VA 3V79C 4I2SA 3O44A 3SNVA 1TWMA 1I1EA 3UJ0A 1HWOB 1IRAX 2VXRA 3ZXGA 1AVUA 4I0YA 1CE7B 3HN1A 4I6IA 9ILBA 4IY9A 4Z9WB 4G9MA 3I2XA 1XHBA 3FGMA 5F8SA 4JAWA 1TOOA 1JT4A 3OBRA 2HWAA 2MIBA 1K5VA 4LO1A 2RSTA 1IILA 3RTIB 1RZOB 4P6AA 4XFSA 2Q3NB 4I4RA 1WD3A 3AKIA 3R4SA 1JT3A 4PC4A 2IWTB 1DZDA 2FO1A 3FUQA 3OGFA 1CVSA 4LO0C 4EKXB 7I1BA 3AKFA 1ISVA 3O4BA 4P0KA 3UDAA 2D22A 3BRDA 3O4AA 31BIA 3JRRA 3PMEA 1DZCA 4XFUA 3NBDA 2AXMA 1NZKA 1A8DA 3O49A 1P63A 4GP0A 1WBCA 2VU9A 3AKGA 1Z4SA 3UD8A 2YUGA 1KNMA 3H6QA 4GAIA 4KEIA 3UJ4A 3CRIA 1K5UA 4JRAA 1HIBA 1QXMA 3FJCA 3O4DA 3WA1A 1IT0A 1FMZA 3AH1A 3FJFA 4KEJA 5BP5A 4P0LA 4H75A 1BFBA 1S0LA 2Y9GA 3FJKA 3O4CA 4KC3A 3IM7A 4R6UB 5GAQA 4ZOTA 3BADA 4FVVA 4JP0A 2I1BA 4L4IA 3FJBA 3WMUA 2XOAA 4OEEA 1JTCA 5DSSB 4D0TA 4ZFUB 4HJJA 2K4AB 2R9KB 1G9BA 3K1XA 1AVAC 3VSZA 3VWCA 3TC2A 3D7WB 3VEQA 3V0AA 3IIRA 4ZLBB 4JQ0A 4LO3C 1ABRB 3UD9A 3EF2A 2BEAA 3FUOA 2BFHA 2NM1A 2Y9XE 3VT1A 1G9CA 4F83A 2NYYA 5D61A 5JLVA 2K8RA 21BIA 4F34A 2NZ9A 3A23A 3F62B 3FJ8A 3IM6A 4LO2A 3WINC 4I4UA 5BXRA 1II4A 1YXWA 2GZBA 1YF8B 5FNXA 5F8YA 4I7IA 1FWVA 2NVHA 2QN4A 4I4QA 1FQ9A 5DZUA 1W3AA 4LO7C 2D1ZA 3BA4A 4MZHA 3BA7A 4UY4A 5DVHA 4CJMA 1FGAA 4ENDA 2KH2A 2WBCA 3I2AA 41BIA 4ZBVB 3C9ZA 1WD4A 2E4MC 3AH4A 3ZC8A 2KI6B 4H9WA 4AN7B 4IYBA 3V0BA 3VT0A 1RG8A 4LO0A 3FFZA 1QQLA 3MPPG 2RQ9A 1ISXA 4DEPA 3S8KA 1AF9A 2F2FC 4OWKA 4HA2A 3AKHA 3KMVA 4LO2C 3QR5A 1PC8B 2Y9WC 4USOA 4QD2B 1G9DA 3H6SE 3BAQA 3RMYA 4I8MA 2D24A 2VLCA 5BXSA 2HWMA 1PUMB 1HCDA 3CAHA 4IONA 1DJSB 2AQZA 3V0AB 4WBCA 3WO2A 2VXTI 1EPWA 2NS2A 1RMLA 2D7IA 4AN6A 2MC2A 4I4PA 4ISRA 1ILR1 3NJ5A 2AFGA 2QYIB 3F1RA 4ZFWB 3BB2A 5G00A 2ZR1B 3CRHA 3FJ9A 1FN0A 2VSAA 5JMCA 3QYDA 4OEGA 2MLLB 4ZFYB 1S0FA 4HR6C 3WMVA 2VUAA 4IZEA 3A22A 5I1BA 2DREA 3BAGA 5EC5A 2LIQA 3N0KA 3MALA 4I3NA 4ZGRB 1S0GA 2HZ9A 3VSFA 4P0JA 5BXPA 1I1BA 1E0OA 3N7KA 1MC9A 3HSMA 4EFQA 3BTAA 4LO3A 1FMMS 2ET2A 5F8WA 1T4QA 1EVTA 5FZUA 1Z2VA 3BRGC 3V0BB 4I96A 5B2HA 3HOMA 1YTOA 4MZGB 2DS0A 1EV2A 3ZXDA 3POKA 1DIWA 3RTJB 4YOLA 3WINA 1BLDA 4J2KA 4FGFA 4J23B 1BLAA 6I1BA 2ESUA 1Q04A 1UPSA 2ZQNA 1S0DA 1V6XA 4I4OA 2DRZA 1D0HA 5FZYA 1ONKB 1T9FA 1HCEA 4QKSA 1TP0A 3BAHA 1DLLA 2Z48A 1ISYA 3BRFA 1AFCA 2E4MA 3VUOA 3OGGA 3CQAA 4IY8A 5EHAA 1V6UA 3AZVA 1ISZA 4H04A 4IQPA 1OQLB 5BOWA 4QO3A 2F2FA 3AJ6A 1DQOA 4XFTA 4DCKC 3PHZA 2X2TA 1IOBA 3FJDA 5BXTA 3ZX7A 3CA5A 4I4SA 2D44A 4X38A 3CA0A 1IJTA 3T8SA 1IRPA 1R8NA 2Y9FA 4J2SA 1XZZA 2HW9A 5D63A 3AZWA 4A7KA 3OJVA 1HWMB 4A7YA 1YYNA 3NBCA 3FJJA 1XYFA 4MZFB 2DRYA 2K43A 1BASA 1TIEA 2LIEA 3H6RA 3P53A 4D8HA 4EB2B 1M16A 2ZQOA 5F90A 4D0ZA 1PZZA 1G9AA 3W9TA 3CA1A 4ZA3B 2KLLA 4IZXA 3CA6A 3HBWA 3NBEA 4LO8B 1W3GA 1V6WA 1DQGA 1JQZA 1XG6A 3I29B 2WRYA 3NBNA 1HKNA 1DFQA 3FJEA 1L2HA 3AJ5A 3N7MA 3N7JA 1M2TB 1PUUB 2VSEA 3ILAA 1FWUA 2M49A 1HWNB 4LO7B 1BFGA 4TLPA 1DFCA 4OUJA 4JKXB 4X37A 2D23A 1WBAA 4KBBA 4GOYA 1TWEA 1YBIA 4J2XA 3N7LA 2P39A 5DUYA 1GGPB 4L4HA 4X39A 4DENA 1SR4C 2P23A 3P6JA 5FNWA 2Q9XA 3A21A 4II0A 4J2YA 4OEFA 3ZC9A 1AVWB 3Q7XA 4GP3A 2FGFA 1JY0A 5BQUC 1AXMA 2UUSA 4QC4A 4Q9GA 1J0SA 4USPA 3Q7YA 1W3FA 2FFVA 4EFRA 1AVXB 3JUTA 3O4OA 4A7ZA 1JLYA 2RG9B 2ERMA 1Q03A 2J3PA 3O5WB 1RY7A 3RSJA 4X3AA 3FJHA 3S8JA 1S0BA 2D43A 4QALA 2GO2A 4GAFA 4ZKTB 4I4VA 4OWLA 3H6RB 3P6IA 1Z0HA 4OWJA 1HWPB 4QBCA 4I37A 5EG6C 5FZZA 4I1EA 3PUBA 4OW4A 2D7RA 4LO1C 3R4UA 3Q7WA 3BX1C 4JPZA 1BA7A 4G6JA 2F8XC 1BARA 3AH2A 4G1RA 1TTUA 3A07A 4I1BA 3BAUA 3FJAA 3IAGC 3FJIA 1N4KA 3WO4A 1QQKA 3LTQA 3OBTA 1MD6A 4ISQA 4G9NA 4IHZA 1R8OA 2D20A 3CA4A 3HMYA 2FDBM 2FFUA 1Q1UA 3CU1B 4XKIA 1PWAA 4EEEB 3IM5A 2IHOA 3UD7A 4I4YA 1BFCA 1VCLA 2AAIB 3LLPA 5D62A 1S0EA 4GOVA 4Q91A 1JT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFM B;  3VT2 A;  4JKQ A;  4KEK A;  1JT5 A;  4EFP A;  1S0C A;  1SZ6 B;  3BAV A;  4I4X A;  3E8L C;  3HAL A;  1NUN A;  1IHK A;  2NTD A;  2NP0 A;  5HPZ A;  3OJM A;  2KKI A;  4Q9P A;  1JLX A;  3BAO A;  1FV2 A;  2KI4 A;  1G82 A;  5BP5 C;  3CRG A;  1EYL A;  1F31 A;  3RMX A;  1FV3 A;  3B9U A;  1BFF A;  3WO3 A;  1ITB A;  1SR4 A;  4QBV A;  5E24 E;  4G6M A;  4QD2 C;  1ISW A;  5BVP I;  5BQU A;  2BEB A;  3CA3 A;  4Z8S B;  4QKR A;  3OJ2 A;  3O3Q A;  8I1B A;  2X2S A;  3PG0 A;  3BA5 A;  2L5X A;  2Z49 A;  1V6V A;  3V79 C;  4I2S A;  3O44 A;  3SNV A;  1TWM A;  1I1E A;  3UJ0 A;  1HWO B;  1IRA X;  2VXR A;  3ZXG A;  1AVU A;  4I0Y A;  1CE7 B;  3HN1 A;  4I6I A;  9ILB A;  4IY9 A;  4Z9W B;  4G9M A;  3I2X A;  1XHB A;  3FGM A;  5F8S A;  4JAW A;  1TOO A;  1JT4 A;  3OBR A;  2HWA A;  2MIB A;  1K5V A;  4LO1 A;  2RST A;  1IIL A;  3RTI B;  1RZO B;  4P6A A;  4XFS A;  2Q3N B;  4I4R A;  1WD3 A;  3AKI A;  3R4S A;  1JT3 A;  4PC4 A;  2IWT B;  1DZD A;  2FO1 A;  3FUQ A;  3OGF A;  1CVS A;  4LO0 C;  4EKX B;  7I1B A;  3AKF A;  1ISV A;  3O4B A;  4P0K A;  3UDA A;  2D22 A;  3BRD A;  3O4A A;  31BI A;  3JRR A;  3PME A;  1DZC A;  4XFU A;  3NBD A;  2AXM A;  1NZK A;  1A8D A;  3O49 A;  1P63 A;  4GP0 A;  1WBC A;  2VU9 A;  3AKG A;  1Z4S A;  3UD8 A;  2YUG A;  1KNM A;  3H6Q A;  4GAI A;  4KEI A;  3UJ4 A;  3CRI A;  1K5U A;  4JRA A;  1HIB A;  1QXM A;  3FJC A;  3O4D A;  3WA1 A;  1IT0 A;  1FMZ A;  3AH1 A;  3FJF A;  4KEJ A;  5BP5 A;  4P0L A;  1BFB A;  1S0L A;  2Y9G A;  3FJK A;  3O4C A;  4KC3 A;  3IM7 A;  4R6U B;  5GAQ A;  4ZOT A;  3BAD A;  4FVV A;  4JP0 A;  2I1B A;  4L4I A;  3FJB A;  3WMU A;  2XOA A;  4OEE A;  1JTC A;  5DSS B;  4D0T A;  4ZFU B;  4HJJ A;  2K4A B;  2R9K B;  1G9B A;  3K1X A;  1AVA C;  3VSZ A;  3VWC A;  3TC2 A;  3D7W B;  3VEQ A;  3V0A A;  3IIR A;  4ZLB B;  4JQ0 A;  4LO3 C;  1ABR B;  3UD9 A;  3EF2 A;  2BEA A;  3FUO A;  2BFH A;  2NM1 A;  2Y9X E;  3VT1 A;  1G9C A;  4F83 A;  2NYY A;  5D61 A;  5JLV A;  2K8R A;  21BI A;  4F34 A;  2NZ9 A;  3A23 A;  3F62 B;  3FJ8 A;  3IM6 A;  4LO2 A;  3WIN C;  4I4U A;  5BXR A;  1II4 A;  1YXW A;  2GZB A;  1YF8 B;  5FNX A;  5F8Y A;  4I7I A;  1FWV A;  2NVH A;  2QN4 A;  4I4Q A;  1FQ9 A;  5DZU A;  1W3A A;  4LO7 C;  2D1Z A;  3BA4 A;  3BA7 A;  5DVH A;  4CJM A;  4END A;  1FGA A;  2KH2 A;  2WBC A;  3I2A A;  41BI A;  4ZBV B;  3C9Z A;  1WD4 A;  2E4M C;  3AH4 A;  3ZC8 A;  2KI6 B;  4H9W A;  4AN7 B;  4IYB A;  3V0B A;  3VT0 A;  1RG8 A;  4LO0 A;  3FFZ A;  1QQL A;  3MPP G;  2RQ9 A;  1ISX A;  4DEP A;  3S8K A;  1AF9 A;  2F2F C;  4OWK A;  4HA2 A;  3AKH A;  3KMV A;  4LO2 C;  3QR5 A;  1PC8 B;  2Y9W C;  4USO A;  4QD2 B;  1G9D A;  3H6S E;  3BAQ A;  3RMY A;  4I8M A;  2D24 A;  2VLC A;  5BXS A;  2HWM A;  1PUM B;  1HCD A;  3CAH A;  4ION A;  1DJS B;  2AQZ A;  3V0A B;  4WBC A;  3WO2 A;  2VXT I;  1EPW A;  1RML A;  2D7I A;  4AN6 A;  2MC2 A;  4I4P A;  4ISR A;  1ILR 1;  3NJ5 A;  2AFG A;  2QYI B;  3F1R A;  4ZFW B;  3BB2 A;  5G00 A;  2ZR1 B;  3CRH A;  3FJ9 A;  1FN0 A;  2VSA A;  5JMC A;  3QYD A;  4OEG A;  2MLL B;  4ZFY B;  1S0F A;  4HR6 C;  3WMV A;  2VUA A;  4IZE A;  3A22 A;  5I1B A;  2DRE A;  3BAG A;  5EC5 A;  2LIQ A;  3N0K A;  3MAL A;  4I3N A;  4ZGR B;  1S0G A;  2HZ9 A;  3VSF A;  4P0J A;  5BXP A;  1I1B A;  1E0O A;  3N7K A;  1MC9 A;  3HSM A;  4EFQ A;  3BTA A;  4LO3 A;  1FMM S;  2ET2 A;  5F8W A;  1T4Q A;  1EVT A;  5FZU A;  1Z2V A;  3BRG C;  3V0B B;  4I96 A;  5B2H A;  3HOM A;  1YTO A;  2DS0 A;  1EV2 A;  3ZXD A;  3POK A;  1DIW A;  3RTJ B;  4YOL A;  3WIN A;  1BLD A;  4J2K A;  4FGF A;  4J23 B;  1BLA A;  6I1B A;  2ESU A;  1Q04 A;  1UPS A;  2ZQN A;  1S0D A;  1V6X A;  4I4O A;  2DRZ A;  1D0H A;  5FZY A;  1ONK B;  1T9F A;  1HCE A;  4QKS A;  1TP0 A;  3BAH A;  1DLL A;  2Z48 A;  1ISY A;  3BRF A;  1AFC A;  2E4M A;  3VUO A;  3OGG A;  3CQA A;  4IY8 A;  5EHA A;  1V6U A;  3AZV A;  1ISZ A;  4H04 A;  4IQP A;  1OQL B;  5BOW A;  4QO3 A;  2F2F A;  3AJ6 A;  1DQO A;  4XFT A;  4DCK C;  3PHZ A;  2X2T A;  1IOB A;  3FJD A;  5BXT A;  3ZX7 A;  3CA5 A;  4I4S A;  2D44 A;  4X38 A;  3CA0 A;  1IJT A;  3T8S A;  1IRP A;  1R8N A;  2Y9F A;  4J2S A;  1XZZ A;  2HW9 A;  5D63 A;  3AZW A;  4A7K A;  3OJV A;  1HWM B;  4A7Y A;  1YYN A;  3NBC A;  3FJJ A;  1XYF A;  2DRY A;  2K43 A;  1BAS A;  1TIE A;  2LIE A;  3H6R A;  3P53 A;  4D8H A;  4EB2 B;  1M16 A;  2ZQO A;  5F90 A;  4D0Z A;  1PZZ A;  1G9A A;  3W9T A;  3CA1 A;  4ZA3 B;  2KLL A;  4IZX A;  3CA6 A;  3HBW A;  3NBE A;  4LO8 B;  1W3G A;  1V6W A;  1DQG A;  1JQZ A;  1XG6 A;  3I29 B;  2WRY A;  3NBN A;  1HKN A;  1DFQ A;  3FJE A;  1L2H A;  3AJ5 A;  3N7M A;  3N7J A;  1M2T B;  1PUU B;  2VSE A;  3ILA A;  1FWU A;  2M49 A;  1HWN B;  4LO7 B;  1BFG A;  4TLP A;  1DFC A;  4OUJ A;  4JKX B;  4X37 A;  2D23 A;  1WBA A;  4KBB A;  4GOY A;  1TWE A;  1YBI A;  4J2X A;  3N7L A;  2P39 A;  5DUY A;  1GGP B;  4L4H A;  4X39 A;  4DEN A;  1SR4 C;  2P23 A;  3P6J A;  5FNW A;  2Q9X A;  3A21 A;  4II0 A;  4J2Y A;  4OEF A;  3ZC9 A;  1AVW B;  3Q7X A;  4GP3 A;  2FGF A;  1JY0 A;  5BQU C;  1AXM A;  2UUS A;  4QC4 A;  4Q9G A;  1J0S A;  4USP A;  3Q7Y A;  1W3F A;  2FFV A;  4EFR A;  1AVX B;  3JUT A;  3O4O A;  4A7Z A;  1JLY A;  2RG9 B;  2ERM A;  1Q03 A;  2J3P A;  3O5W B;  1RY7 A;  3RSJ A;  4X3A A;  3FJH A;  3S8J A;  1S0B A;  2D43 A;  4QAL A;  2GO2 A;  4GAF A;  4ZKT B;  4I4V A;  4OWL A;  3H6R B;  3P6I A;  1Z0H A;  4OWJ A;  1HWP B;  4QBC A;  4I37 A;  5EG6 C;  5FZZ A;  4I1E A;  3PUB A;  4OW4 A;  2D7R A;  4LO1 C;  3R4U A;  3Q7W A;  3BX1 C;  4JPZ A;  1BA7 A;  4G6J A;  2F8X C;  1BAR A;  3AH2 A;  4G1R A;  1TTU A;  3A07 A;  4I1B A;  3BAU A;  3FJA A;  3IAG C;  3FJI A;  1N4K A;  3WO4 A;  1QQK A;  3LTQ A;  3OBT A;  1MD6 A;  4ISQ A;  4G9N A;  4IHZ A;  1R8O A;  2D20 A;  3CA4 A;  3HMY A;  2FDB M;  2FFU A;  1Q1U A;  3CU1 B;  4XKI A;  1PWA A;  4EEE B;  3IM5 A;  2IHO A;  3UD7 A;  4I4Y A;  1BFC A;  1VCL A;  2AAI B;  3LLP A;  5D62 A;  1S0E A;  4GOV A;  4Q91 A;  1JT7 A; 
#chains in the Genus database with same CATH topology
 1TFM B;  3VT2 A;  4JKQ A;  4KEK A;  1JT5 A;  4EFP A;  1S0C A;  1SZ6 B;  3BAV A;  4I4X A;  3E8L C;  3HAL A;  1NUN A;  1IHK A;  2NTD A;  2NP0 A;  5HPZ A;  3OJM A;  2KKI A;  4Q9P A;  1JLX A;  3BAO A;  1FV2 A;  2KI4 A;  1G82 A;  5BP5 C;  3CRG A;  1EYL A;  1F31 A;  3RMX A;  1FV3 A;  3B9U A;  1BFF A;  3WO3 A;  1ITB A;  1SR4 A;  4QBV A;  5E24 E;  4G6M A;  4QD2 C;  1ISW A;  5BVP I;  5BQU A;  2BEB A;  3CA3 A;  4Z8S B;  4QKR A;  3OJ2 A;  3O3Q A;  8I1B A;  2X2S A;  3PG0 A;  3BA5 A;  2L5X A;  2Z49 A;  1V6V A;  3V79 C;  4I2S A;  3O44 A;  3SNV A;  1TWM A;  1I1E A;  3UJ0 A;  1HWO B;  1IRA X;  2VXR A;  3ZXG A;  1AVU A;  4I0Y A;  1CE7 B;  3HN1 A;  4I6I A;  9ILB A;  4IY9 A;  4Z9W B;  4G9M A;  3I2X A;  1XHB A;  3FGM A;  5F8S A;  4JAW A;  1TOO A;  1JT4 A;  3OBR A;  2HWA A;  2MIB A;  1K5V A;  4LO1 A;  2RST A;  1IIL A;  3RTI B;  1RZO B;  4P6A A;  4XFS A;  2Q3N B;  4I4R A;  1WD3 A;  3AKI A;  3R4S A;  1JT3 A;  4PC4 A;  2IWT B;  1DZD A;  2FO1 A;  3FUQ A;  3OGF A;  1CVS A;  4LO0 C;  4EKX B;  7I1B A;  3AKF A;  1ISV A;  3O4B A;  4P0K A;  3UDA A;  2D22 A;  3BRD A;  3O4A A;  31BI A;  3JRR A;  3PME A;  1DZC A;  4XFU A;  3NBD A;  2AXM A;  1NZK A;  1A8D A;  3O49 A;  1P63 A;  4GP0 A;  1WBC A;  2VU9 A;  3AKG A;  1Z4S A;  3UD8 A;  2YUG A;  1KNM A;  3H6Q A;  4GAI A;  4KEI A;  3UJ4 A;  3CRI A;  1K5U A;  4JRA A;  1HIB A;  1QXM A;  3FJC A;  3O4D A;  3WA1 A;  1IT0 A;  1FMZ A;  3AH1 A;  3FJF A;  4KEJ A;  5BP5 A;  4P0L A;  4H75 A;  1BFB A;  1S0L A;  2Y9G A;  3FJK A;  3O4C A;  4KC3 A;  3IM7 A;  4R6U B;  5GAQ A;  4ZOT A;  3BAD A;  4FVV A;  4JP0 A;  2I1B A;  4L4I A;  3FJB A;  3WMU A;  2XOA A;  4OEE A;  1JTC A;  5DSS B;  4D0T A;  4ZFU B;  4HJJ A;  2K4A B;  2R9K B;  1G9B A;  3K1X A;  1AVA C;  3VSZ A;  3VWC A;  3TC2 A;  3D7W B;  3VEQ A;  3V0A A;  3IIR A;  4ZLB B;  4JQ0 A;  4LO3 C;  1ABR B;  3UD9 A;  3EF2 A;  2BEA A;  3FUO A;  2BFH A;  2NM1 A;  2Y9X E;  3VT1 A;  1G9C A;  4F83 A;  2NYY A;  5D61 A;  5JLV A;  2K8R A;  21BI A;  4F34 A;  2NZ9 A;  3A23 A;  3F62 B;  3FJ8 A;  3IM6 A;  4LO2 A;  3WIN C;  4I4U A;  5BXR A;  1II4 A;  1YXW A;  2GZB A;  1YF8 B;  5FNX A;  5F8Y A;  4I7I A;  1FWV A;  2NVH A;  2QN4 A;  4I4Q A;  1FQ9 A;  5DZU A;  1W3A A;  4LO7 C;  2D1Z A;  3BA4 A;  4MZH A;  3BA7 A;  4UY4 A;  5DVH A;  4CJM A;  1FGA A;  4END A;  2KH2 A;  2WBC A;  3I2A A;  41BI A;  4ZBV B;  3C9Z A;  1WD4 A;  2E4M C;  3AH4 A;  3ZC8 A;  2KI6 B;  4H9W A;  4AN7 B;  4IYB A;  3V0B A;  3VT0 A;  1RG8 A;  4LO0 A;  3FFZ A;  1QQL A;  3MPP G;  2RQ9 A;  1ISX A;  4DEP A;  3S8K A;  1AF9 A;  2F2F C;  4OWK A;  4HA2 A;  3AKH A;  3KMV A;  4LO2 C;  3QR5 A;  1PC8 B;  2Y9W C;  4USO A;  4QD2 B;  1G9D A;  3H6S E;  3BAQ A;  3RMY A;  4I8M A;  2D24 A;  2VLC A;  5BXS A;  2HWM A;  1PUM B;  1HCD A;  3CAH A;  4ION A;  1DJS B;  2AQZ A;  3V0A B;  4WBC A;  3WO2 A;  2VXT I;  1EPW A;  2NS2 A;  1RML A;  2D7I A;  4AN6 A;  2MC2 A;  4I4P A;  4ISR A;  1ILR 1;  3NJ5 A;  2AFG A;  2QYI B;  3F1R A;  4ZFW B;  3BB2 A;  5G00 A;  2ZR1 B;  3CRH A;  3FJ9 A;  1FN0 A;  2VSA A;  5JMC A;  3QYD A;  4OEG A;  2MLL B;  4ZFY B;  1S0F A;  4HR6 C;  3WMV A;  2VUA A;  4IZE A;  3A22 A;  5I1B A;  2DRE A;  3BAG A;  5EC5 A;  2LIQ A;  3N0K A;  3MAL A;  4I3N A;  4ZGR B;  1S0G A;  2HZ9 A;  3VSF A;  4P0J A;  5BXP A;  1I1B A;  1E0O A;  3N7K A;  1MC9 A;  3HSM A;  4EFQ A;  3BTA A;  4LO3 A;  1FMM S;  2ET2 A;  5F8W A;  1T4Q A;  1EVT A;  5FZU A;  1Z2V A;  3BRG C;  3V0B B;  4I96 A;  5B2H A;  3HOM A;  1YTO A;  4MZG B;  2DS0 A;  1EV2 A;  3ZXD A;  3POK A;  1DIW A;  3RTJ B;  4YOL A;  3WIN A;  1BLD A;  4J2K A;  4FGF A;  4J23 B;  1BLA A;  6I1B A;  2ESU A;  1Q04 A;  1UPS A;  2ZQN A;  1S0D A;  1V6X A;  4I4O A;  2DRZ A;  1D0H A;  5FZY A;  1ONK B;  1T9F A;  1HCE A;  4QKS A;  1TP0 A;  3BAH A;  1DLL A;  2Z48 A;  1ISY A;  3BRF A;  1AFC A;  2E4M A;  3VUO A;  3OGG A;  3CQA A;  4IY8 A;  5EHA A;  1V6U A;  3AZV A;  1ISZ A;  4H04 A;  4IQP A;  1OQL B;  5BOW A;  4QO3 A;  2F2F A;  3AJ6 A;  1DQO A;  4XFT A;  4DCK C;  3PHZ A;  2X2T A;  1IOB A;  3FJD A;  5BXT A;  3ZX7 A;  3CA5 A;  4I4S A;  2D44 A;  4X38 A;  3CA0 A;  1IJT A;  3T8S A;  1IRP A;  1R8N A;  2Y9F A;  4J2S A;  1XZZ A;  2HW9 A;  5D63 A;  3AZW A;  4A7K A;  3OJV A;  1HWM B;  4A7Y A;  1YYN A;  3NBC A;  3FJJ A;  1XYF A;  4MZF B;  2DRY A;  2K43 A;  1BAS A;  1TIE A;  2LIE A;  3H6R A;  3P53 A;  4D8H A;  4EB2 B;  1M16 A;  2ZQO A;  5F90 A;  4D0Z A;  1PZZ A;  1G9A A;  3W9T A;  3CA1 A;  4ZA3 B;  2KLL A;  4IZX A;  3CA6 A;  3HBW A;  3NBE A;  4LO8 B;  1W3G A;  1V6W A;  1DQG A;  1JQZ A;  1XG6 A;  3I29 B;  2WRY A;  3NBN A;  1HKN A;  1DFQ A;  3FJE A;  1L2H A;  3AJ5 A;  3N7M A;  3N7J A;  1M2T B;  1PUU B;  2VSE A;  3ILA A;  1FWU A;  2M49 A;  1HWN B;  4LO7 B;  1BFG A;  4TLP A;  1DFC A;  4OUJ A;  4JKX B;  4X37 A;  2D23 A;  1WBA A;  4KBB A;  4GOY A;  1TWE A;  1YBI A;  4J2X A;  3N7L A;  2P39 A;  5DUY A;  1GGP B;  4L4H A;  4X39 A;  4DEN A;  1SR4 C;  2P23 A;  3P6J A;  5FNW A;  2Q9X A;  3A21 A;  4II0 A;  4J2Y A;  4OEF A;  3ZC9 A;  1AVW B;  3Q7X A;  4GP3 A;  2FGF A;  1JY0 A;  5BQU C;  1AXM A;  2UUS A;  4QC4 A;  4Q9G A;  1J0S A;  4USP A;  3Q7Y A;  1W3F A;  2FFV A;  4EFR A;  1AVX B;  3JUT A;  3O4O A;  4A7Z A;  1JLY A;  2RG9 B;  2ERM A;  1Q03 A;  2J3P A;  3O5W B;  1RY7 A;  3RSJ A;  4X3A A;  3FJH A;  3S8J A;  1S0B A;  2D43 A;  4QAL A;  2GO2 A;  4GAF A;  4ZKT B;  4I4V A;  4OWL A;  3H6R B;  3P6I A;  1Z0H A;  4OWJ A;  1HWP B;  4QBC A;  4I37 A;  5EG6 C;  5FZZ A;  4I1E A;  3PUB A;  4OW4 A;  2D7R A;  4LO1 C;  3R4U A;  3Q7W A;  3BX1 C;  4JPZ A;  1BA7 A;  4G6J A;  2F8X C;  1BAR A;  3AH2 A;  4G1R A;  1TTU A;  3A07 A;  4I1B A;  3BAU A;  3FJA A;  3IAG C;  3FJI A;  1N4K A;  3WO4 A;  1QQK A;  3LTQ A;  3OBT A;  1MD6 A;  4ISQ A;  4G9N A;  4IHZ A;  1R8O A;  2D20 A;  3CA4 A;  3HMY A;  2FDB M;  2FFU A;  1Q1U A;  3CU1 B;  4XKI A;  1PWA A;  4EEE B;  3IM5 A;  2IHO A;  3UD7 A;  4I4Y A;  1BFC A;  1VCL A;  2AAI B;  3LLP A;  5D62 A;  1S0E A;  4GOV A;  4Q91 A;  1JT7 A; 
#chains in the Genus database with same CATH homology
 1TFM B;  3VT2 A;  4JKQ A;  4KEK A;  1JT5 A;  4EFP A;  1S0C A;  1SZ6 B;  3BAV A;  4I4X A;  3E8L C;  3HAL A;  1NUN A;  1IHK A;  2NTD A;  2NP0 A;  5HPZ A;  3OJM A;  2KKI A;  4Q9P A;  1JLX A;  3BAO A;  1FV2 A;  2KI4 A;  1G82 A;  5BP5 C;  3CRG A;  1EYL A;  1F31 A;  3RMX A;  1FV3 A;  3B9U A;  1BFF A;  3WO3 A;  1ITB A;  1SR4 A;  4QBV A;  5E24 E;  4G6M A;  4QD2 C;  1ISW A;  5BVP I;  5BQU A;  2BEB A;  3CA3 A;  4Z8S B;  4QKR A;  3OJ2 A;  3O3Q A;  8I1B A;  2X2S A;  3PG0 A;  3BA5 A;  2L5X A;  2Z49 A;  1V6V A;  3V79 C;  4I2S A;  3O44 A;  3SNV A;  1TWM A;  1I1E A;  3UJ0 A;  1HWO B;  1IRA X;  2VXR A;  3ZXG A;  1AVU A;  4I0Y A;  1CE7 B;  3HN1 A;  4I6I A;  9ILB A;  4IY9 A;  4Z9W B;  4G9M A;  3I2X A;  1XHB A;  3FGM A;  5F8S A;  4JAW A;  1TOO A;  1JT4 A;  3OBR A;  2HWA A;  2MIB A;  1K5V A;  4LO1 A;  2RST A;  1IIL A;  3RTI B;  1RZO B;  4P6A A;  4XFS A;  2Q3N B;  4I4R A;  1WD3 A;  3AKI A;  3R4S A;  1JT3 A;  4PC4 A;  2IWT B;  1DZD A;  2FO1 A;  3FUQ A;  3OGF A;  1CVS A;  4LO0 C;  4EKX B;  7I1B A;  3AKF A;  1ISV A;  3O4B A;  4P0K A;  3UDA A;  2D22 A;  3BRD A;  3O4A A;  31BI A;  3JRR A;  3PME A;  1DZC A;  4XFU A;  3NBD A;  2AXM A;  1NZK A;  1A8D A;  3O49 A;  1P63 A;  4GP0 A;  1WBC A;  2VU9 A;  3AKG A;  1Z4S A;  3UD8 A;  2YUG A;  1KNM A;  3H6Q A;  4GAI A;  4KEI A;  3UJ4 A;  3CRI A;  1K5U A;  4JRA A;  1HIB A;  1QXM A;  3FJC A;  3O4D A;  3WA1 A;  1IT0 A;  1FMZ A;  3AH1 A;  3FJF A;  4KEJ A;  5BP5 A;  4P0L A;  4H75 A;  1BFB A;  1S0L A;  2Y9G A;  3FJK A;  3O4C A;  4KC3 A;  3IM7 A;  4R6U B;  5GAQ A;  4ZOT A;  3BAD A;  4FVV A;  4JP0 A;  2I1B A;  4L4I A;  3FJB A;  3WMU A;  2XOA A;  4OEE A;  1JTC A;  5DSS B;  4D0T A;  4ZFU B;  4HJJ A;  2K4A B;  2R9K B;  1G9B A;  3K1X A;  1AVA C;  3VSZ A;  3VWC A;  3TC2 A;  3D7W B;  3VEQ A;  3V0A A;  3IIR A;  4ZLB B;  4JQ0 A;  4LO3 C;  1ABR B;  3UD9 A;  3EF2 A;  2BEA A;  3FUO A;  2BFH A;  2NM1 A;  2Y9X E;  3VT1 A;  1G9C A;  4F83 A;  2NYY A;  5D61 A;  5JLV A;  2K8R A;  21BI A;  4F34 A;  2NZ9 A;  3A23 A;  3F62 B;  3FJ8 A;  3IM6 A;  4LO2 A;  3WIN C;  4I4U A;  5BXR A;  1II4 A;  1YXW A;  2GZB A;  1YF8 B;  5FNX A;  5F8Y A;  4I7I A;  1FWV A;  2NVH A;  2QN4 A;  4I4Q A;  1FQ9 A;  5DZU A;  1W3A A;  4LO7 C;  2D1Z A;  3BA4 A;  4MZH A;  3BA7 A;  4UY4 A;  5DVH A;  4CJM A;  1FGA A;  4END A;  2KH2 A;  2WBC A;  3I2A A;  41BI A;  4ZBV B;  3C9Z A;  1WD4 A;  2E4M C;  3AH4 A;  3ZC8 A;  2KI6 B;  4H9W A;  4AN7 B;  4IYB A;  3V0B A;  3VT0 A;  1RG8 A;  4LO0 A;  3FFZ A;  1QQL A;  3MPP G;  2RQ9 A;  1ISX A;  4DEP A;  3S8K A;  1AF9 A;  2F2F C;  4OWK A;  4HA2 A;  3AKH A;  3KMV A;  4LO2 C;  3QR5 A;  1PC8 B;  2Y9W C;  4USO A;  4QD2 B;  1G9D A;  3H6S E;  3BAQ A;  3RMY A;  4I8M A;  2D24 A;  2VLC A;  5BXS A;  2HWM A;  1PUM B;  1HCD A;  3CAH A;  4ION A;  1DJS B;  2AQZ A;  3V0A B;  4WBC A;  3WO2 A;  2VXT I;  1EPW A;  2NS2 A;  1RML A;  2D7I A;  4AN6 A;  2MC2 A;  4I4P A;  4ISR A;  1ILR 1;  3NJ5 A;  2AFG A;  2QYI B;  3F1R A;  4ZFW B;  3BB2 A;  5G00 A;  2ZR1 B;  3CRH A;  3FJ9 A;  1FN0 A;  2VSA A;  5JMC A;  3QYD A;  4OEG A;  2MLL B;  4ZFY B;  1S0F A;  4HR6 C;  3WMV A;  2VUA A;  4IZE A;  3A22 A;  5I1B A;  2DRE A;  3BAG A;  5EC5 A;  2LIQ A;  3N0K A;  3MAL A;  4I3N A;  4ZGR B;  1S0G A;  2HZ9 A;  3VSF A;  4P0J A;  5BXP A;  1I1B A;  1E0O A;  3N7K A;  1MC9 A;  3HSM A;  4EFQ A;  3BTA A;  4LO3 A;  1FMM S;  2ET2 A;  5F8W A;  1T4Q A;  1EVT A;  5FZU A;  1Z2V A;  3BRG C;  3V0B B;  4I96 A;  5B2H A;  3HOM A;  1YTO A;  4MZG B;  2DS0 A;  1EV2 A;  3ZXD A;  3POK A;  1DIW A;  3RTJ B;  4YOL A;  3WIN A;  1BLD A;  4J2K A;  4FGF A;  4J23 B;  1BLA A;  6I1B A;  2ESU A;  1Q04 A;  1UPS A;  2ZQN A;  1S0D A;  1V6X A;  4I4O A;  2DRZ A;  1D0H A;  5FZY A;  1ONK B;  1T9F A;  1HCE A;  4QKS A;  1TP0 A;  3BAH A;  1DLL A;  2Z48 A;  1ISY A;  3BRF A;  1AFC A;  2E4M A;  3VUO A;  3OGG A;  3CQA A;  4IY8 A;  5EHA A;  1V6U A;  3AZV A;  1ISZ A;  4H04 A;  4IQP A;  1OQL B;  5BOW A;  4QO3 A;  2F2F A;  3AJ6 A;  1DQO A;  4XFT A;  4DCK C;  3PHZ A;  2X2T A;  1IOB A;  3FJD A;  5BXT A;  3ZX7 A;  3CA5 A;  4I4S A;  2D44 A;  4X38 A;  3CA0 A;  1IJT A;  3T8S A;  1IRP A;  1R8N A;  2Y9F A;  4J2S A;  1XZZ A;  2HW9 A;  5D63 A;  3AZW A;  4A7K A;  3OJV A;  1HWM B;  4A7Y A;  1YYN A;  3NBC A;  3FJJ A;  1XYF A;  4MZF B;  2DRY A;  2K43 A;  1BAS A;  1TIE A;  2LIE A;  3H6R A;  3P53 A;  4D8H A;  4EB2 B;  1M16 A;  2ZQO A;  5F90 A;  4D0Z A;  1PZZ A;  1G9A A;  3W9T A;  3CA1 A;  4ZA3 B;  2KLL A;  4IZX A;  3CA6 A;  3HBW A;  3NBE A;  4LO8 B;  1W3G A;  1V6W A;  1DQG A;  1JQZ A;  1XG6 A;  3I29 B;  2WRY A;  3NBN A;  1HKN A;  1DFQ A;  3FJE A;  1L2H A;  3AJ5 A;  3N7M A;  3N7J A;  1M2T B;  1PUU B;  2VSE A;  3ILA A;  1FWU A;  2M49 A;  1HWN B;  4LO7 B;  1BFG A;  4TLP A;  1DFC A;  4OUJ A;  4JKX B;  4X37 A;  2D23 A;  1WBA A;  4KBB A;  4GOY A;  1TWE A;  1YBI A;  4J2X A;  3N7L A;  2P39 A;  5DUY A;  1GGP B;  4L4H A;  4X39 A;  4DEN A;  1SR4 C;  2P23 A;  3P6J A;  5FNW A;  2Q9X A;  3A21 A;  4II0 A;  4J2Y A;  4OEF A;  3ZC9 A;  1AVW B;  3Q7X A;  4GP3 A;  2FGF A;  1JY0 A;  5BQU C;  1AXM A;  2UUS A;  4QC4 A;  4Q9G A;  1J0S A;  4USP A;  3Q7Y A;  1W3F A;  2FFV A;  4EFR A;  1AVX B;  3JUT A;  3O4O A;  4A7Z A;  1JLY A;  2RG9 B;  2ERM A;  1Q03 A;  2J3P A;  3O5W B;  1RY7 A;  3RSJ A;  4X3A A;  3FJH A;  3S8J A;  1S0B A;  2D43 A;  4QAL A;  2GO2 A;  4GAF A;  4ZKT B;  4I4V A;  4OWL A;  3H6R B;  3P6I A;  1Z0H A;  4OWJ A;  1HWP B;  4QBC A;  4I37 A;  5EG6 C;  5FZZ A;  4I1E A;  3PUB A;  4OW4 A;  2D7R A;  4LO1 C;  3R4U A;  3Q7W A;  3BX1 C;  4JPZ A;  1BA7 A;  4G6J A;  2F8X C;  1BAR A;  3AH2 A;  4G1R A;  1TTU A;  3A07 A;  4I1B A;  3BAU A;  3FJA A;  3IAG C;  3FJI A;  1N4K A;  3WO4 A;  1QQK A;  3LTQ A;  3OBT A;  1MD6 A;  4ISQ A;  4G9N A;  4IHZ A;  1R8O A;  2D20 A;  3CA4 A;  3HMY A;  2FDB M;  2FFU A;  1Q1U A;  3CU1 B;  4XKI A;  1PWA A;  4EEE B;  3IM5 A;  2IHO A;  3UD7 A;  4I4Y A;  1BFC A;  1VCL A;  2AAI B;  3LLP A;  5D62 A;  1S0E A;  4GOV A;  4Q91 A;  1JT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...