2I1LA

Crystal structure of the c2 form of fad synthetase from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
289
structure length
267
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 62
structure length 267
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2i1lA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2i1lA01
4I6JA 1KKUA 2VXOA 3S3TA 3SZ3A 1IH8A 1MOPA 2HZ7A 4NDAA 1U3CA 1U7DA 1VL2A 5KCMA 2HMAA 4MVYA 5AHWA 4L2IA 2J5BA 1WOYA 2YWBA 3NV7A 1PFWA 4CT0A 4JYZA 1R6TA 2ZP1A 3CVVA 4K03A 4DDHA 4MWCA 3ILVA 1N08A 3PXUA 1OWOA 1NUTA 1NB0A 1H3NA 1KR2A 1MAWA 3IMCA 3FDXA 4R2MA 2H2AA 4U7JA 4MW2A 4YP6A 2BTEA 1S4MA 4Q16A 4ZT4A 3TS1A 3FOCA 1G8HA 2GM3A 2JAXA 1G8FA 3KT8A 4I6EA 5FNZA 3IMEA 4PBSA 1JEEA 3X1JA 4F4HA 4YMIA 4MVWA 4WSOA 3KT0A 3ISJA 1K97A 4YBRA 3G6KA 2X3FA 3AFHA 1HYBA 1N2IA 2WB2A 4MW1A 2QJFA 1N2JA 1H3EA 1KQNA 3E27A 4AQ7A 2J08A 2VBSA 3PNBA 1WXHA 4GU5A 5HG0A 1EFVB 3ND7A 5EKDA 4ZT7A 4ZCSA 5DB4A 1N77A 2DPLA 4DLPA 4MUKA 2IP1A 3OTWA 2DXIA 1JMVA 2DR2A 2JA2A 3IOEA 2V0GA 3N8HA 2V0CA 3H97A 1N75A 4EG7A 1WKBA 4ZT6A 4HPWA 2CSXA 2QUHA 3K32A 3HGMA 2CV0A 2AKEA 1JECA 4XFJA 1MRZA 3H9CA 1OD6A 1COZA 1T6ZA 1NUQA 1KH2A 4PBTA 3COVA 3N9IA 5A88A 4NX2A 1BS2A 1TFUA 4ZCQA 1I6KA 1NP7A 2CFOA 4OUDB 1JZSA 4EG3A 1JZQA 3IOBA 4UZFA 3MLBA 5J59A 3Q10A 1EFPB 3FY4A 3OP1A 1WXEA 1H1TA 1O97D 1OWPA 4FZJA 2A7XA 5TRDA 1N07A 1WJGA 1O97C 1TYCA 3LE8A 4E1AA 4EG5A 4ARCA 1TYAE 3HV0A 1V47A 1PFVA 4G5YA 1QNFA 2CYAA 1GLNA 2OQ2A 3BL5A 3DLAA 3Q12A 2P3MA 3D6UA 2NSYA 3ZIUA 5H16A 1VBNA 4NZPA 2DUMA 1T6XA 4F3RA 2AG6A 1MJHA 1J1UA 5TEWA 1WXGA 1QQTA 3N2YA 1MAUA 3X1KA 5J58A 3TZEA 2QTNA 2E21A 4DE5A 3IVGA 1J09A 2IELA 2VBTA 1M8KA 1Q15A 1YIAA 2QTMA 2CV2A 2WQ7A 1N2HA 2A1UA 1UFVA 3COYA 4MVXA 5LLTA 2VTBB 1IVSA 3UY4A 1ULHA 2QUKA 5TEVA 1GAXA 2ZUEA 4CDMA 3ZJVA 5A8AA 1QU2A 1Q19A 5DASA 1NI5A 3IH5A 2HGZA 2WQ6A 2G36A 3MLAA 1YIDA 3RBAA 3FWKA 3MXTA 2ZUFA 5TGTA 1O95D 3QTBA 3CLSD 2D13A 1IHOA 3CLSC 4J75A 3VGJA 4KPUB 2O8VA 4JXXA 3CR8A 3KT6A 3D6VA 3TZLA 4MUGA 1N06A 5H7XA 3UK2A 4EF6A 4MWDA 4EGAA 1GZUA 1G59A 2A4MA 3BNWA 3ND6A 4MULA 2E89A 1KORA 3ELBA 4JFAA 1JHDA 2A86A 1OBHA 4MUJA 2JANA 4YP7A 4CDNA 2DERA 2GOYA 5J5AA 1MB9A 1F9AA 1N2BA 5K0SA 1X8XA 1M8PA 4R0NA 3I05A 4HJXA 3AG5A 5BNZA 3HL4A 1FFYA 2CT8A 3AKZA 1KAQA 3L92A 1T9GS 1Q77A 2E18A 1PFYA 2OYNA 3CVYA 1NUSA 1OWNA 4NAUA 3N05A 2XRYA 3COZA 3M5WA 3IUBA 2Z3VA 4KR9A 1GTSA 1XJQA 1O0BA 4J76A 4P2BA 3DO8A 1I2DA 3RHSA 1GPMA 3DV2A 1NB9A 3ZXSA 3A2KA 2R5WA 1NSYA 2VBUA 5DK4A 1CT9A 1P4MA 1TYDE 1V8FA 3UMVA 1N78A 1O96B 1DNPA 1YI8A 3GLVA 4MWEA 1T9GR 1J1ZA 1R6UA 4ARIA 1JEDA 3X1MA 4WNYA 2CYCA 1Q9SA 1JIIA 1J70A 4EG6A 1N05A 1LI7A 3HZRA 2QJTA 5IJXA 1G8GA 1IQ0A 3CA8A 1F7VA 1U7XA 1O94D 2YWCA 1NYLA 1EFVA 1O94C 3C8ZA 4NAHA 3IVCA 4DNXA 2AZXA 3G5AA 1XNJA 2RE8A 3FG9A 2PZ8A 3LOQA 1JGTA 2NZ2A 3P0IA 1WXIA 2X1LA 4MVCA 4DDKA 1Y42X 1KH3A 1O96A 4EG8A 3GUZA 1U0BB 4EFKA 2PZBA 4TS1A 3PNYA 4HK4A 4PBRA 2PFSA 2Z09A 4ZCPA 4MW0A 5KHAA 1N2GA 2A1TS 2J09A 3IMGA 3TQIA 3SP1A 2O5RA 3FIUA 4MW4A 1I6MA 4OUDA 4MAFA 3AIIA 2PIDA 2DLCX 2PXHA 2PG3A 1F4LA 3IDFA 2QUJA 2WSIA 1EFPA 2IJGX 1T6YA 2QJOA 4KKVA 4H3SA 1QRSA 2X0KA 4ZT5A 1QRTA 4DJAA 4QRDA 1PG2A 2CYBA 2YY5A 4U8HA 4XSVA 3RK0A 4PY2A 4QREA 1N1DA 4ZCTA 4AS1A 3RK1A 2EL7A 3P52A 1H3FA 2A84A 3FH0A 4X0EA 3SDBA 3DPIA 1K4MA 1ZJWA 1IQUA 3JXEA 4Q93A 2A1TR 3CLTD 1WXFA 3CLTC 3H99A 4K0RA 1MC1A 1O95C 2CUZA 1IQRA 1TYBE 3Q4GA 4MUEA 1M8GA 2DEUA 3KT3A 4R2LA 3HMQA 1TEZA 3UC5A 3QE4A 2VTBA 4MWBA 2QTRA 4KR7A 3NBKA 1XNHA 3RJZA 3SYTA 3LCJA 5DEOA 1J20A 1ZUNA 1WQ3A 3ZJTA 4QBTA 2Z08A 3ZJUA 1OBCA 4MUNA 1YUNA 3P0HA 4KPUA 3IOCA 4OJMX 4ZT2A 4CQNA 3ZXIA 3VRHA 1I6LA 1PFUA 3UOWA 1EJ2A 1N2EA 3ND5A 4MUHA 3L93A 5LM3A 2EJCA 4A91A 4BWVA 1J21A 5IHXA 1Q11A 4MW5A 4ND6A 5HUHA 1MB2A 3FI0A 1D2RA 1VBMA 3FHJA 2E0IA 2QUIA 3IVXA 1M1ZA 1YULA 2A88A 4MW6A 4NATA 2I1LA 1ZH6A 4MQ6A 1GN8A 1EUQA 2YXNA 5FO0A 2C5SA 3CLRD 4KR6A 3CLRC 1B6TA 1KQOA 2B7LA 4MUFA 4XFDA 2H29A 1IRXA 2J4DA 1ZH0A 3K9WA 3AG6A 2XRZA 2J07A 3RFFA 3FNRA 2PZAA 1X6VA 4HJRA 5K0TA 2D54A 1GTRA 1SURA 1K92A 1NUUA 3CVUA 1LW7A 1KP2A 5KWVA 1NUPA 1QJCA 1EXDA 3MUEA 3G59A 5HUJA 1EUYA 3IUEA 3SEQA 2OV4A 1ILEA 2D5BA 3A05A 1KQPA 1N3LA 3HFJA 4U63A 3A04A 4EG4A 5F23A 4EG1A 1O6BA 3F3MA 1WQ4A 1WY5A 3AL0C 3P0JA 1QU3A 1O0CA 3PRHA 1U3DA 3CVXA 3A4IA 2GKSA 5LFAA 3VU8A 3H9BA 1PG0A 4I6GA 1RQGA 3TNJA 2CV1A 3SEZA 3KFLA 3TQOA 1MBZA 4GRIA 3MMXA 3CTAA 4RPIA 1K4KA 4ZCRA 1OWLA 1JIKA 1N2OA 1OWMA 1VLHA 4ZT3A 4G5FA 2RD2A 1O5TA 3U1VA 2A1UB 2DETA 1A8HA 1JILA 4MLPA 2BYTA 4DDMA 1KP3A 3INNA 1QTQA 3CLUD 1M8JA 1P7PA 3CLUC 4MW7A 5A89A 3COWA 3CVWA 2X1MA 2VBVA 4S1OA 1JIJA 3IODA 1IFXA 4G6ZA 4JZYA 3GMIA 1XNGA 1NURA 4L2IB 3FETA 5TS2A 4RUKA 1M83A 4ND7A 3ZUGA 3SZGA 4JXZA 4MUIA 1LI5A 1NZJA 1EE1A 1FYDA 1TQ8A 4MW9A 3ZGZA 2TS1A 5FO1A 1KH1A 1M8FA 3QTTA 1VBKA 1YUMA 3NBAA 1QRUA 1WZ2A 5JBNA 1F7UA 4YP5A 1KAMA 1R6XA 4UZEA 3PNVA 3H05A
chains in the Genus database with same CATH superfamily
4ZMSA 2HZ7A 2Q5JA 3CKYA 1YIJB 3FSJX 3NT2A 1BE0A 3OE5A 4FZ3A 1ZQ9A 1C9JA 4KVZA 1E1YA 1NBWB 3CPEA 3QTLA 2V7BA 2W2QA 4QTTB 4K6KA 3HUFA 1UPXA 5JALA 2QR5A 2HMYB 2RONA 4AS2A 4P4NA 1QF6A 1KMHB 3D7KA 1RPAA 3DXZA 3RF7A 4F96A 3HXPA 3ERCA 4K03A 3V4LA 4MDHA 4WN9A 4AKTA 1ESCA 3AVOA 3ILVA 4KIWA 4BJ1A 2WIGA 4GX0A 4D9IA 2ZPTX 5LA6B 3GHYA 4Z4ZA 2QU7A 3GGGA 2FLKA 3DF7A 5FLKA 2OQVA 3RVDA 4BNNA 5H3CA 1DWOA 5IAOA 3U40A 5IKMA 2NYAA 1H3NA 3AFOA 3QVTA 5JS2A 3VZRA 4AY2A 4XD2A 3VAZA 4WWVA 5JPDA 4A2PA 1PSDA 2A5FA 5JY6A 2B1JA 1E0KA 2VP2A 1KEKA 3W9UA 2BWJA 3I92A 3PFWO 3FTCA 4JWKA 4D9MA 1A9YA 1N3IA 2NAFA 2OUKA 1W8IA 2AQHA 2P75A 1VJRA 3AR8A 4X63A 5IF3A 1R18A 3FPAA 1DWQA 2OR3A 1GAXA 3LWBA 5FNZA 1NGSA 1PX2A 3HBFA 2RKWA 2XZTA 3IMEA 3LBIA 4WEQA 3C3CA 1NJ2A 4LZLA 5E6SB 3R7WA 4F85A 1IUNA 2YFHA 4V0LA 1M6HA 2GH1A 2ZJOA 3DV0B 5K3AA 3HB7A 1P31A 3ISJA 2ZSEA 1GEEA 2FN4A 3HKBB 2OBRA 3EUEA 1PGQA 3PFKA 1V26A 1YNOA 2A5JA 2X3FA 2WFZA 2EW1A 1BGVA 4ENPA 1CERA 2PUFA 2ZIAA 2VJCA 1I8DA 5IM4F 1JXMA 2PD6A 2Q9BA 4UEWA 3O92A 4ZGNB 1WIWA 2B8NA 1CUJA 4GOMD 4DCOA 3UC9A 2MSNA 1X1BA 3EOAI 5LQDA 2GCOA 5K03A 1GOTA 2XQKA 1SHJA 2NG1A 1DT5A 2QPAA 4AQ7A 4X6UA 3RC8A 5AKLA 1FDWA 1U1FA 4H27A 2V5UA 2QT1A 1ZHHA 2I6GA 4UNPA 5DB4A 5G1PA 4IHJF 1E3IA 3VU3A 3WYNA 3FZQA 1EX9A 4DLPA 2Y1FA 4TV9F 3W7VA 2NO0A 1KI6B 1OV6A 5JH7F 1SRRA 2QPOA 3SYNA 4GI1A 3NQ41 3CRNA 5JSFA 2CBGA 4Q7JB 2D3WA 3MTGA 5K3FA 3GPLA 3UKOA 5HZAA 2RGNC 4EHKA 2W6NA 5KPJA 4I55A 5DN6D 1XTBA 4TTAA 4DRYA 2XOEA 3IERA 4XFJA 1P0MA 3H9CA 3NGLA 5HF6A 2GEKA 2GPAA 4C4XA 1BO6A 1YRYE 4JEIA 2ZPAA 3K9HA 3P32A 1F2UB 3UGQA 2XF2A 3FPPA 3COVA 1VQ9B 3N9IA 4NYMQ 4RHUA 4X61A 4JJFA 2DYKA 1IZ9A 4KK4A 5IYZF 2IPOA 4CV3A 1CDOA 2A92A 3F5FA 3FNEA 2O3RA 1P7VA 2CDCA 5JW6A 4LCBA 1A72A 3PGKA 2GO1A 2J46A 3UB2A 4WPGA 4U2CA 4BO2A 3FPKA 1VG0B 4PGFA 1O97C 1XWFA 4FFRA 1U9IA 5DIZA 3W5BA 1RHKA 2JGNA 4H15A 3BBPA 1X13A 3MCWA 4M21A 3QXHA 4IIYA 1N5LA 3VTKA 5L95A 2BBOA 3KS9A 4EW1A 4KRXA 3VSDA 1CUSA 5ITZA 3ICOA 1FDTA 1GGNA 3T4XA 1LC0A 2WJVA 3QOWA 4NZPA 2NO6A 2VPWA 5AW5A 3QXJA 4EY5A 1FFXB 2IUUA 5KO2A 4OOXA 3C3BA 1J42A 2XMQA 3N2YA 2B98A 3DXYA 4RKRA 3UYKA 4CQMA 5K7SA 2M9MA 4ETWA 4TUYF 1U6IA 5BN4B 3GHHA 2R1UA 3CH4B 5A0TA 1RLJA 2BONA 4GZ3A 4Z49A 2Q3HA 2QYSA 1RHRA 4G41A 1E8DA 4ATNA 2CV2A 5ALQA 3BZUA 2ZRMA 4TMTA 2R6HA 4BEVA 1UFVA 1G20E 3EY9A 3L06A 4YREA 3T3GA 2C4WA 3ZHRA 1SVSA 1BKYA 1UDAA 2ORIA 4HUQB 2PLWA 2FPIB 2XZDA 3UAVA 1NDHA 1SKQA 3L7DA 3RIGA 1N1MA 3V80A 3QW2A 3KFVA 4ZO8A 2QEXB 1RVV1 3L1UA 1U0SY 3GN2A 3KV1A 4XQ0A 5ECDA 4CEHB 1RXSA 1OA1A 4CV2A 2O7RA 2WQ6A 2AE1A 3A26A 3EEBA 2ZM5A 2R6JA 2HKIA 4YCBA 3PJEA 3EIEA 3C6ZA 1H4VB 1T1IA 1BE6A 3ZNQA 1YZHA 3W7BA 4GDMA 4PHCA 2Z2JA 1NBMD 4MVJI 5KAMA 2FWJA 4QELA 3E7XA 3VHXB 1E7WA 4KSBA 4UPVA 3SHOA 4J29A 4BXOB 2NUTB 3DDSA 1O8BA 1X7XA 2VYVA 1II9A 3CP2A 4DNFA 4HXGA 7REQB 4FJ0A 1HVXA 1U0HC 1YACA 2IHUA 1LSJA 3C0KA 4E4RA 4OKSA 4R8SA 4PQGA 2P69A 4U2BA 5FHQA 3UK2A 1PJRA 2J33A 3STYA 4J0KA 1QO0A 2FN7A 2G40A 4PRZA 5FDFA 4CDNA 3TG2A 5AXBA 4OB7A 2DERA 1SCNE 3OECA 5FEMA 4R9NA 3CZ4A 1UIMA 3A1SA 3U3MA 2WMYA 5FYQA 1IJEA 3S2SA 5EJ6A 4ZV7A 3OPOA 3PLNA 3WNBA 2OYRA 3BQJA 1JDNA 3GEMA 3KZVA 3AERA 2FKAA 1DV2A 3H9UA 1A9OA 2E5WA 1IHYA 2HD4A 4BUZA 3HSSA 2JLQA 3K9CA 1RWMA 4XSGA 4HDRA 2C2YA 3R6TA 3PQ6A 5TB5A 3E6AA 3FYHA 2F8SA 1YKGA 2C98A 3GPIA 2FPMA 3O6VA 1VSVA 4IR7A 2NYUA 3PUZA 4HAIA 5C4IA 4QVJA 4NBNA 4B6FA 1NRWA 2I71A 1O4WA 3QXXA 1D2MA 2FMXA 3G23A 1VL0A 2BGKA 3PK0A 1GL7A 2F1LA 1CBUA 1N9KA 2ASVA 4WZ6A 3RFXA 4C5BA 5CEJA 3RS5A 1NJ6A 1L7NA 2PMKA 4ADSG 3KKZA 3PGMA 2GNAA 1AKYA 4IFEA 1VQKB 3IQDB 3RJ9A 3ZCSA 5BWLA 2F59A 1Y1LA 1ZJ5A 3ANYB 1LZLA 1Q2XA 2HSZA 3R3ZA 3NBMA 4LOAA 2QUBA 5LLDA 3HHPA 3U3XA 1RI5A 1EG7A 4TT3D 3PYXA 4U7HA 1AHHA 1YI8A 1Z2CA 2HC9A 3GLVA 4YRNA 1XTVA 1T9GR 4YRZA 2QRLA 1R6UA 3N2GA 1YONA 3NYRA 3DCIA 3P0FA 3AHJA 2R6CA 2Q8PA 2X8KA 3EDRA 3OQJA 1LQ2A 1MX9A 2OZKA 3S2FA 2DFVA 3D64A 2OZPA 4YI3A 1V5EA 4GW3A 4Z0NA 1JAIA 1KO4A 5AT1A 1QV7A 1OC2A 1A2OA 4M9SA 4XASA 2IYSA 1I80A 3KHKA 2GD6A 3QV1A 3AF4A 1GTVA 3DT8A 1WNFA 2R8PA 1P72A 4R2IA 4RZ3A 3M1YA 3I6QA 3NGXA 3ZW7A 3ZVLA 1NRIA 3HWSA 4U2GA 2C83A 4G3XA 5F78A 2G6TA 3F4LA 5ULLA 3R20A 4J6FA 3DAPA 1T25A 2CK3A 2DT5A 1N0WA 2GSDA 3DOUA 3GGOA 3SMQA 2FMKA 1F6WA 1FVHA 3OQ1A 4ZQCB 2FOXA 2QTBA 2WHEA 3D1VA 4ZYWA 1DHTA 3EGDB 4TTQA 4CF7A 1KSHA 3EXG1 3PFHA 2E1PA 4MVJD 4M7PA 4EEXA 3S1AA 2WPDA 3FBGA 1YL5A 2IYXA 3IPCA 3K0AB 2R62A 4BUCA 3SNKA 3SKBA 1JWAB 5BV0A 4BNTA 3JTMA 3NTLA 2O2IA 1GL6A 2EW2A 4MEBA 1XCJA 5LNK1 2BKUA 4FHEA 2ZTLA 4WE3A 3R8XA 5K99A 2E6KA 3CWZA 5F9MA 4RV9A 4O8ZA 4Y1RB 1CJMA 3EIWA 3BRWD 1F4LA 3GRVA 4CJXA 4GECA 4O4HA 1NBAA 1WSRA 2QAGB 2FNAA 4RLFA 1B6GA 1ZW6A 4OFBA 3BZBA 2QRJA 4OHCA 1V6AA 3KU1A 2XNDA 4ZT5A 3QX7A 2HHJA 3H9EO 2WAXA 3H3XA 3DBIA 4Q1VA 1B2RA 2KX7A 3I72A 3R6LA 5EN4A 4DVGA 4WLFA 1GUZA 4FZVA 4KNWA 1Y33E 5FBLB 2R97A 4OMDA 3GLGE 5EIWA 3OM9A 3FN4A 3P2JA 4EQ6A 2XNCA 2HWXA 3R09A 4AIRA 4FFVA 1HE5A 3WWCA 4UDYX 3DPIA 3RC3A 5DHTA 1IQUA 3L0DA 5HUQA 1IBKB 1EK0A 2A1TR 1FFBA 4XMYA 1OAOC 3EISA 3HXTA 3KJNA 2WR8A 2IW3A 1N8NA 1TU4A 1YUBA 3KSDO 4FR0A 1Q6YA 2RGGA 2ZAGA 4MUEA 4QGAA 4WK4B 3BVPA 3F1KA 1YS1X 521PA 1Z4MA 3W6ZA 4E6EA 1JPVA 3D8TA 3RK4A 2M2IA 5ED4A 1M1KD 1VQ7B 1KO8A 3NHMA 5FNVA 1CCWA 2YCLA 4RVHA 5EKSA 4AJ9A 1Z15A 4MPDA 2J6BA 2OHGA 3GW8A 3OEYA 3U17A 4Z9BA 4R1LA 4Z53A 3NORA 4MWBA 5ALEA 4KR7A 4XJVA 4LDQA 5F2OA 5TQ2A 2IH2A 3O9MA 1HTWA 1UAGA 2CVOA 1DOAA 1JTVA 2ZWVA 3RJZA 3SYTA 2PT7A 4H2DA 1P1KA 2OCKA 3PJDA 2A7QA 4Q3CA 4F6RB 1T6NA 3C7CB 1L5HB 4O1MA 1QRDA 4D0LB 4C7OB 3OJCA 4KACA 3OW2B 4RM3A 3D4LA 3E35A 4YHHB 2JK0A 5AW0A 4RGYA 4ZKEA 3UWPA 2Z08A 3IXQA 3AW9A 5GVRA 2XH8A 2OHJA 5I4CA 1NNSA 3RSSA 3VX3A 2W2OA 1V1MB 1DTEA 1ZFNA 3AV3A 3IKJA 4KPUA 3RKRA 1ZD1A 1FUEA 4MQ4A 1Z4PX 5GP1A 2EJBA 3ZXIA 2J3LA 4E2ZA 1KZ1A 3W2FA 1PK7A 3C7DB 3CGWA 4Q3KA 1BW9B 2DU8A 1W48A 3DZHA 3F5SA 4R01A 3HVKA 2QNBA 4ESOA 5BNFA 1NJ8A 2ZT8A 4ND6A 3WDLA 2R68A 3B3JA 2H51A 3OPYB 4ZARA 2IXDA 3GQBB 3HU3A 2J7PD 5JH7A 3PPYA 1AZWA 4QVKA 2JB9A 3PXAA 1WZCA 4S1PA 2O3UA 1VE9A 3WG9A 3AZPA 5BUCA 4CL8A 3TW0A 1OZHA 1E58A 4C07A 5FTNA 4X84A 3UBTA 1VSBA 2P11A 4Q4JB 4KR6A 2XCLA 2GPJA 1KZ7B 5FKJA 2HQ1A 2MYTA 3PYMA 3RFVA 1RLUA 2FA9A 3WIEA 5B30A 2R9VA 3I5YA 5KVVA 2J6HA 1U9ZA 2CNKA 3QEOA 4C30A 5BWBA 2PSEA 5CFMA 3O4VA 4IIJA 1T2AA 4ER0A 3FFXA 1JJFA 5JNRA 2WA1A 2ZIEA 6Q21A 2OQRA 1Q14A 3FWYA 3KEFA 1AH2A 4QICA 3BWMA 1BEEA 2REOA 5MN5A 2XB6A 4UCXA 5BURA 4R68A 3LCCA 4XJXA 3BRSA 3G6WA 1BTOA 3UT0A 1RWWA 3H3FA 4FFWA 5EJIA 2GUWA 1C4XA 2FW9A 4QYXA 3DVQX 1GU7A 4CLHA 1SBNE 5AI4A 4QPNA 4BNUA 5IT0A 5K3OA 3URKA 4BNIA 2B9VA 2FDCA 2FPPA 3SQDA 4X6XA 4BHTA 3KOUA 3IT0A 4CKEB 2JVIA 3FUUA 2YMLA 4P92A 3I3SR 4HLUC 3ZV4A 2P2CA 4NV3A 3LNTA 3DCJA 1MJNA 1U3DA 1NN5A 3G2OA 4GC9A 3OX3A 1VLLA 5EWLB 3NVMB 1RI4A 2P5YA 2Q28A 5KYUA 1C9KA 1VB3A 5EJ9A 5JMOA 5LFAA 1ACMA 1DADA 1PG0A 2BZSA 1BCSA 3A58B 5G1OA 3OF2A 3ZZTA 2JZCA 2NT4A 4UHCA 4TVOA 3KK0A 3QX8A 1JHMA 3P0EA 2A3NA 3S44A 5HF8A 1CUUA 3F7MA 3GRUA 1WB6A 1ZAKA 4M38A 3W6OA 1W5BA 3IKTA 4IRUB 4QGHA 2LRHA 2OOSA 2F1KA 4GGPA 1UWLA 1W4RA 2Y99A 2P3OA 3KLMX 4FCCA 3UJDA 5KQSA 2RD2A 2W8ZA 1YKSA 3P7MA 3ULKA 3LO8A 4GOJA 3SX2A 2DETA 5CFQA 2ZZGA 2PK3A 5EE0A 3QF4B 3VV2A 4DARA 3INNA 2WJYA 4XGQA 3C6YA 2LCQA 2Z5VA 1AN0A 3CLUC 4DR3B 2O06A 4TM8A 1E1DA 3GYGA 3CTPA 3DONA 3QI2A 4FYHA 1ZY2A 2EZ9A 3DKKA 3KKLA 5AM0A 5A9TA 1K7YA 3E5NA 1UC9A 3R5KA 3FJ1A 1JFRA 5WRFA 3ZIAA 5LKAA 2PLNA 2PKYX 2J9ZB 1KC3A 1P2DA 1TRKA 1W85A 3N8GA 5KNBH 4CV1A 4RKEA 5DNWA 3ZUGA 3EW9A 1I4EB 2GM9A 1EP2B 5I9BA 4RXMA 4J2HA 1CW2B 3EJWA 4K9PA 1QFZA 2RK4A 4OK3A 5JC1A 5MGNA 2ZB3A 1P4RA 3JASA 2A9PA 4L9RA 2TYSB 3X1WA 2O8CB 4R1PA 3NX4A 4A6DA 1N2CE 4C6SA 2ATXA 5KQLA 5AVXA 4UOQA 3CT4A 2FEAA 1FMTA 1M2KA 1XXLA 4IL5A 3OHPA 4NI5A 4BBJA 4AKHA 2VDOB 3F9RA 2G1JA 2IF2A 3KTAA 1II0A 2CL7X 4PR0A 1T8PA 2CZCA 2WJGA 2EFCB 3NDIA 3S3TA 1OH8A 2DUJA 2BGIA 1WB5A 1ULUA 4MWTA 3TTWA 1JTEA 5J35A 3JD1A 3FGPA 1CIJA 5KCMA 1XV5A 4D5EA 2UZIR 2HMAA 2XMPA 5IVDA 4PYMA 1T3TA 2J5BA 2J9RA 2MT9A 3MUFA 2X41A 1U3GA 4GOXA 2VCEA 3LCVB 4IIEA 4QXMA 1S9HA 2J5RA 4TROA 5LQRA 1RXEA 1V8OA 1WSDA 4O3FA 3LQYA 2FP4B 1ZZEA 2BFWA 4JI8B 3H1GA 1MN6A 4ZEWA 2G71A 3G9TA 5JI3E 1PTKA 2EJUA 4MWCA 4NWIA 3O3OB 4BRWA 4OX9B 2M32A 3D7LA 5B6JA 3ICQB 3UFXB 1Q1BA 4O1IA 4RULA 4C89A 2NQ2C 3WK4A 4OQYA 1GAQA 1CY4A 2W6PA 1IN1A 1N4AA 4PU0A 1H2ZA 1UC4B 3V48A 1JQBA 5DM60 4HXFB 2H2AA 1F38A 2IITA 3AEKA 3ZCRA 4MH0R 3KKOA 5BNTA 2QP4A 4F2WA 1T3ZA 3VNAA 5EXTA 2G77B 2Q4RA 2QYOA 2IHZA 3QPVA 4BLRA 3ES9A 5IJ9A 1QG4A 4QVIA 4LXUA 4N0PA 2PZGA 2R6R1 1O6ZA 4R1NA 5D86A 2Y0PA 6YASA 1V5IA 4YCLA 4RA9B 3VGPA 2DWCA 4PC2A 1AS2A 2BH9A 3GZJA 3BGVA 4UFPA 3A2LA 5HHTA 1K6MA 4MVWA 1WZNA 1VRWA 1CQJA 1I3KA 5IYRA 3IQHX 1U80A 1FXWF 1QPBA 5F4JA 4DMRA 4E2YA 4L4SA 3JQ6A 4OBXA 3RE1A 4KE8A 1IC6A 2ZYDA 4CNQA 4AX4A 4D46A 2BELA 3CUUA 4DXDA 4E0FA 3K73O 2C4NA 4PZYA 3AVTA 2Y1CA 1LSOA 2ZBDA 4QTXA 3HC7A 4DR5B 3QEAZ 3USES 2EQBA 3E27A 3IB6A 4BIIA 1Y1KE 5K4HA 2HYDA 5EKDA 1M34B 1R15A 2BFBB 3IV6A 4OV6B 4R1QA 3LUJA 3Q1LA 5CBKA 4AZVA 4Y18A 3SJUA 1P29A 1J33A 3AXTA 4OPVA 4PPGA 5A4MS 2FFHA 1R0ZA 2OLKA 5BVHA 1WB9A 3U4QB 3H8SA 1RXVA 1XZMA 3UJ6A 5IWCA 3GN1A 4MLZA 1NNEA 2GEBA 3PWKA 5J43A 5EJ7A 3EEQA 4D9JA 3I1FA 2YW2A 4ZT6A 1JP7A 2IHTA 4KBFA 2CNNA 1HSOA 1KVTA 5EP4A 3BICA 4K9SA 1JG2A 1MC4A 3PUVA 4NBUA 5HKAA 1TUGA 2EZUA 3S55A 2WOOA 3VDMA 4LGYA 1FX0B 2IU6A 4MYDA 4HADA 1DKLA 3MFYA 2HO5A 3W3AA 4OHXA 4AWBA 3CD6B 5KOYA 2PS0A 1ISRA 1DTSA 3QU5A 3DDCA 2XDYA 2EZ8A 1JZSA 3LX5A 4UBIA 3X2EA 3WNZA 4BO7A 3TFOA 3OLZA 1M33A 1NU6A 4JKYA 1NFRA 2P35A 1KQFA 4CNBA 3VC3A 1U5BA 3C8HA 3UFBA 3PR1A 1S2DA 1L4HA 2ENWA 6ADHA 3VTAA 1V9CA 3I9V1 5K05A 2O9JA 2C8LA 2W83A 4H1TA 1HDRA 2HREA 3KM0A 1E8MA 4R9RA 1B74A 3SVZA 4E5SA 3IRUA 4EIWA 5JCXA 3VKHA 1MT3A 2R85A 2GPSA 4Y2TA 3MAAC 2QLBA 1EVEA 4AC9A 4L8FA 3MILA 3VPBA 3GFGA 2DX7A 1Z6ZA 4HXYA 4KJZA 3MBKA 4M9CA 2QXYA 4RJ2A 1XRNA 2NSYA 2DAPA 5H4HA 4B7UA 1ZD3A 2AN1A 1IUOA 2ZJAA 5FL3A 2DUMA 2EGUA 2ZUBA 5CHEA 5B1DA 2AG6A 1JSLA 3JD2A 4WLUA 4DCCA 2D5LA 4ENTA 3GEHA 1TT5A 3TL2A 4AO6A 5LMUB 1H66A 1SWVA 2E21A 2QGZA 2C5FA 2BM1A 3QKWA 3SG0A 1NZDA 1QCDA 5COBA 3OZRA 1UJ6A 1AKQA 3G05A 1MQSA 1SO8A 3AIMA 2XTMA 3GOHA 2VZ0A 2OO5C 3OCCA 5AXCA 5KQRA 3PTAA 5UKDA 2H1WA 4G01B 1I10A 3U3OA 3IS3A 4KQXA 2YUTA 4ZVOA 5CLFA 1NN1A 1E32A 1ULHA 1YQQA 2VP3A 1G9XA 4Q4LA 3B6EA 2GZ3A 2H4YA 4RQUA 5ESWA 3CRQA 1OYOA 4CDMA 2ZUEA 4PW0A 3FYSA 4PYLA 4D02A 2O59A 4FMBB 4N0QA 4UHHA 4DN6A 3RU2A 5DASA 1XZAA 1NTOA 2IW1A 1ORVA 2PGJA 2ZZQA 3RS8A 3VPCA 3L8DA 3WJ2A 3T3PB 5F77A 1XXHB 1H1LB 2NSLA 3CLSD 1XX6A 4DLAA 2WWWA 1HE3A 2ZT6A 4LMRA 2O8FA 5DSZA 2W98A 1CUDA 3MF4A 3FSRA 1W30A 2NUAB 3TCKA 1RRKA 1T9KA 3INTA 4FILA 3B1WA 1H4SA 1GZ5A 1YBAA 1W29A 2CNLA 2HRQA 2NNWB 2X8AA 3HWRA 4QO7A 4S2EA 4X20A 4TZKA 3G2JA 3OMXA 1C29B 2A0WA 2F90A 3JATA 3PYLA 4QGBA 4RETA 3Q8XB 4L6IA 4L72A 5FYDA 3T6KA 4AT1A 1SG6A 1BCRA 3P94A 4E5PA 2UUBB 1P91A 3BHNA 4EABA 4X6YA 1MGPA 3LHIA 4MPPA 1NN0A 3EEIA 3ELBA 5F5XA 1A8IA 3KQNA 1IYZA 1PFGA 4A1OA 4HS4A 4REMA 1LBIA 2C54A 2JDIA 1MB3A 4ZAYA 3KB1A 1H0RA 4DBVO 1ULBA 2XXBA 5AK3A 4AF7A 5ENDA 2WZBA 3WNQA 3HO8A 1RHJA 3ASVA 5SYNA 2BFCB 4QX6A 2C03A 1ENOA 3L7LA 1M7HA 4BMNA 4CEIA 3VO9A 2QN6A 2HLHA 1AQLA 1C4KA 2W0SA 1MOSA 4BFTA 4IDFA 3HZZA 1W49A 1DAGA 4DMCA 2AVDA 1W59A 2FRDC 3NJ8A 3WHPA 3FMOB 1BMFA 1LI4A 3JPWA 2GK7A 2QMUA 1HORA 2Q3MA 4F92B 5K0LA 1JTFA 2EXXA 2B4RO 3ITEA 1G6HA 4WUVA 1GVNB 4C2TA 4QZVA 3ACCA 3RYHB 2GHRA 4B3IA 5LD2B 2R44A 2H48A 4WZBA 4LMAA 4DM3A 2W0MA 1JHOA 3NHBA 4RACA 4DQXA 4E14A 3ROPA 1OY1A 2CXNA 1JEYA 2DBVO 1M2EA 3SQMA 4TLDA 4MI9A 1RKBA 2QKYA 2GK3A 5ELLA 2HBZA 1FJ2A 2ZUCA 1KXJA 1N6NA 2Y76A 5J1SB 3I28A 1RLMA 3EZ6A 1QORA 1EP9A 1QSGA 1V8FA 2IHBA 4EB3A 3SQXA 3VI3B 1N78A 2VZ8A 4FE3A 3RBZA 1M2HA 5IF9A 1Y9AA 1LPOA 5TMDA 4WZEA 3FTEA 1NAHA 1LNZA 2FW0A 2CW5A 1RAAA 2EX4A 4LRWA 3ZLVA 1YFJA 5AXDA 4UATA 2JEOA 3EE6A 3CCEB 1SXIA 2N9UA 5AHOA 2V3VA 5DFAA 1WWKA 2WD8A 1KU6A 1Q92A 2WU4A 3PQ2A 3V8RA 2XSZD 3RAFC 1U7XA 2AR7A 3KWFA 4HLUA 5HJ7A 4ZAFA 4DZZA 4GEGA 1QH8B 4P5PA 4CTOA 4OHZA 1PVDA 4B43A 4P3XA 1XNJA 2AZTA 1PL6A 1QFSA 2H0RA 4K2AA 4TQAA 2PZ8A 2G5PA 3RREA 3RABA 1C3XA 3IEUA 4QHSA 4ZYYA 5LBUA 4HWSA 5H83A 4DDKA 3PWSA 2GRJA 1O96A 2NVUA 1US8A 1Q81D 1DC6A 2AUNA 3OMWA 4LVCA 1BU8A 4LF6B 2FJUA 3OJ0A 1UC8A 2BTOA 3D4IA 5LWHA 3PNYA 2YKGA 3C5WP 4HDQB 3PA2A 4NEHB 4RU1A 4QDZA 5FUXA 1WU7A 2Q62A 2WWVD 4BZWA 4CLEA 1YR3A 4LY0A 2Z3WA 1OILA 2XUOA 3ML1A 2Q2VA 1G21E 1H0HA 2BCJQ 2YWDA 4KYTA 3DP7A 3GZTB 3RO7A 3GLIE 3RC1A 2JS7A 2VPTA 4YMHA 4AJLA 1T8UA 2GK4A 1XZDA 4BFYA 4ZJZA 2P5UA 3T9AA 1KXZA 3FPSA 1TM4E 2CGEA 3OU2A 3QNMA 3BDAA 2Y68A 3O83A 2V7VA 4AMBA 1YBHA 1U0FA 4JLAA 1MDBA 2QP3A 5I7UA 3ZZMA 2VO1A 4DNQA 1IONA 4GVLA 4QRDA 3VVLA 4YEJA 1PG2A 1Z68A 2FOIA 3A6EA 3FW1A 4U8HA 1VQ6B 2VJKA 3A0UA 2AQKA 3DKPA 5EHZA 3OZVA 4I50B 4RK1A 1GZSA 5DISB 1VLJA 2BEWA 4OK6A 3A1CA 3GZ4A 1HF3A 3FYDA 1WOSA 4FFDA 5CLQA 4CKYA 4B9AA 5KYXB 3AVQA 3WOVA 1VPDA 1YDFA 3L8GA 2HCRA 3FRIA 1F8YA 1NULA 1QOZA 1SA0A 3Q6NA 4IRXA 4KFSA 1VXOA 3BJZA 4Q93A 5F98A 3ASQA 2VVTA 3A0RB 4TLEA 4GWKA 3CUYA 2ZT5A 1PWXA 3CEHA 3DAFA 1U1GA 5JYDA 1M2GA 1M8GA 1NRXA 2HOQA 5K6AA 1V5VA 1QIIA 1FDVA 3ANNA 3SZOA 4D99A 3DQQA 3HRHA 4WBSA 5TIIA 1SXJB 3WA7A 1FP2A 2D9RA 4FOSA 1XRSB 3FZEA 4QULA 4RMIA 3UK1A 3NBKA 1W25A 2W6ZA 4YRFA 2BFNA 2BFPA 4XIJA 1YC5A 5ALYA 3ZE0B 1V7QA 2JAQA 4G8BA 2O3TA 2Y1EA 1WOOA 5EXDA 2QSJA 3W5IA 3HCEA 4G1UC 1N5MA 2PRSA 3QXCA 2XDWA 9LDTA 4EHBA 2UYOA 4MRMA 1CY2A 2WBLC 5FOSA 1D1NA 1ODCA 2I3DA 4JP8A 4AXBA 1Z0FA 3UHFA 3FDZA 1PVOA 4DBLE 5JFOA 1LK7A 3FBTA 4Q9AA 3ZE1B 3NASA 3VR6A 5IH3A 1LF0A 3IIJA 1J21A 4FWTA 3HSKA 3F3KA 3SIRA 5DXJA 3RS3A 3C8DA 4UDOA 5C1OA 3B6MA 5A62A 3DF9A 1J0EA 2PZJA 1SOWA 2ZEJA 2H9YA 3OF5A 2CFCA 2GMWA 3EQ7A 2WJ6A 3KXLA 3NFRA 4HGRA 2ANCA 1QVAA 3H7IA 2DKFA 4HX2A 3U4GA 3GZNB 1KFKB 4HIZA 4XWGA 2VNKA 4MS4A 2B20A 2XGGA 1FIUA 3DMNA 4NDNE 2YV1A 2GPYA 1A5BB 5FQOA 1P0CA 3ZX4A 1DQSA 3MJHA 1PKEA 4J4TA 2XRZA 3H1AA 4JJ8A 4JI0B 2ONCA 1Y4DE 4XD7A 4D7AA 2J07A 1QONA 1BFDA 2MOKA 3VBCA 4ASUD 4C4RA 4KW7A 4J0EA 1JR3D 1VHEA 3DW1X 2PUHA 5D3QA 5F3WB 5LQUA 3O2NA 4I36A 3KPJA 3HEMA 5DHFA 3I34X 4IQ0A 3X2FA 4RZHA 2KBFA 1XFAA 4XQFA 4L27A 5EXEA 3A8IA 3N2EA 3H8VA 2ZYWX 3I09A 2IIQA 4X1KA 5KWVA 5I3CA 1EDZA 2CB9A 2QRZA 4JB2A 4B6SA 3HB5X 1M6VB 3IDSA 3MS2A 3JQGA 3E9ZA 3I30X 4JQZA 4MKRA 1GSIA 4C0XA 1MTZA 3IUEA 1F6DA 2B25A 1P1IA 4Y2HA 3T1QA 1MIHA 2IV2X 1NW5A 1SVIA 3NUQA 1F0YA 3WYBA 5YASA 2CLCX 1TAUA 3MELA 4NULA 1GARA 1R3UA 2C3OA 3LLCA 1NW4A 4EG4A 4O1HA 3DTVD 4GI2A 3E82A 1P6QA 2BTQA 3L0IB 3KEOA 1CQWA 2VJBA 4D74A 5HCIA 3QG5A 4DZRA 5GIOE 2CNOA 3D6NB 2H7VA 3B60A 3U7RA 1XF1A 3TX2A 4ED9A 3WLQA 5CB8A 4N39A 1TUBB 1L1EA 4GP6A 4L8YA 3ZU5A 1TF5A 1RQGA 4Q7MB 3L6UA 1YL7A 5DEIA 3PCTA 4JLUA 2WJ4A 3BWYA 3TNJA 3QEBZ 4PSAA 1D4FA 2C9DA 1GZ4A 4IZ6A 2VSQA 4FFBA 3TEJA 1VXRA 1QIKA 2NLOA 3B1FA 2Z2YA 1NBHA 3ZHUA 5B7QA 3CLHA 4HLCA 3C3AA 1NC1A 1N2OA 4U7GA 3C5VA 1UT8A 4X05A 2AFHE 1MW9X 5HK8A 3U1VA 2E9SA 2YV3A 2XYPA 3EY4A 4RZIA 3HU5A 2BV3A 2XYGA 4GOKA 1RXWA 4UZUA 3IAFA 3BWVA 3IEPA 4QIHA 5E8JA 1MGOA 1YB6A 3BTVA 2GZRA 3P26A 4MXDA 5HMMA 1NR5A 1E60A 2RHWA 1IDN1 1XDUA 2COKA 5CD9A 4BUJA 4J7CA 3ZIDA 5IYPA 3G0HA 1Y8CA 4O2BB 2ORYA 1DX6A 3LGXA 4G6ZA 4O2AA 5BNWA 4R9VA 1NNI1 3QY0A 4MV5A 4FMDF 3FROA 3H1PA 1STOA 5I9SA 3B13B 2K7ZA 1OFHA 1M83A 2Y1KA 4O8CA 3G71B 4GL4A 2ZDGA 5BN3A 1LI5A 1TQ8A 2LKCA 1SUDA 2A57A 2ZWMA 3DMRA 5MHTA 1KJYA 2B61A 2ZTNA 2ZDQA 3B89A 3KIPA 3Q6MA 3LLUA 3QXGA 2XT6A 3HWWA 4XYBA 3TR0A 4DXHA 3HUEA 1J8DA 1R6DA 3SWWA 3ET5A 3MJCA 3S5UA 2QTWB 2ZRKA 3R5XA 2ZRJA 3GPBA 4GOLD 4RPKA 5T4FA 4BB6A 1JDBC 4QU8A 1HKHA 4GM1A 2QEQA 4EPRA 4A7PA 1L1QA 4YUYA 5IMSA 4L08A 3F5MA 2WQ7A 5J40A 1BHO1 4IHQA 1SQ5A 4BYGA 1QTIA 5IZCA 1V5WA 2YWBA 2ZJZA 2H2WA 4X00A 4Q19A 4FGUA 2GM4A 3HHEA 3MVEA 2QX4A 3SOPA 5ERGB 3FDFA 1LBTA 2ZP1A 3PDCA 1FVFA 1XCPA 2HRBA 4XUGB 3EZ7A 1PN3A 1XLVA 4Z4CA 1K6JA 5C5DA 4C0JA 3TDMA 1Z6QA 3HPQA 3LPMA 3UV6A 4X64B 2H6EA 1N4DA 1XOIA 2DJ5A 1OYYA 3RJ5A 4JI3B 1RAFA 1ZJJA 4XLLA 3S8EA 1V16B 1A5AB 1NDQA 1J25A 1VLZA 4UCQA 3MBOA 1C2TA 1ZLYA 3G8YA 1DTWA 4U02A 3MEQA 5J23A 4HZIA 2XE8A 4AN0A 1F2TB 3D3JA 4UM8B 4BVFA 1BXGA 5BUZA 4M49A 3EQ9A 3B5EA 5BWOA 2O1EA 3BILA 1FJGB 5CVVA 1E9BA 4HWRA 3UM9A 1QFJA 4GXRA 4K0KB 4I6EA 1AUQA 1ZD9A 1ZMXA 4URFA 1H2XA 1XZCA 2EDAA 3GRPA 2WP8J 3O38A 3U13A 3E3MA 2BF7A 3WDMA 2X7HA 2J48A 4WNIA 1CQIA 2G8NA 1YJQA 3IPLA 4CUKA 3I61A 3EGIA 3LK7A 3LD9A 3EEOA 4QJ3A 5A6SA 2ERYA 3WBFA 1VZ2A 4B40A 4TPKA 4QHYA 1VM6A 3GMDA 1RP7A 3TPFA 4HUTA 2W8BB 3IQGX 4N9QA 1J9EA 3RU7A 5T67A 2ZJ5A 1G7TA 1JQ3A 3DAGA 4Y2UA 3HDYA 2CE2X 3L0BA 4YDRA 4B85A 4RSHA 1J0BA 3UBMA 3VSAA 1WXQA 1SUSA 3IP6A 3KR0A 1M2VA 2C31A 3KYDA 4BQSA 5ALZA 3SYLA 1P6UA 3E1KA 3R6WA 4G4GA 3BWBA 2CB0A 1IB0A 5H68A 4ZGQB 1I9CA 3JALB 5DN6A 1JDPA 4JEHA 4ZQGA 3I6MA 5LU8A 3A06A 3ANTA 3FCYA 3HR4A 3CLKA 4C20A 1HZJA 2IUTA 3EC2A 3QKTA 3IOEA 3RU9A 4G26A 3QELA 1OX5A 1L8AA 2ACEA 4I4TF 4EEZA 1XPOA 2E7ZA 4QJ4A 4FB5A 3A10A 3JRXA 1PS0A 4IX1A 1WPRA 3HB1A 1RC8A 3HYCA 3A1NA 1QRAA 2IVZA 1Y63A 2PJZA 2PX0A 4GZMA 4PV7A 3F78A 1IXZA 5E3IA 3BL8A 3TLJA 4BVAA 1UCFA 1J97A 4JK3A 3M7IA 4XB1A 3E22A 2NV0A 4ND8B 1RWKA 1D2AA 4LPSA 4YQZA 1LLUA 4DCVA 4GQIA 5CHYA 1GYRA 3L7IA 3K1TA 3QITA 4RZ2A 5D01A 1I6KA 3L0SA 4EMTA 2IBMA 5K8VA 3BUSA 1YB2A 2C42A 3DVRX 1J90A 3HH8A 4UBMA 2E49A 4P22A 1MEJA 2GYUA 3B1KA 3CIOA 3GJ4A 4G5RA 3M6IA 5FLYA 1LW6E 1U2PA 1L4NA 1OHHD 1YSCA 3ANLA 4UULA 5FUBA 2O3SA 3SQNA 2X23A 4F3NA 1R4AA 2PZKA 4D3DA 3EXEB 4AQDA 2C2HA 2PXXA 2Q5CA 5T3UA 3UMSA 4F97A 3O4RA 1IM2A 5DLYA 2Z8XA 3ESYA 1Z0SA 3SVLA 1XKQA 3BJIC 1PQYA 2XIQA 2ZIFA 4YRCA 1V8ZA 2HK9A 3JQ7B 2OQ2A 4MI6A 1GVHA 4XQGA 3E03A 2JGEA 2C2WA 2G4LA 2JJ1D 2X8JB 4IG9A 4DA0A 2Z9DA 1DELA 5H16A 2V7EA 2CVQA 4H08A 1ZD5A 5I7AA 1YZYA 5F9HA 1G41A 4IDPA 5B3JC 2OHOA 2YYYA 5TEWA 1N2XA 1QQTA 3SYMA 4EUSA 3T5PA 1R8SA 2C5EA 3BWDD 1U8UA 3WMFA 4KR2A 3HU1A 2PGNA 2MR5A 4A6EA 4CBVA 1H8HD 3SX0A 4RTJA 4GP9A 5HW0A 1G2OA 1F3OA 1EM8B 1M6WA 3NHSA 1KSGA 4EI9A 1A7KA 5B2EA 4BZPA 1ZICA 3BIFA 4HDMA 4TRRA 1FW6A 5FFFA 2XRMA 2D4AA 1TC2A 1FA9A 4UM5A 5CLGA 4X92A 1Z47A 2F8MA 3MTIA 2VCHA 1NIJA 1NBMA 2HU7A 4NE9A 5D3KA 5DDIP 4EA7A 4F4FA 1NXOA 4OKNA 2ENUA 3BDVA 3GQVA 3HSYA 2FZVA 2ILTA 3KNZA 3VSEA 2E4WA 4QOEA 4CF5A 5J63A 4BNVA 4Z4FA 2D8AA 2D7DA 2B2CA 2GN4A 2HLNA 3UJNA 1C7IA 3DFZA 2JGDA 1RKQA 2C2ZA 3A3YA 3IAM6 2ZUUA 3NAMA 4AM8A 5JSUA 2AMJA 3LPCA 2IZ0A 1SBYA 3C98A 4KFCA 5C2JB 1WDLA 1NW3A 2QPLA 1EUZA 2C94A 5DH9A 8GPBA 4MS3A 3EFBA 3U7QB 3S40A 1L7PA 2J9FA 2VG8A 2X0JA 5EJAA 1POXA 2ZTHA 5A9SB 3G02A 1LDBA 3AILA 5CPBA 4G4SP 1WPCA 4YB8A 1S2IA 5H81A 3H16A 3OPNA 3OZ7A 1Q0PA 5FWXA 2JGLA 3VU1A 4KRFA 2JANA 1Y82A 4CM7A 2RHTA 4MQEB 3V9PA 4CLRB 2ZIGA 1ECFA 3A3KA 5FUMA 3EFOB 4C5AA 3IL2A 3EIFA 1MB9A 3UGJA 3G5UA 4RBNA 5IFLA 5ED0A 2NP6A 3DMDA 2XLCA 4R0NA 5F3RA 2UYQA 3G9QA 4XOUA 2IYYA 2C7QA 1ZL2A 2I4NA 3LBAA 2CT8A 5IXJA 2WWTA 2H7XA 3RHZA 1E2BA 5BOVA 3DE3X 3BCRA 3K9BA 4MHSA 1TTHA 2Y2UA 3EZFA 3GPDG 3OLVA 5ALFA 1WV0A 5T57A 4B6EA 1WKVA 1ZSNA 3ZC3A 1C3EA 2C5LA 1K3TA 5J2UB 1UBLS 4PZ0A 5KNCH 1W4ZA 3ZDFA 2R4TA 3BQMB 1Q3TA 5E8RA 3JQEA 3VR3D 4ES6A 1CJUC 1K9VF 1OKKD 1TK2A 1UBUS 4PLYA 3BE5A 2PRIA 2XCOA 2D62A 2ZS7A 1ZESA 4TT3A 3GJ7A 3LHSA 3LW7A 4OHPA 4HNGA 4RDIA 4DGQA 3S8YA 4LJ9A 3N0VA 4OHKA 1KJJA 4BGUA 1B8NA 3EYAA 4NE7A 4LTMA 4B3BA 1EYZA 1YGYA 2VTEA 1TYDE 4RHCA 5B6PA 1DNPA 1Z29A 1L4MA 2IQIA 3DE7X 1Y80A 3AM4A 3TKLA 3WB9A 1SK9A 3EXG2 3OOJA 3JZFA 1PV4A 4Y1GA 4NJEB 1WXDA 1BXKA 2ZCVA 3EUAA 2YQ4A 2J3EA 4GBJA 1U2ZA 3WK6A 1J70A 3DD5A 2QUAA 3MJFA 1LI7A 3ICVA 4U3JB 4BO1A 5LA6F 1UFOA 1L5NA 1D9ZA 4P1ZA 3VYTB 3N58A 4K1XA 3FTNA 3TVTA 4ARBA 1QHEA 2GN1A 5HTKA 4E33A 4XQCA 4C29A 4RS4A 3HR7A 1Z0IA 3ASRA 3AJAA 3G5AA 3KZNA 4XUCA 5IBCA 4NZNA 3RSHA 4PNZA 4MHTA 2XNSA 4MVJA 5C1PA 4TWAA 1E9AA 3L2OB 4P54A 2X1LA 1HRDA 3I9NA 3EVBA 4MVJM 5D3MB 3N8DA 4GIBA 2CDNA 2IX9A 4V0KA 3WGVA 2DVMA 1JKJB 2YNMD 2ZYUX 1FXUA 3DVAA 4DWWA 3NVDA 1GG9A 2G0NA 4M0DA 4BJ6A 4C0HA 3CCQB 3DB2A 3BRWA 5A4DA 1TPZA 2LKDA 2VJIA 1N2GA 5DGTA 4KLCA 4CG3A 4PZLA 4DA6A 2IPAB 1WF3A 3H6HA 3K0HA 4YRKA 1Y3BE 3BOSA 3SLKA 1GITA 2PIDA 5KYTA 2PG3A 2V45A 4KLAA 1PZGA 3EK2A 5B2ZA 4BFCA 4M1SA 4ECEA 2QZJA 1PTJC 4B35A 1I94B 3O5AA 1QFXA 4B45A 2P2YA 4URYR 2FHSA 4KE9A 4AN1A 1SPXA 4P82A 4E09A 4BFLA 2AEFA 3SE0A 2CLDX 4R2HA 1P75A 4XSVA 1KY4A 1BLIA 2ZI7A 3P9ZA 1NJ5A 3ZQUA 5K01A 4ZV9A 2WYWA 1WZIA 2YV4A 4LF9B 3P52A 2A84A 1S89A 4DM7A 1JAHA 2XTJA 1KZGB 4PEVA 1KIFA 2EKPA 1J6UA 3P2OA 1IU9A 1ZG3A 2EQAA 2GARA 3OPMA 1VPEA 1WXFA 2NUPA 3CLTC 3HZHA 4M8KA 3C7TA 4PGHA 3F7NA 3ON5A 3ZCVA 5BPFA 2OFPA 1P39A 3HVUA 3SR4A 1UKAA 2MJLA 4ZRMA 4ZOQI 1T2VA 1UXOA 3HMQA 4BKQA 5BSHA 1U8TA 4QUEA 1W47A 3U4AA 2R6FA 1W4CA 1Z18A 3JRWA 3UWSA 3ZHSA 2CCKA 4NFHA 4I99A 2G83A 2I65A 2QM0A 2AXPA 1XO1A 1QZXA 1OX6A 1R3DA 1U3UA 3MWLA 4U39A 3ZYCA 1WD5A 1I14A 2O5VA 3BHMA 3EPRA 1E96A 4TTJA 3B5JA 4MJ7A 3L7KA 3DMTC 3WYDA 4YAIA 2PAAA 2QMYA 2OO3A 3QU9A 4RGBA 2ZITA 3PHBE 4BE4A 4WACA 2ZTUA 1Y48E 5JSZA 5BVGB 2E85A 2GLXA 2OSVA 3HKCB 4MIYA 2HT1A 2OTJB 1RD4A 1EWVA 2X3UA 1YMVA 4ZT2A 3O82A 5E9JA 5CIWA 1QVRA 3FBWA 2PX3A 4Z4VA 3AOGA 4HHEA 1TJ3A 4MMXB 4MI3A 4PWZA 3VRHA 2J7PA 3KKNA 2JBAA 4JIMA 5IEBA 3QLVC 2CDBA 3CF0A 2V3CC 1C7ZA 3NW9A 1VHDA 1L1RA 1GR0A 4Z4EA 4FINA 1M5UA 3OOSA 4Q34A 5IT5A 3G4SB 2HQBA 4F9GA 2GBLA 2HNAA 4KTTE 1QGUA 2C3MA 2AS0A 4M55A 2HSDA 3IJEB 3ESBA 3V1YA 1GPWB 1SUAA 5FO0A 1CS4C 1DO8A 3AF1A 2ZXFA 4FYXA 4GG1A 2ZBFA 3PG5A 4X41A 3UJAA 3OFKA 2LV8A 4YDQA 1YJ8A 1D4ZA 4I4LA 4L15A 5D1NA 1LPBB 2PX6A 1TQDA 4H1UA 3VNQA 4HZUA 4IOJA 3ZLJA 4DHWA 1J2EA 2VP0A 4HAUA 3C1TA 4J1NA 3ER9A 1FYFA 3WBJA 1KA9H 1GXSB 5CDYA 4P25A 3DLCA 2HRDA 2Y66A 2GEJA 4LGMA 1H94A 3KWJA 1W88B 4UW9A 5I7RA 3RG2A 5JLAA 1Z2NX 3AUJB 4QDJA 4NCXA 4WERA 2ZT7A 4CDGA 2DSNA 1PYDA 3KPUA 2AH5A 3TOVA 5AESA 4D25A 1LW7A 4G6IA 1PR3A 3HEBA 1FU7A 2ZR0A 4H7KA 4OP3A 2JAWA 5M34A 3J81A 3CUVA 3A6LA 3OZSA 4O25A 1KE1A 1P18A 4NARA 1W87A 2HTFA 2FAXA 2C82A 3KOZA 3IILA 3S1LA 3W6UA 2HU5A 2JGIA 3I2HA 5I5GA 5B55A 1RW4A 4JNKA 5LKRA 5F9FA 2A6PA 4Q9JA 4PNPA 4POAA 1GT6A 1F0NA 3AETB 4WMLA 2DFPA 1BQ3A 4XQ9A 3CVOA 4IS2A 1G5HA 1KYYA 4JZKA 1WD7A 3I01A 4KXXA 4DG9A 2VRBA 4ZAXA 1E18A 2E55A 1PWEA 3AM5A 3GAFA 2VBCA 1CPYA 1H9AA 3PHCA 4TX1A 3U31A 1R64A 4CIXA 1Q0QA 3I01M 3K05A 1VMEA 3NTOA 1T0HB 1FE8A 4BY9E 2ATCA 1QHXA 1N9ZA 2JFHA 3U0VA 3DG9A 4B4DA 2XWPA 1W7AA 1OH5A 2C2XA 5JXWA 8ABPA 4X1OA 1UBKS 2AOTB 4XIYA 2AEMA 3CTAA 1CY8A 4JJEA 2AGVA 3V4OA 3ZLBA 3C8UA 4PCAA 1EGQA 5ER9A 1DRWA 3E1GA 2O6HA 3E5HA 5BV7A 2UZ1A 3LZCA 4FXPA 1NJ1A 4GKKB 2X6WA 4I1PA 3KSRA 4WBNB 1O5TA 1XCBA 3KE9A 1IJFA 3F6EX 1YQWA 5IUJC 1XU4A 1SG9A 4M99A 2P6UA 1P1JA 4KDFA 4TVSA 4H9GA 4EOGA 1KP3A 3K15A 5E7IA 4B84A 4NH0A 4PAWA 4FYJA 1DIGA 1K2VN 1W5EA 1PR9A 3LBYA 1M54A 1NQAO 1FLVA 3NYWA 3Q5EA 1QHNA 3LZDA 3HCNA 2I2DA 1H9BA 1Q2UA 4E31A 4NBRA 1G60A 1B00A 3Q6QA 1F17A 4TV8A 3R8CA 5GGYA 4JZYA 1GAEO 3O3NB 4N41A 2VQDA 1YR2A 1DINA 1XHFA 2ZQZA 3FETA 4HH4A 3SSNA 1DG3A 1IATA 3NBZC 1BFUA 1QPGA 1AA9A 5ARCA 3U39A 4CIVA 1JIUA 3E5MA 2ZBRA 1BD3A 1PT9A 2XXAA 4B3FX 4IYRA 1XRPA 1RXCA 4ENUA 1A4XA 3ETGA 4KKSA 4RPLA 1EAYA 2QROA 3O8BA 3HXQA 2F1MA 1YQUA 3ASTA 5DCWA 1KAMA 2Q5HA 4LJAA 4C7VA 5F76A 4LE1A 1M2FA 4ALNA 4CMGA 5ITVA 1G3RA 1N2SA 5BW4A 2NV6A 4NDAA 2DT8A 3O9VA 2QAGC 2V54A 3H5LA 2O5CA 3CF4G 1XZKA 4L95C 3RQIA 4LS3A 1VRCA 1W1WA 3EFEA 1COWD 4MV1A 4Q7QA 4YYZA 1P4JA 1PZHA 3DDNA 5ILOA 1G8JA 2ORED 2X0DA 1Z7WA 3NHKA 5FR2A 4CTKA 2DPYA 5BW6B 4RTRA 1EEXB 4DDHA 1DG9A 3ENVA 1DO2A 4G1FA 4GR4A 2VF4X 1JEQB 1OLUA 4Z4GA 4OA5A 3EUFA 4DNTB 4WHMA 1MQAA 2PT9A 4V0MA 1RNLA 2X58A 2PBZA 3LT4A 4RJJA 2FPSA 4R2MA 2FSSA 4Y6QA 2MCFA 2FQQA 4YCCA 2OWDA 4Q16A 1U0NA 3VSCA 4YQYA 2VDJA 3EVCA 3GELA 4LDPA 3NONA 2QTZA 3GB9A 1WLSA 4RHYA 4OXQA 4OHFA 3SS8A 3AUAA 4NS4A 1DBWA 2QN2A 1JVNA 1L4KA 2QRMA 1E4OA 1G8FA 1S6YA 2HNKA 2ZBPA 4YALA 4IJ6A 4IOMA 3O1LA 1TZJA 4BNFA 4YA6A 2HJRA 2YWRA 1OROA 3O7MA 3K72B 5JZMA 4N8SA 3GLFB 1ZLXA 1Z4OA 1IPEA 1U6KA 3PUJA 4YJ2A 4D6XA 3SY8A 4FKBA 2G9QA 3K0FA 2FXVA 5J47A 2BMDA 7MDHA 3ONFA 3OCUA 1JPNA 5LA6A 5LIPA 1IY9A 3SPXA 3G6KA 4RLSA 4Z0HO 4DIMA 2XY4A 2FE1A 3ORYA 3VZBA 3C15C 1PWYE 3NWBA 3FFTA 2FUG6 1P9NA 1GPYA 1T43A 3HKDA 4ZZ0A 5DM70 2YR0A 1VCOA 1JQ5A 4X45A 1FSFA 3A6KA 1LJUA 1M1NA 5LZ5A 1AQ6A 1K2WA 4GU5A 3ZDYB 2CBZA 3LC2O 1UEXC 5JE8A 3L05A 3ND7A 2V9ZA 1X7WA 1L4BA 3WGUA 1RIIA 2FW1A 5KTRA 3M6VA 1T1EA 2D2IA 4AJNA 2B6HA 2IEGA 2VPXA 4QJ5A 2BTEA 4GZLA 2DXIA 5BSKA 4N7RA 4W82A 2CLHB 1KU0A 1DO0A 4F7DA 2FFRA 1AMOA 3N8HA 3CRW1 3OO1A 4LNAA 4N54A 4EM6A 2XMDA 2N47A 2QUHA 3KX2A 1R16A 1XLTC 2FMIA 4L9SA 3OLXA 1YS6A 4QLAA 2CV0A 3QX3A 3TSYA 5KYKA 1X2BA 2Y9MB 2ZTMA 5IVPA 3AI3A 4LJ5A 4U4AA 4ZAZA 3RF6A 4UCFA 3D7NA 2GF0A 1JG4A 5CDFA 3P9XA 3T56B 3HJCA 3DOJA 3TJRA 2V5AA 3I9OA 4RENA 3H87A 5EHIA 4TWZA 5IAGA 2ZRNA 1C1DA 5AJTA 3ADCA 3UB4A 5BMVB 3ETEA 3HCRA 2QR2A 4CTMA 2FEPA 2V9CA 4GYKA 4IOLA 3NDJA 4KUGA 3LE8A 3L0CA 3M1LA 1PQUA 3THOA 2ZJYA 1Q86D 1GCUA 1LRKA 4E7OA 3WAJA 3U44B 1Q17A 4TZTA 5A03A 2ORVA 1RC0A 4ZYVA 3E23A 2NU9B 1BS9A 1DCKA 3GNQA 3SSOA 2FUNB 2CLMB 2IL1A 5AKEA 4DFDA 4TQGA 5AVSA 5EJ5A 5A7FA 1F2UA 1HUQA 3SQOA 2CL5A 1MJHA 3WWEA 4OQDA 1J1UA 3BGWA 5CH5A 1UM9B 3VOSA 1YK0A 3MG9A 3TEMA 1GGMA 1DT3A 1V3QE 1ZOSA 1D2EA 4LV6A 4Z86A 4P36A 2PX8A 1M73E 3NHAA 3ASPA 4WZAA 2IYFA 4Z4WA 2EOAA 4EL5A 2ZRPA 3KEQA 3KO8A 3MGKA 1TMOA 1N2HA 1OFTA 2R79A 2GCEA 1FFDA 4PN7A 3COYA 2G9NA 3EG9A 1LTQA 2QIPA 1XELA 3JAMA 3WLPA 2B83A 3MGAA 2WZQA 4KGDA 3UHJA 4BNHA 5I7OA 4Z3OA 4X7PA 3GWGA 5CXQA 1KTVA 2WPNA 3NWPA 2ID7A 1IVYA 2JFNA 3DLHA 3FLEA 5FA5A 1QU2A 4GBGA 4BX0A 2RGRA 4Z8XA 3DHEA 3RR2A 3AY3A 1KK3A 2A0KA 3MTAA 1U90A 4LJYA 3O8OB 1YIDA 3LPLA 1I7SB 1H0SA 4G1VA 1IRIA 3ROZA 3BFXA 1L5KA 4E1BA 2BZGA 2A9RA 2D13A 5DGDA 4J75A 3H2JA 4MYHA 1NI3A 4UC0A 4B5LA 5A4JA 1Y3IA 2W6ID 2OZEA 4FLFA 4NENA 1RQ2A 4XWYA 5IYNA 2OV8A 1C7JA 2IUSA 5A1JA 4EHDA 4IEIA 2M1ZA 4JGBA 1CSEE 4L57A 4YEDA 5LCXA 3SZMA 5JNSA 1WZUA 4OFXA 1YHYA 2WM3A 1GZUA 2ZE5A 2B4AA 1Q74A 2QLJA 1AS0A 2D5CA 2I6XA 2X1HA 1ZQ1A 3NHFA 1CP3A 4OQNA 4E5DA 4OGGA 3NE5B 4R1MA 4Z4QA 1UBEA 1NVVR 2H31A 4YP7A 1U5CA 2P2DA 1IEVA 1Y9DA 5DYNA 1R4ZA 4D3FA 2OCBA 1JHXA 2I54A 4A8HA 2HWKA 5ICSA 2NXEA 1NKVA 2C4VA 3DBRA 3EASA 3P0RA 4X44A 5THKA 3ZHZA 1LQTA 4MPJA 2PUDA 3RJMA 2C2BA 2AJCA 3EXIB 4LXXA 1Z22A 3YASA 1U11A 1YASA 3LT0A 1Q1GA 2GERA 2IOHA 2Q6VA 2I4OA 5C5IA 2O8NA 1K75A 5IRCD 5BO5A 4LOIA 3IYLW 4GMKA 3THRA 4J4BA 5IYWA 2QX7A 3GROA 4ZO6A 1XCGB 1DJPA 2FPGB 3IAHA 3BFPA 3DR5A 3LRXA 2CXPA 1PJ5A 5IYQA 1Z5GA 2RBEA 1DXQA 1KS2A 2VHJA 2AF3C 3EARA 1CJKC 1WHSB 4HNQA 4X8OA 4F9TA 2N42A 4G0MA 5K2MA 2CXSA 3E9EA 1YDHA 3U9LA 2ZE8A 2P3QA 2OOKA 5EZQA 3SHFA 1J0CA 1KD1D 4A23A 3KSUA 5FPKA 3WFZA 4OH7A 3JPYA 5EMLA 3HCAA 2XYVA 4J76A 1BX0A 5EMJA 2CHFA 2WSBA 4YCDA 2ID8A 1KVRA 1FU4A 1JU4A 3RHSA 3WV5A 1BVHA 5KC8A 3M89A 4C4ZA 1A69A 2VLBA 5AW7A 1U2EA 5JR3A 4HWPA 3L4EA 2LNDA 3Q6IA 4WXPA 4JD5A 4U7PB 1S3FA 2KM1A 5AK6A 2PX5A 1N3BA 1GRNA 2R11A 1D6MA 3BCSA 2YJ6A 5E4FA 2KVOA 1KDPA 4ODIA 3ZVKA 1P6XA 5FTMA 1W9HA 2XSZA 3OC0A 3FCAA 2D3LA 3EBLA 5DBHX 4PZEA 2A8YA 3I6IA 4WFQA 1EVYA 1I18A 6PFKA 1JEDA 1S8NA 4QG7A 2H2FA 3ICPA 3L8ZA 4PLPA 4XLFA 3ET4A 2WUFA 2QD1A 2HXYA 1G8SA 3H2YA 2SKEA 3OT4A 2NM0A 2NSHA 3CR7A 3RVPA 4QEDA 2B21A 1ANKA 2FEOA 1XDZA 3HDQA 2XD4A 3SKVA 3EVFA 5AK0A 1Q50A 3GEBA 4HCJA 3CO0S 2TMGA 1XALA 4LEIA 1QE5A 3GNLA 8OHMA 4R40A 3WTBA 5EXSA 3ETDA 1IZYA 1Q1NA 3KELA 3Q7RA 4J1TC 4I1UA 4MV9A 4BQQA 1K0UA 1T8SA 3D8BA 3ZQJA 4EI2A 4F5ZA 1U0BB 1BH2A 1VIVA 3COSA 3QMWA 3AM3A 1JR2A 3EGXB 4IVRA 2HSJA 5C31A 3ER8A 4HWGA 4XVQA 5BMOA 4ZOAA 3QYFA 3NBYC 4II3A 4ZCPA 1ZNWA 3ZJYA 4LZJA 1V6SA 1YB5A 2ADOA 3KQWA 2VQSA 4Q1BA 1Z12A 4KNYA 4GR5A 3OFND 3QY9A 1BOOA 5DHAA 5LWQA 3EAQA 2IHKA 5AKGA 4QE3A 4EUFA 1SZPA 2WM2A 2Z4SA 1L5VA 2PJDA 3AIIA 3B3QA 3K8OE 1WR8A 4KUEA 5HBRA 3PEYA 2DQZA 3E9MA 3HCFA 2XKKA 4H6PA 4KN9S 4AUNA 5C3MA 1E3MA 4US0R 3FZYA 4RCVA 1RRGA 1CVLA 1RYMA 2GJRA 4ROXA 1MO6A 2J6IA 4P38A 4EBBA 4TYWA 1DAEA 1UT6A 1YTLA 1ZJYA 2VWGA 4PVDA 1M1YB 5EUBA 1AHNA 5KQPA 1RR6A 3NKFA 1FVOA 5TC4A 3KUXA 2RJNA 4D0RA 1QC5A 1MX3A 2QLMA 3I5AA 4F3YA 4LZNA 2Z5LA 5L3VA 1Z3IX 3CMAB 1PD0A 1S5PA 4LOHA 4D4KA 2XUQA 5KSWB 3GT7A 2CXHA 1UKBA 5FWYA 1ZH8A 5LZ4A 3R75A 1J5EB 5ITWA 4K6CA 5F1KA 2OLJA 3H99A 4KREA 2GYWA 3MIIA 1NVAA 4TTTS 1WVIA 1KI8A 2E1RA 1JMKC 1SY7A 3Q2OA 3Q4GA 1JQEA 5ALDA 2WUEA 3KB8A 1HPLA 4WN9B 1M5RA 2YQZA 4AL4A 3EZ9A 3A6DA 3R5JA 1K5GA 2W2TA 5DTJA 1A1VA 1C5KA 1KI2A 5E1OA 3JZDA 1RPZA 3SBEA 2OL4A 1YJ5A 1JJBA 3QVVA 2LE0A 3VOBA 1E6LA 1KZLA 3V4RA 2LR0A 2HBQA 2I7CA 2ZBVA 2NW6A 3TLYA 4J16A 3QPUA 1XTTA 3UMMA 3QYAA 2OHXA 1F0KA 2X40A 1QVFB 3EVEA 3ZDXB 4KQEA 2H4FA 5K8JB 1E3WA 3MCTA 4RKQA 1RM3A 1WCV1 1WQ3A 2FK8A 4UUBA 3WWZA 4EKYA 3W5UA 4XVRA 2HHLA 1J06A 1E77A 1ABFA 1QYIA 3FYTA 1IBRA 3MPOA 3R7WB 1DBIA 2JIBA 3LY9A 3QE0A 3LC7O 1U9YA 1OXUA 4FXOA 2PKCA 1EGHA 3TM4A 4JL5A 2V6FA 5JFGA 2VNAA 3C6XA 1NVEA 3CF4A 3EH2A 3IBFA 4A82A 1WDMA 4AY3A 1EJ2A 4R41A 3IAEA 1F14A 5F21A 5DGCA 3AHHA 3ZDDA 1C8VB 5AVUA 4HWOA 1D07A 4MW5A 5KW9A 1RU3A 1ZBQA 2GCOB 1EX6A 1FS4A 2E0IA 2C7VA 1ZIXA 2W4IA 3ED5A 3WFIA 1XK6A 3BAFA 2UUAB 2WI8A 3D6FA 3C74A 1I7NA 2Q21A 1L5HA 2P5TB 2JLAA 3DKIA 1EUQA 1FVXA 2J59A 4FBMA 4G89A 4ASUA 2HJVA 3OQBA 4BGEA 1C9NA 1PJ7A 1JR3A 2PR2A 2R6AA 3DLBA 3H18A 2JAOA 1L4GA 3A9TA 3BX1A 3MHTA 1A8UA 1V2GA 1YRBA 1TO6A 5K3FB 4DRZA 5I48A 4BDTA 1BW9A 4I55B 4QPDA 5FCDA 1EFUA 2I67A 4COKA 4FONA 4HJRA 2JHPA 3ZLUA 5KVCA 5HMLA 4QDKA 1X80A 1K92A 1MH1A 3LUHA 2FN9A 4GBED 4QV2A 4ESEA 2Q3DA 2AYXA 2QTTA 5B6IA 1XPUA 1W9MA 5CG2A 2JGKA 2EKQA 4Q15A 2B30A 2QYTA 4PLCA 3OM8A 3DTVA 5EIFA 4AG6A 1T36A 3LU1A 3AUXA 1TNDA 4JA2A 1CLEA 3KVOA 1A8PA 4NKRA 3IHKA 3ZBPA 1ML3A 3MGBA 1B26A 4C2UA 3VOAA 1AHIA 5DX0A 5AWFC 5LD2C 1QHGA 1VBFA 1ORIA 1XR3A 2JVKA 3HFJA 2NQTA 2X0RA 3U7IA 4FP9A 4JYMA 2P4UA 5GONB 4DLZA 1WY5A 4LYHA 3BN3A 4CT4B 1P4GA 3RY8A 1W19A 1NJID 1KZYC 1BRTA 2WAOA 3AP3A 5ITZB 5EUQB 3HJHA 3PC8C 1YAHA 1UK7A 4BNGA 2DKOA 2G70A 2ZSHA 3NIWA 1GNVA 4RVCA 4F7WA 4H4EA 2NXWA 5KNLA 4N12A 5K09A 2ZR8A 3SEZA 3QVLA 5AVVA 4GRIA 1QKIA 2QXUA 2ZR7A 2VSNA 3R7NA 1ULAA 3MMXA 4YJGB 4KQ1A 4H7PA 4KX5A 2F3PA 4CQMB 5FOVA 3DGFC 1AE1A 3LQRA 2A94A 4P8RA 3W4IA 4P34A 2GEUA 4URXR 3CY6A 1ORTA 3QRWA 3PJRA 4UTZA 3GLHE 4Z4SA 2VHCA 3FF1A 4C05A 1QF9A 3VNSA 3CB4A 2OM2A 4X0CA 1YVDA 1BU5A 3HJNA 3P9YA 4I81A 2G8LA 4WKBA 5TRTA 2EAUA 4RIGA 3AVXA 1JILA 2VQ6A 1FLDA 1KMCA 4L75A 4DDMA 5FUQA 5JD6A 1VJDA 1KE2A 4JJZA 3HKEA 4YRJA 3BE6A 3T3HA 3ZGOA 4F3KA 4RF5A 3AWDA 5H0IA 2ZS9A 4D0SA 1J2RA 1W2WB 2FSIA 3JYNA 4KRGA 2ODTX 4V0RA 1R8QA 2QN9A 4C7MA 3KTFA 3ZCXA 1NVUQ 2I4IA 2ZUWA 1UQTA 1J5PA 1U1CA 3CGGA 1G6KA 3KJEA 2X22A 4JL6A 3WL5A 5KTOA 1JLLB 1XUOA 2WJAA 1WUTA 4JLDA 4Q4AA 3HY6A 4PGOA 4UAGA 2PMFA 3SBDA 1YLOA 5CU7A 4LA4A 4PTYA 4DJJA 1ODJA 1Z0AA 4B2LA 3PL5A 3WOHA 2ZIXB 3UMCA 1LGYA 3VDNB 1Y8RA 5TT1A 3G88A 4I4NA 5SY4A 3NC0C 3TSOA 4URUR 3DE6X 4LRUA 3FPEA 1X77A 2FI1A 2JLCA 3LXUX 2QQEA 4IHKA 1QQ6A 2X2FA 3NTXA 2VDWA 3NTVA 2LDBA 1ZWKA 1TA9A 1BN6A 3BCFA 1FNSA 3VU9A 1AB6A 4B47A 2V7TA 4I4CA 4Q37A 2F62A 1JQJC 2YMPA 3EZLA 3GNSA 2VHQA 1J23A 3JSAA 5CIQA 4OX9Y 2DQ4A 4YUZA 2QD5A 3GVPA 2NIPA 3EDMA 4Q3LA 5IDXA 5JZBA 4YAUA 5KHLB 3OU6A 1BMDA 3ABOB 3JWIA 1BWPA 5T8KC 2Y8EA 1FSGA 2AJTA 2VK2A 4EFNA 5FT9A 1PFWA 1WRBA 5AIAA 3PKZA 2Q7DA 5AVWA 3AERB 3RM3A 2XUHA 1GM5A 2ZJ6A 5CLJA 3T1TA 3S2GA 4Z8YA 2I03A 4R3UC 2EZTA 1MO4A 1O54A 3AOEC 2EJTA 2X3YA 6REQA 2G7ZA 1Q82D 1U28C 1TM7E 3DE5X 5FI5A 2ONJA 3NHYA 1EXMA 2ZJ3A 2CVHA 3F3YA 2GDJA 5BR4A 3ZDQA 4UUMA 1F3LA 4HDRB 4G9BA 1Q7TA 3SYKA 4COOA 3T3MB 3L18A 5BV2P 1NVDA 2PT6A 3L8FA 4QT4A 1SCAA 5EMKA 2PPVA 4M0LA 1T2UA 2GK6A 1PJSA 4LKOA 5HS6A 5IFKA 2ZIZA 4W9RA 1R37A 3LLMA 1NBOA 4E12A 4IGIA 5H1YA 1SXJC 4QQKA 2R65A 4XTCS 2AMYA 1JEOA 2R1ZA 4QSMA 5CCXA 4RDJA 2DQYA 2ZATA 3NALA 4I50F 4WKCA 5A5FA 3SJAA 1MV8A 1MENA 2QWXA 3ADPA 1EHCA 4MKZA 1JMYA 2JHGA 3A9WA 4S1WA 1SPBS 5K3DA 4DR2B 1DQNA 2ERXA 1V9SA 4AKEA 5EL0A 4IINA 3M4YA 5LQKA 1XMQB 4E11A 3WLIA 5DBEX 3VO8A 1CUZA 3MM4A 3NBQA 2ZL7A 3GT4A 5FA8A 5BOSA 3BCUA 4FC7A 4KQWA 2WB2A 4QFBA 1BXZA 3B52X 1OH7A 4BAZA 4PHFA 2B78A 1CUCA 1Q7RA 1H3EA 4EJSA 5GJVC 2JASA 4KQGA 3UW1A 4WOCA 3VR5H 3RFCA 1E9EA 1NM5A 1ZKMA 2YC2C 2JPDA 3D3NA 2ZVQX 1KAHA 4J7UA 2IZ1A 2WJJA 4IQGA 3AEZA 1R10A 2B4KA 3IV7A 4MUKA 5BSUA 2X6YA 1QV6A 2FPOA 3LRTA 1GD1O 1B42A 1IZZA 3I83A 1Z0ZA 3PEWA 1QG0A 3LA8A 3H97A 3I6YA 4QDOA 3RYHA 4RDLA 3TD6A 1FQWA 4GUAA 3TPZA 5L3QA 4M8IA 3NP7A 4YJKA 3EFHA 2X1VA 3HGMA 2QLTA 3K1ZA 5INTA 2AKEA 2BY4A 2G4VA 1GSAA 1OFUA 1RYBA 1VL1A 3H4TA 5I9MA 3R3XA 1OD6A 1MC5A 4KXQA 2XRFA 3S1AB 4F38A 3WLNA 4QDXA 4DGSA 3UUEA 5CX4A 1I1OA 2FSVA 1OHHA 2Z1NA 3B1JA 4J1TA 4MGZR 5MGBA 2Q46A 3HS3A 5F12A 4L5AA 4OQZA 5DS0A 2Z0MA 5AM5A 3SC2A 1XYGA 4P33A 4F46A 1YDGA 1JZQA 3RTCA 4O4HB 1DIOB 5IPFA 2YICA 5DOVA 5ETJA 2JJ1A 4UJ5A 4XJTA 1N07A 1K6XA 3C3YA 2TSYB 1EAMA 3OWOA 4HB4A 1TYAE 3RRBA 5KWSA 4ARCA 2XCUA 1NVGA 3O74A 4UTRA 4NQRA 2XIJA 4AYTA 1S7GA 5JAMA 1Z63A 3BL5A 3DM5A 4RLHA 1CR2A 1TRHA 2BGRA 3OD5A 2GTHA 3UB3A 3W1EA 3JQ9A 4A8TA 3FWNA 2P3MA 4Q7LA 4M3NA 1D2HA 1CEEA 3VKGA 4GC5A 1MA0A 5IG2A 1JIVA 1IOWA 5E9AA 4ZCLA 3O4GA 2BJWA 3H0EA 1H4TA 4LDJA 1H8HA 1DAIA 1ZC3A 5DLEA 1ONSA 1H6AA 3U3ZA 1WUHS 5DHUA 4JLWA 2PLAA 4XW2A 5U9CA 4M1ZA 3IQFA 1VKZA 4H0NA 2BBSA 5CB6A 3D0QA 1Y4AE 5B58T 2IELA 2ZJFA 3HBLA 1XT6A 2YL2A 3OC6A 3FCSB 3IQEA 5CYFA 5JBQA 1VQ8B 5FNVB 2IYPA 4DCTA 1ADCA 4OGFA 1JG3A 1KETA 1NVVQ 4PG4A 3DEYX 4EDFA 4QBKA 4KG7A 4X1YA 4B83A 4C4PA 5CCEA 1DJNA 3LCMA 2KQUA 1LU9A 1XAGA 3C5HA 4CF4A 1AQUA 5HSGA 2IXAA 5ALUA 2I66A 2XCIA 3RODA 1PHPA 3E81A 5TQ2B 3T0IA 2CLFB 3ED1A 3HRKA 2L19A 3T9DA 4YC7A 4KVAA 1WCYA 1DCMA 3CYFA 5KJ1A 3Q40A 1K98A 2D0PB 1QH1A 4L0DA 1EX7A 2OILA 3ABZA 3VR2D 3BD6A 1IIRA 2WHYA 1DRUA 3U4CA 3KPWA 5A0VA 2FEWB 3E8SA 3PDWA 2BI8A 2YHSA 3C6MA 3Q8KA 1IHOA 3LHFA 2AI3A 5LQSA 1NQVA 4KPUB 1NBIA 4HZGA 1CDEA 3B53X 4G4SO 2Q0HA 4HEA1 1BA3A 2ZZEA 5L40A 1SBTA 3E8MA 2AWNA 3WKAA 2IEDA 121PA 5CW1A 1KFCB 4JOBA 4G2NA 4MUGA 5U1PA 3QQPA 4KH1A 2FQXA 4ZGBA 1DMSA 3SIPA 3C39A 3JYPA 1G59A 4QUGA 2IS2A 2E4VA 3CSUA 1RRFA 3R3VA 4OM7A 5L4NA 3ND6A 3P9KA 4NBSA 2AVNA 2MIIA 1IXKA 1IHUA 1HX7A 1GZDA 3FTQA 4NFSA 1UKVY 3DYBA 1QP8A 5AJZA 3L4KA 5DNYB 4RA6A 4D44A 3QU7A 2DHDA 4P4LA 4TLAA 5HE8A 3U49A 5HQTA 1KAOA 4J0HA 3RVJA 3QK7A 4BFSA 2CJPA 4TN1A 4KL8S 1Y5MA 2BJVA 2PKQP 4YXWD 3ZWPA 4G24A 3ADBA 1Z5ZA 3WRVA 2FB9A 2QA4B 2OXIA 3ILYA 3OZCA 4O2BF 4XGIA 1X0XA 1X1TA 3AFMA 1K0FA 3AKZA 4B3MB 3SX4A 2F8TA 1QVZA 1SQGA 3G0BA 3NDRA 4GT1A 1JG7A 4IIJB 1OJ7A 3CISA 4WEOA 2Z04A 3VR3A 4D9GA 3P20A 5EY5B 1OKKA 3CVYA 4CWAA 3EF3A 1BROA 1RZRD 1YK1A 2H2IA 1JT2A 4B2YA 2VHYA 5DCLA 2W4QA 3LECA 3JD3A 5EHNA 2R1TA 3QUBA 1TECE 2P2LA 4FCWA 4FR5A 5KYGA 1UJNA 2AFRA 4YECA 1E1RD 5C1DA 4FI3C 3K09A 3IHTA 4BU1A 2C20A 5IVIA 2AB0A 2Z9CA 2BI7A 2DCMA 3AESA 1CUYA 1KI9A 1F8GA 2EU8A 3ECAA 1CZUA 1OIWA 4PIVA 3WADA 1BDIA 2FPPB 1DPGA 1WW8A 3F7TA 4ISCA 4YFYA 2INGX 4KKUA 1RI2A 4IIBA 2IU3A 4TKZA 5A2GA 2HSWA 5JYCA 1RYHA 2JLWA 1CJBA 3BRQA 3HQ4O 1PL8A 2DPMA 2OV2A 2C3UA 1DB3A 3BH6A 4MSUA 4F06A 1WSBA 4ZMBA 5IAAA 2W2LD 1NE2A 2XMBA 1CFZA 3EMVA 5I47A 5DMXA 1Z74A 2RFLA 5EIHA 5EZSA 1C7QA 5LQJA 1PDOA 4RF4A 1K3FA 4YV2A 5KYUB 3X1MA 2I2CA 2CYCA 2QSYA 3D4PA 3LFHA 1ZX1A 2JH8A 3H7AA 1BCSB 2XMSA 3BY2A 1J2JA 2BUCA 2OD9A 1DBPA 3F71A 3HZRA 3RASA 3R9XA 4H6VA 3P9QA 4FI3F 4K40A 2EFHB 1CX9B 1MG5A 2Q49A 4FDUA 2PGIA 4GFDA 1G4UR 2H85A 1WXXA 1X8JA 2ZRFA 2YNMA 4UXJA 4DQ0A 3H17A 2QRQA 2JI4A 2WRZA 1ZAYA 2IY7A 3NKLA 3OE7D 4MVCA 4EPTA 1YQEA 5G2OA 3I9JA 2EBUA 2ZTVA 3D7RA 2Y4OA 1HTBA 3M3DA 3CINA 2RGDA 4X5OA 5DBIA 3V33A 4LWOA 3W5SA 2WSLA 4UVDA 2C8VA 5TX7A 2Z09A 2ZXEA 4LCEA 4XX1A 1LRLA 1I2BA 2R47A 3I3OA 4DCPA 7MHTA 3CNBA 4UOEA 1WVMA 4BZZA 5AP9A 3UENA 3W2IA 1NHGA 3D8UA 1W85B 3RYFA 2GQ0A