The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
62
|
sequence length |
289
|
structure length |
267
|
Chain Sequence |
b'VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSKFE'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima
rcsb |
molecule keywords |
Riboflavin kinase/FMN adenylyltransferase
|
source organism |
Thermotoga maritima
|
molecule tags |
Transferase
|
total genus |
62
|
structure length |
267
|
sequence length |
289
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2006-08-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01687 | Flavokinase | Riboflavin kinase |
A | PF06574 | FAD_syn | FAD synthetase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Elongation Factor Tu (Ef-tu); domain 3 | Riboflavin kinase-like | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HUPs |