2I1LA

Crystal structure of the c2 form of fad synthetase from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
289
structure length
267
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima
rcsb
molecule keywords Riboflavin kinase/FMN adenylyltransferase
molecule tags Transferase
source organism Thermotoga maritima
total genus 62
structure length 267
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2i1lA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2i1lA01
3QE4A 1QTQA 1LW7A 1GPMA 2VXOA 1NUPA 5A88A 1YUMA 3FI0A 4MW5A 1PFWA 4MW2A 1PFUA 4CQNA 1WXEA 2OV4A 3HFJA 1OWMA 1WZ2A 4QBTA 2OQ2A 2V0GA 1NB9A 1O96B 5DASA 1U7DA 1T6XA 4YBRA 3LOQA 4NATA 4BWVA 1U3DA 1JGTA 1VBMA 4KPUA 5H16A 1VBNA 2O5RA 1MBZA 5J5AA 1GTRA 2DR2A 1U0BB 2JA2A 1J09A 2X1MA 2YWCA 3NBAA 5K0SA 3FH0A 1Q9SA 2PFSA 1N07A 1V8FA 1OD6A 2G36A 3N2YA 2C5SA 3LE8A 5LFAA 1F7VA 2QTNA 3MLAA 4L2IA 4KR9A 3H9CA 3G59A 3P0IA 2O8VA 4ZCRA 4MUIA 1TYBE 3TQIA 1N08A 1JIIA 3COWA 1YUNA 4CT0A 1EXDA 1XNGA 3VGJA 2JANA 5FO1A 3CTAA 1JZQA 3PXUA 2CYBA 1FFYA 1D2RA 1K92A 4RUKA 4R0NA 1N2BA 3CVXA 1GZUA 3QTBA 4DE5A 3OTWA 4ZT7A 3CLTC 1NUUA 2WQ7A 1QRUA 3UMVA 4MWBA 3UC5A 1OWPA 3COYA 4GRIA 1O94C 3F3MA 2A1UB 1Y42X 3HMQA 1Q11A 2ZP1A 1M8KA 2X1LA 1VBKA 4MW0A 1HYBA 1BS2A 1LI7A 1WKBA 1PG2A 4I6EA 1SURA 4F4HA 2D54A 2A86A 1JILA 4YP5A 4EG8A 3IMGA 1G8GA 3CVWA 1I6LA 1WQ4A 3INNA 4MVWA 5TEVA 1FYDA 1N2EA 3FY4A 2J4DA 4MUHA 2GOYA 2AZXA 3ND5A 1N05A 3N8HA 5HUJA 4MW1A 1IHOA 1NUSA 3Q10A 4EGAA 1G8FA 5TS2A 3HV0A 1H3FA 4HK4A 1F4LA 1EFPB 1I2DA 1KP2A 4G6ZA 1KQOA 3G5AA 3FNRA 1OWNA 3IOCA 1JIKA 5A89A 3ZUGA 1O97D 1WXIA 3KFLA 4JFAA 1IH8A 2QJFA 1G8HA 1J1ZA 1MRZA 3DLAA 1QRSA 1H3EA 4NZPA 1EJ2A 2IP1A 1YULA 3P0JA 2DLCX 1QNFA 1N2IA 5KCMA 3SZGA 1O5TA 1KH2A 3Q4GA 4DJAA 1YIAA 3PNVA 4MW9A 4ARIA 4R2MA 3CLUD 5HUHA 5FO0A 4RPIA 1PFVA 2AKEA 3COVA 1MJHA 1O95D 3KT6A 3L92A 4KR7A 1TYAE 3G6KA 1Q77A 3RHSA 3X1JA 1CT9A 4MUGA 2PG3A 5DK4A 1K97A 3DO8A 1KH1A 4JZYA 1J21A 1COZA 1TYCA 1K4MA 2PZ8A 4WSOA 2QUJA 4JYZA 4PBSA 1U7XA 1ILEA 4MAFA 3HGMA 3FETA 4ZCTA 3A4IA 4PBTA 1QU3A 2QUHA 2J5BA 3MMXA 3UOWA 2RD2A 3ELBA 1NUQA 3RJZA 1M83A 1XNHA 4KR6A 2PZBA 3UK2A 1YI8A 3M5WA 3AG6A 1JHDA 3IVGA 4MWEA 4EG3A 5AHWA 1JIJA 1WJGA 3IUBA 2A1TR 3HL4A 3KT3A 4XSVA 1X6VA 3IMCA 3IVXA 1JECA 2WSIA 4XFDA 2WB2A 4QREA 3I05A 2Z08A 3KT0A 4KPUB 4OUDA 1N77A 4MVCA 1WOYA 3X1MA 4MWDA 3ND7A 4EG6A 3AG5A 1WXHA 3H99A 4UZEA 5TEWA 3RBAA 1IFXA 4MW7A 3SP1A 2CV1A 1YIDA 2CYCA 1O97C 1XJQA 3P0HA 2YXNA 3PRHA 4MWCA 1R6XA 4L2IB 4A91A 4HJXA 1N75A 3DV2A 3CVYA 2A84A 1JMVA 2R5WA 3IODA 4MVYA 3UY4A 2NZ2A 2DXIA 1N2HA 2HZ7A 2OYNA 5A8AA 2CV2A 3GMIA 4MLPA 1PG0A 2E18A 5LM3A 1H3NA 1M1ZA 4MQ6A 1GTSA 4U8HA 1NURA 1ULHA 3AL0C 3ZJTA 2CV0A 3TZLA 1TQ8A 2ZUFA 1N2GA 3CLUC 3CLRD 4MW6A 3D6UA 5TGTA 3VU8A 4E1AA 2RE8A 1F7UA 1O95C 1Q15A 3H05A 2YWBA 2E89A 2DPLA 2IELA 3P52A 4X0EA 2VTBA 1M8JA 1EUYA 4PY2A 3AKZA 3BL5A 1O0BA 1IQUA 1WXGA 3X1KA 2XRYA 2E0IA 3NV7A 1KP3A 3RK0A 2PIDA 2QTMA 3FIUA 5BNZA 5DB4A 4NDAA 1TEZA 1M8GA 1N2OA 1T6ZA 1GN8A 4S1OA 4FZJA 3SYTA 1N78A 1WY5A 5IHXA 4MULA 2A7XA 1EFVA 2YY5A 3RK1A 3CR8A 5EKDA 1IQ0A 4MUJA 1MAUA 2EJCA 4PBRA 4U7JA 5KHAA 3BNWA 2P3MA 3COZA 4EG4A 4ZCPA 4ZCQA 4JXXA 4KKVA 1MC1A 1NZJA 3MLBA 3ISJA 1UFVA 2QJTA 1KQPA 4I6JA 4ZCSA 3ZJVA 1MAWA 3DPIA 5F23A 3HZRA 1KKUA 2GKSA 1KQNA 4YP6A 1IRXA 5K0TA 4G5FA 3E27A 4MUEA 1IQRA 3KT8A 4G5YA 4MUKA 4EF6A 2XRZA 4MUFA 4J75A 2CFOA 2I1LA 3RFFA 3IDFA 1M8PA 4ND7A 4WNYA 3CLSD 3PNBA 3ZJUA 1PFYA 1KR2A 3SZ3A 1R6UA 5KWVA 2D5BA 2J09A 4MVXA 5H7XA 4YP7A 1ZJWA 2H29A 1QU2A 1ZH0A 2AG6A 2D13A 1IVSA 3FG9A 4J76A 4AS1A 2EL7A 1DNPA 1M8FA 2E21A 1N3LA 2J08A 3IOBA 2A4MA 4AQ7A 1MOPA 2J07A 4UZFA 2HMAA 1WXFA 2A88A 2DUMA 3AIIA 2X0KA 3N05A 4TS1A 3IVCA 3CLRC 3AFHA 1X8XA 1VL2A 2Z09A 3IMEA 4Q16A 4EFKA 1J1UA 3QTTA 4P2BA 1T6YA 2GM3A 2DERA 5HG0A 3IOEA 3CVUA 1MB2A 4U63A 4K0RA 3FWKA 4DDKA 4MUNA 4ZT6A 3U1VA 3LCJA 4JXZA 4NAHA 4CDMA 3A2KA 1S4MA 4GU5A 4NAUA 2PXHA 4QRDA 1F9AA 2CT8A 3ILVA 1P7PA 1Q19A 1N06A 4OUDB 1MB9A 3H9BA 2CSXA 4F3RA 2WQ6A 1B6TA 1A8HA 3N9IA 3ZXSA 3FDXA 1RQGA 3ZIUA 1U3CA 4HJRA 2A1UA 1GLNA 1ZH6A 1O0CA 1TYDE 3IH5A 3SDBA 3D6VA 1OBHA 3PNYA 2BYTA 4ZT3A 3Q12A 1LI5A 1R6TA 2CYAA 3GUZA 1G59A 3MUEA 5LLTA 2QUKA 4K03A 3OP1A 5J59A 1T9GR 4H3SA 4R2LA 4OJMX 4ZT5A 4ND6A 3CLSC 3ZXIA 3JXEA 2DEUA 2A1TS 5FNZA 1EUQA 2HGZA 2CUZA 1OWOA 1NYLA 2Z3VA 2TS1A 3ND6A 1GAXA 1EFPA 2VBTA 1NP7A 3SEQA 2VBSA 2JAXA 1QJCA 1I6MA 1KAQA 1KH3A 4EG5A 5J58A 1OBCA 2VTBB 4MW4A 3TZEA 4DNXA 2QUIA 4ZT2A 1J70A 4Q93A 2ZUEA 3A04A 1NSYA 4NX2A 3A05A 1NB0A 3L93A 3TQOA 3S3TA 2V0CA 1NUTA 3VRHA 5TRDA 4ZT4A 3SEZA 1EFVB 1VLHA 3GLVA 3TS1A 4CDNA 2BTEA 4XFJA 1N2JA 2H2AA 1KAMA 2DETA 2VBUA 1WQ3A 3C8ZA 5DEOA 1QQTA 3CLTD 4EG1A 4ARCA 1QRTA 3IUEA 4DDHA 3TNJA 1N1DA 4DDMA 5JBNA 1O94D 1JZSA 3CVVA 1TFUA 2B7LA 1NI5A 3FOCA 3H97A 1ZUNA 3K32A 2NSYA 3CA8A 1J20A 2QJOA 1V47A 1XNJA 5IJXA 2QTRA 3MXTA 1H1TA 1T9GS 4DLPA 1EE1A 1O6BA 3NBKA 1P4MA 4HPWA 2VBVA 4I6GA 4EG7A 1OWLA 2IJGX 2PZAA 4YMIA 2X3FA 1I6KA 1KORA 1JEEA 3K9WA 1O96A 1JEDA 3ZGZA 1K4KA 3FHJA
chains in the Genus database with same CATH superfamily
2C94A 5BVGA 1QE0A 3ZE8A 2ZSDA 1CQJA 3PNLA 1OYWA 4NSNA 1P61B 1R6AA 4ANFA 1P4RA 5HR5A 3AL3A 5D3KA 1NUPA 1UT6A 3C39A 1YUMA 4G5OA 4GMXA 4PFQA 2R8YA 4R31A 4ZI3A 1IBCA 3NUQA 4AMUA 4E7PA 1PFUA 3B1XA 3IOMA 3PGLA 1TKCA 3RC8A 4FD2A 2YJGA 2I7TA 4AQDA 1QXSA 1CE8B 4I1PA 5I9BA 2INGX 5J2TA 3AINA 4JQCA 1NXVA 3FHTA 2VT3A 4NBVA 3K1AA 5T67A 1WOMA 1RAGA 2OBTA 3U31A 2P11A 3IE0A 1MAAA 3ZE9A 1N9ZA 3UV7A 1BX0A 1C9YA 5G4KA 5EMMA 3GJRA 5FPKA 1YDMA 4DLWA 3N8GA 3QUAA 1SXPA 5EHIA 4HS4A 5GONA 4QUDA 4BRUA 4KK4A 2PX4A 2X1MA 4R41A 5D3ZA 5K0SA 1MDBA 3GA0A 4BE9A 3TOXA 3H9EO 4RDXA 4CT5A 3K6SA 3MLAA 3P9ZA 1P1RA 4TRJA 4QVIA 1CQPA 2Z1MA 5DLEA 1HK7A 2H2WA 4Q4JA 2DF8A 2XGOA 2KHZA 1P2TA 4B84A 4E7OA 2BHRA 4Q1BA 4ZAWA 4Z4RA 5IZ4A 4F2WA 1U6IA 1H6DA 5FNVB 4NXNB 2FN4A 2FPGA 2W2XA 3PPWA 4M6WA 2Z8ZA 2FR8C 2EYQA 5ALFA 2W98A 3ZU2A 2OFWA 3AEKA 1EDDA 3PFBA 3Q7RA 4I5EA 1WPXA 1UWVA 2AX4A 2P68A 2X4GA 4MQEB 4QUKA 4YJKA 5FCDA 3UJ7A 1VCMA 3UWKA 3VVMA 5KOHB 3DE2X 1JXMA 1ZD1A 1D5WA 1N1MA 4XL9A 4IIJF 2KE5A 1X7GA 2IEGA 3OCYA 1YOVB 3IAUA 1ZHOA 1U98A 1YZNA 1NUUA 3SDZA 1KMHA 4C22A 1DRJA 2QRVB 2XMGA 5DOZA 3U6KA 4FMCF 4UUMA 5DPMA 4BEWA 3AQ4A 4WV3A 4YWJA 1UBRS 2G6BA 3VR3D 3GQVA 3VR6H 4N41A 4IM7A 4JT4A 5H68A 1P75A 3EVCA 3T53B 4UOQA 2PUDA 3KWJA 5GZ1A 2GJRA 5JJIA 1HYBA 4FQ5A 1BS2A 1LI7A 1YB5A 2VWHA 1UD8A 4I6EA 4B2LA 4BV2A 3D3WA 5IJ0A 1PJ7A 2ZIGA 3FPPA 4PAGA 3ETHA 3SJ7A 1UWCA 3KETA 5F9MA 3L7BA 4E3ZA 1MABB 3H1BA 3OETA 3KWLA 1F8UA 5CIQA 3CVWA 4Y6OA 4ER0A 5IMBA 4CUKA 5JECA 3P4UA 4KLZA 4CG2A 3WKBA 4F11A 1XG5A 2OR3A 5DKFA 5H3LA 3PCTA 2YJNA 1N05A 5C32A 4D4LA 4TKLA 5JNWA 1Q1EA 1MRSA 1THMA 4W5JA 1F4PA 4DDUA 1R4AA 4ZPXA 1NYRA 5E4TA 1FMTA 3ZBUA 5EKSA 2V55B 1F1JA 4QDKA 1V95A 2WSSD 1XTSA 4Q03A 4BQOA 1JTVA 1LUAA 1H4QA 2DPMA 5KX5F 1NV9A 5AJZA 2CL5A 1SR8A 2FSVA 1ENZA 1GR1A 1WVGA 1ZRMA 2V03A 4A6EA 4UASA 2QRNA 4KYVA 4S24A 5A5EA 4QG3A 5LLSA 1IH8A 1Q5PA 1QHHB 4G81A 1P7WA 3NXSA 4KQ2A 4REOA 2VSNA 4V03A 3RYFB 3VHQA 5JHHB 2O8FB 3EZNA 2EJWA 4TYPA 5A7GA 1TXGA 2YUTA 3OECA 1W47A 2JFNA 2FQWA 1P91A 1I1QB 2HU8A 1M7GA 4JP5A 1W2WB 2W2QA 3AP3A 2QP9X 3B6ZA 4D74A 2ZBPA 4CT4B 2HBQA 4EP1A 3RADC 2REBA 3CEHA 4H59A 4IH9A 4TV9A 1JA0A 1E18A 4YRJA 1R6DA 1SHKA 1XHFA 4INPA 1YKFA 4M55A 3IIMA 4OQDA 3I4FA 3L49A 3NOVA 1TM5E 5AK0A 1B0UA 2J9FA 4AG3A 3LDUA 5HOEA 4FSXA 4KG7A 5EIFA 2YYAA 2PFGA 1XD9A 3CZ5A 16PKA 1D2HA 1EDEA 2GN2A 1BRMA 4D45A 4US2R 2J33A 5K0EA 2UZ3A 2PZEA 4IICA 4DYDA 4WZTA 4OK6A 3SYKA 4MI9A 4IIFA 3LWBA 5FBKA 1QORA 1WA5A 2V3VA 2WAOA 4RK0A 3VTKA 3JQ7B 4BNLA 3THYA 2AG8A 2VRCA 3ORQA 4C4TA 1Y48E 3U13A 2ALJA 1I36A 3IHKA 3L6DA 4KH0A 3K4PA 3QI2A 1XLWA 3PI7A 4PBSA 2XBLA 5JMWA 4I8DA 3OWXA 4R05A 5A4FS 1JP7A 1F48A 2HHLA 2PDAA 3HJTA 4FLFA 4PIMA 3SF0A 3K1ZA 3CNEA 4PPYA 4GNRA 4DA7A 3QYPA 3BJRA 1RJEA 1P4SA 1YRBA 1OQAA 2PM8A 4WK4B 2CFIA 1RRGA 2ZSFA 4S2UA 2V5AA 3TFQA 4E15A 1GT91 1RZRD 5ALEA 4YCSA 4KN8A 4EARA 1CJKC 4H7PA 4EGFA 1A9TA 3C43A 1RTKA 2JGJA 2VL7A 3KR1A 3O7WA 2J85A 4UNSA 1RXEA 1TZBA 3KUXA 3GIRA 3IR5A 4DIUA 3HVJA 2JLQA 1BWRA 3K8YA 2QM0A 1FBNA 1MGPA 3PQ8A 4G4JA 3LBNA 1E3WB 4O2BB 1NR5A 5TQVA 1EVLA 2IUEA 2FETA 1E79D 3B89A 3BQ9A 4DSTA 2H51A 4Z7JA 4OPVA 1X6VA 2WJIA 4IQ0A 3TIGA 4TYQA 5DCLA 2WSIA 4YJ3B 3D7MA 4XFDA 1O89A 5JZOA 4MKRA 2Z5FA 5CDUA 3PGVA 3DE4X 1DBWA 2ZITA 5FA6A 1N2ZA 2F90A 2P35A 1AO3A 2A14A 3DKKA 4MVCA 3VPHA 4F9FA 4DA4A 1IZYA 3VU1A 4RPGA 1JKIA 1CF4A 4OCZA 1GL7A 1XOIA 2BFEA 5EFZA 2DOKA 3V2HA 1OSNA 1WUJS 4UM7A 4EG6A 4W5TA 4C43A 2QDXA 3AHCA 3TL2A 3PHHA 5G0VA 2HDNB 4X94A 1YIDA 3M5DA 4J0JA 1Z7EA 4JLMA 4UD2A 4YUAA 4DK0A 3ENVA 2FEMA 2OTJB 1C0EA 4JOSA 1VZ3A 4XVUA 2VSOA 2ZLBA 2Q3EA 2B8NA 3R40A 3WGTA 1DG3A 3ESZA 3WMWA 4TLDA 2UUCB 4GYWA 1KAHA 4N3GA 1VJ1A 2QORA 3IODA 2OV3A 2OCXA 2VDPB 2OPBA 2DXIA 2WD8A 2HZ7A 1W8DA 2OO5C 4LRYA 2VJKA 4OHFA 2J5QA 4GZ5A 1XK6A 4TXHA 5MFPA 3VM6A 1Y6QA 3DGEC 4HGQA 4MVJG 2GHRA 1KOLA 1HQDA 4X6LA 2B4RO 1MFZA 1T3TA 2EDCA 3BWDD 3JQBA 5EL0A 5FV7A 1IYZA 5IG2A 2IU6A 3NW9A 2JJMA 4M9CA 3VYRB 3AHGA 4MB2A 4M0LA 5LZ2A 1VQ7B 4G4IA 5JCJD 2O7SA 3CLRD 4E1AA 4TTAA 5D84A 5DLPA 5AVZA 1EJBA 4KIJA 1PI3A 3OPYB 1NNUA 4ZWNA 3ZXXA 3HDGA 3OMLA 4PZ9A 5HQTA 5JTUA 2J87A 3ZCUA 2E5LB 1LBEA 1JYSA 2LP4Y 4GHWA 5E4FA 4JUCA 1PNOA 1GU1A 4PY2A 5LP6F 3FYUC 1KC3A 3X1KA 2WZBA 2OYRA 4AZSA 3SU8A 1HDYA 1KSJA 1FEZA 1SCQA 2WJPA 3BCRA 2V7UA 3E0QA 2J3DA 2JHFA 2RGUA 1OFTA 4IIBA 1P4GA 1V8OA 5EEGA 5IJAA 1KZHA 1N2OA 3R5JA 1NA5A 4CMIB 4ENSA 5BYAA 4YHHB 2RONA 1SD2A 5BN5B 4ASUA 5IKOA 1KD1D 4FFMA 4BQFA 4EYEA 1P72A 3EAGA 4ENTA 5JEDA 3ESBA 1EFVA 1R4MA 4FUQA 4TRRA 1XVTA 3G23A 2AFIB 3IOYA 3G2QA 2AXQA 2GNAA 3CNQS 4EA8A 4QRHA 1DG9A 1HYEA 2ISSD 3QSGA 5FAKA 5I9IA 4ABTA 3FWYA 1HFJA 3ORSA 1RQRA 1MC1A 3OSUA 3PRYA 4D6XA 4JHLA 1LVGA 2IEIA 2D74A 3NTUA 5JV5A 1N4DA 3GLTA 4MPDA 2VHXA 2G9UA 4Q7LA 3EXAA 1KYYA 3E81A 3NHKA 4BPBA 1THTA 4NZ9A 1IRXA 1ZC4A 3U0VA 2PZLA 4C6TB 3FKQA 5FX2A 1TM7E 4AUNA 3EXHA 1GEEA 1Z0SA 2Z6BD 2D3NA 2V8OA 4IDBA 4NLLA 5DRTA 3EQ7A 1WB5A 2GBIA 1ESNA 4MUKA 2HMYB 2WPDD 4EA7A 1RKBA 4KN6A 4TUYA 1X2EA 2H7VA 1ISHA 1FXWF 1T9AA 2J6BA 5TQJA 2P9QA 3Q88A 2FUG1 2HN9A 3BDIA 4XYBA 3ZWYA 1XWIA 2G76A 4AMZA 3G1TA 3K9FC 1EUDB 2I67A 3NHWA 3JALB 4NDNE 3LUFA 2UXDB 4DVJA 5IMSA 3V7UA 2H57A 4DV3B 4JJ7A 4XWOA 1KO1A 2Y0CA 1PS9A 4LF8B 1U0HC 4UZUA 2MHCA 4ZPJA 2OXEA 4BHTA 4NESA 4JVMA 2E1PA 4FUTA 3IBGA 1NTRA 4FN4A 3HB1A 5TT1A 1LPMA 3EZ6A 4G65A 2A0UA 2EL7A 2GGSA 5LJIA 3DT6A 4IDEA 3C3BA 2E85A 4S1WA 2VF5X 4HDSA 3RVLA 3X2FA 4B9AA 2Z6QA 5H3HA 2LE0A 2PV0A 3QJGA 2HXGA 1JKJB 3HGQA 3ASYA 4OYHA 3HA2A 4WBSA 4GC5A 3RIEA 1PNTA 3STHA 1D5CA 1OIWA 4QFMA 1UT5A 2SCUB 3IBFA 3TDNA 4RTOA 1GTJ1 2XNDD 3R6JA 1W2HA 5DXAA 3MAAC 3IVCA 4N5LA 1RWKA 4E5PA 2RAUA 4ZIRB 5G41A 1TF2A 4QD3A 5EE5B 3TQHA 3IMEA 4RMGA 5GOTA 1V48A 5JOQA 3OQOA 2PS0A 1X1RA 1DDGA 3HUDA 2ONCA 3GLGE 2FGJA 1E1NA 1W75A 3PFKA 4EY6A 2UYYA 2MU1A 3OHMA 3OQVA 1XWWA 4MQLA 4PIPA 4U63A 3WSWA 2OC4A 3KKKA 4K0RA 1LW6E 5JH7B 1XQWA 3GCGA 4EJSA 1FIUA 1IULA 1GPJA 3ORHA 3K15A 4YNBA 4Z3DA 1JH8A 2D00A 1X9IA 4RSMA 3KQSA 1S4MA 1EJ0A 4C4PA 1I4OA 1S02A 2PWZA 3QXGA 1VCHA 2G70A 1VHTA 3LCMA 1BKSB 1XXHE 2NYVA 2RJOA 4JT9A 3W4IA 3PF9A 2ZTMA 4AJ4A 1M5RA 2EQAA 4AFNA 1Z4LA 3S8EA 4HOYA 1VKOA 4C0SA 1G2QA 5TJ9A 2MYTA 5C8XA 1GUYA 4JEMA 3IC5A 4MV3A 4BEJA 4EEKA 5EXDA 2Z43A 4D56A 1FCJA 4PRLA 5FL7D 1ZJZA 1QE5A 1F2VA 4QQKA 2YZKA 1K66A 2J7KA 3H3JA 4HAUA 3NV9A 5CVCA 3KFVA 3O4IA 1CIVA 4XORA 1MQAA 1TYDE 1UJ6A 1X19A 2Z8YM 5LLDA 3HR4A 1GCIA 1OZAA 4PO9A 4RTSA 4FTWA 4QYMA 3VC7A 2Z83A 2MSNA 4GI1A 5JMPA 1E61A 3K7EA 3VDQA 4EZEA 2CYAA 1VJ0A 3KEMA 1QTNA 1UWLA 2ZJAA 3HSKA 4LJYA 5AVOA 1PJTA 2NYRA 4AULA 4C0BA 3CWZA 3PWKA 4N7RA 2I2WA 1DUIA 2WHYA 1MT0A 5E7JA 3HYCA 1U8TA 2C95A 5GJVC 2HPAA 2EJTA 2QW0X 4GXQA 4I3HA 4DA8A 4NQRA 3EGEA 1WQ1R 4U7PB 1CG6A 1A76A 1FFXA 1YRAA 2CXSA 1XMIA 4HZUA 4IIXA 3WV4A 4JN6B 1KE2A 3U4CA 2VWPA 4U6NA 1NF9A 3R24A 1HTBA 2FEOA 3K6KA 4PR3A 1RR6A 3SEQA 2VBSA 1D9ZA 1VGRA 1KAQA 5COBA 2RGNC 3V2GA 3QWFA 1FXUA 4A5SA 1RIIA 4HHEA 4BO1A 2P77A 1VIYA 5ENZA 1PKVA 3RHFA 3L4BA 2ZJ3A 2NUTA 3UTCA 2AL7A 3A04A 3ONYA 2G3YA 4NX2A 5EZYA 3UNXA 1U9ZA 3MT0A 2BFFA 4UD6A 2PT7A 3LPCA 4WOKA 5AJTA 1I3MA 1FJGB 4IRXA 1U65A 2JFZA 1P9OA 1Y3IA 1QVAA 3D31A 3KJZA 1WHSB 4D4KA 1FOEB 2E9SA 5K7SA 1NG9A 3R5XA 3ED5A 3ZOZA 1P6QA 5F21A 4XM2A 4CDNA 1XZJA 4YRGA 2FCAA 1S9HA 4Q48A 2BEJA 5AH0A 4J4TA 2NZXA 4LFCB 4MGIR 1A8SA 5LZ8A 1ZI8A 2MINB 3GFPA 1GQOA 4R2KA 4CLHA 4ZC8A 1XI2A 3P9YA 5J2UB 1XQXA 2RAPA 2X58A 4RGQA 3ZXUB 4LG1A 3ZJ4A 5JZ9A 3IL2A 1YQWA 3HVHA 5IDVA 3WFIA 2OHOA 4R1NA 2TRSB 1NI5A 4B45A 1D6MA 4NENA 1I3KA 4RTNA 1CX9B 3HA3A 4GYYA 1UJ4A 2B4QA 5C5DA 2PZGA 3BWMA 3I53A 2I66A 4HB2A 1IUKA 2PR7A 3ECAA 4OP2A 4DM7A 3FF1A 3WLTA 1RADA 3WLFA 1U0RA 2R86A 2NVUB 1ODFA 5L51A 5TXGA 4MO2A 4B6GA 1PZXA 2AJTA 2G77B 2ZBQA 3BWYA 1YJWB 3QPWA 4BU1A 2G5GX 4NHOA 1OFIA 3HCPA 1X7HA 3T7AA 1O96A 5FOSA 5ILOA 5F98A 4HFNA 3N0TA 1Q14A 3N6RA 621PA 3W2HA 2O8DA 3GF4A 3KEOA 5ALUA 4DG8A 5CGQB 4Y3UA 4QASA 1KJNA 3FYHA 3GC6A 3ZCRA 2VTEA 3OLCX 1AQYA 2O0MA 3L8EA 4QGHA 2HSJA 1RQ7A 1BE0A 5BWBA 3P9IA 3V1YA 1NW8A 2BCGY 3FBGA 4LQ4A 2YV1A 4OQFA 4OI2A 4M1OA 2I4TA 1EGAA 1S1MA 3LLMA 1GYRA 2R00C 3PRKE 1N9GA 2N9UA 3PDIB 2GEFA 1UR5A 2ORED 3BFVA 3AUKA 3L8MA 4WA7A 3ANLA 2PRJA 3JWPA 3CCEB 3Q3JB 2C5GA 4OL9A 1VCIA 3VU9A 5H16A 1PDOA 4BMZA 3ICOA 4PINA 1CS0B 5ICMA 5F7OA 3ECSA 5CT8A 1C4OA 4UBLA 4BLWA 1K28D 1K7XB 1DARA 1E2MA 1R10A 1XRQA 5KNBH 4JBYA 4UDNA 2NO5A 3GRKA 3AM3A 3CLHA 3COPA 1KNQA 3F6RA 3MCUA 3OE7D 5LZ5A 1RJFA 4AMVA 4C2AA 5BPHA 1Z4NA 1ZM7A 1SUSA 1Y8RA 2C2YA 2C1ZA 4I4NA 3RS5A 3I61A 2IHBA 3BKXA 4RK7A 2C4VA 4H3HB 2O07A 3ZE1B 4BC1A 1N5DA 1AS3A 4CPDA 3BCSA 2GILA 3RKSA 1WP9A 2IDMA 5JIBA 4RTKA 2AMYA 1Q0TA 3IHLA 4MUIA 3AH8A 4X8OA 1O08A 3HJBA 5DNUA 1WD5A 4JOCA 3KPUA 4NU6A 4QBIA 5I4IA 2RHWA 3M1YA 3VAZA 1SUFA 1U9IA 3H8VA 1XVIA 1JIIA 3OJWA 3E23A 4MPPA 5F77A 1ZH8A 4PYNA 4GDFA 1U4SA 2RI6A 5IK2A 1DJOA 2ZR8A 4U0KA 3ZVMA 3BXEA 3D8RA 1XDWA 1ZK2A 3DDOA 3PHIA 1RU3A 3CVXA 1K6XA 1NMZA 1T26A 2LUOA 4J7UA 3EXIB 3DBRB 3JASB 4RIGA 3OEWA 1Q81D 3OTWA 3LL7A 4WOBA 4ZAZA 3SBXA 5AD1A 5CIYA 1LLDA 1LNSA 3DB2A 3SQDA 4X85A 4YR9A 2Q7DA 1L8XA 3H0EA 3VV2A 2HA0A 3HCWA 1FRQA 2I1VB 2MYNA 1OB0A 2O7VA 2HY7A 3AF4A 1K6MA 4FGUA 5CX1B 1M8KA 3EGXB 3LZDA 3OEYA 5H4GA 2ZSBA 2AEJA 3HG7A 5LMUB 5LD2C 1PG2A 4O4LF 1ZJ5A 2I6UA 4AU1A 4HYYA 3RYCA 2ZYAA 4EHAA 2BI8A 1P8AA 3WP1B 1VPTA 2EGGA 4D98A 2ZBDA 4ACAA 4FFRA 1OHHA 1F9EA 2VAMA 3FPEA 4XGKA 2VUUA 1AQIA 4NG5A 2VIIA 1WW3A 1DXOA 3QV1A 5I9LA 3F3KA 3CX3A 3PNSA 2EW8A 1KQGA 1SXQA 4RLZA 3Q10A 3R09A 1X1EA 2P9HA 4Q3CA 5JNVA 5TS2A 3DLHA 4WKNA 1FS6A 1MG0A 1FFSA 1EXWA 3KSMA 4L8YA 2H1VA 2IV7A 3LX4A 3UK6A 1JLKA 3QQ5A 4TSFD 1JNYA 3CCLB 4D26A 1QG0A 1DKMA 4OL0A 1JIKA 4LNHA 1K9MD 3IS3A 1JHPA 4WRRA 4F2DA 3ZDBA 3D5QA 4JFAA 4LJAA 3QLJA 5DI3A 4DR5B 1A96A 3UGTA 3HBNA 4WKCA 3WLAA 5B37A 4KDRA 3P9KA 3OOEA 2HHAA 5CA1B 5JNSA 5FADA 3QKRA 5EXPA 1YBAA 4O4JB 4CLRA 1X7YA 3I04M 5EZSA 3LGSA 3L0YA 3HU3A 2GLTA 3HVRA 3HA7A 5LNK6 3U3MA 4JEIA 4RCYA 3AJ9A 5IFLA 1DIRA 2O2ZA 2A67A 4UREA 2CVHA 3CF4G 2EX4A 3LOUA 4IQ8A 4R6WA 4PQYA 4F4DA 4ARIA 2Q5EA 3QLTA 4EI7A 4WESB 1E59A 1OTHA 2ZAMA 4QQ8A 1ULBA 2NAFA 1AHIA 3LF2A 3AFGA 3MINA 4WMLA 4DJDC 5FPTA 4WK6A 2Y0EA 2GF9A 1NDHA 4M7WA 3K4QA 5KJEA 1U8CB 1XZKA 2VLBA 3G6KA 5K3CA 4AMBA 4IWXA 2PKQP 2F48A 1YS7A 2W2LD 4OQ4A 2PCJA 1MJNA 3INRA 1G21A 5FTLA 4RNCA 1KI2A 1DEHA 2NXNA 1N9KA 1VCOA 3FUTA 1PGQA 2JCSA 2QRPA 1NZFA 3FRHA 4Y30A 5DXJA 3ZKAA 5L7WA 3LTEA 3EMBA 2ETXA 3G5LA 3AVVA 2H9YA 3KVRA 4KQGA 2CZGA 1LDNA 2CLEB 4YJGA 3BIJA 4K40A 4MI3A 3EDYA 1ZSNA 1NXOA 1NQ5A 2ECOA 2XLBA 4PVDA 2QUHA 1C7QA 3HLTA 1W5TA 3IUJA 3LT5A 3STYA 4IUYA 2WMNB 4ARCA 1TAUA 2XH8A 3GPBA 1U2GC 2OFXA 4I4TA 3ER8A 3ZBTA 1E4EB 2I4RA 2ZPAA 3LWDA 2Q27A 3VYVA 1OV4A 1TK3A 5BSRA 2LKCA 5JD6A 1ST3A 2LVBA 1D04A 2NZ8A 1I1OA 1SG0A 2NADA 1ECLA 1XNHA 4R3NA 3DDWA 3RJZA 2VK8A 4CMEA 5EKXA 4D4IA 3FTCA 1RYEA 1PGNA 4OOEA 3VR2D 1S2OA 2FR0A 4O8ZA 1IEXA 4D97A 4X1KB 1Y8CA 2QVCA 3CJTA 4ZC1A 3KYCA 1ZUD1 2NO1A 2DFPA 1EESA 4PZCA 5KNCD 4BNTA 1TM2A 3J7TA 2I6GA 5JCOC 1KY3A 2VPPA 2YV4A 1W25A 1W76A 2V4MA 4XVHA 4C7MA 1V71A 3RSOA 4GBED 3EC2A 4JEHA 1Q7EA 2DFLA 2BBTA 3DLIA 5FTKA 4BNZA 1W34A 1AK9A 2FRDC 4GPZA 2IU4A 3D4OA 1MH9A 4F12A 4YTEA 1JJ7A 3DCNA 1KC1A 3A36A 1ESDA 3VDNB 3EIFA 4H7HA 1QBKC 2WBLC 3H5NA 4MI6A 3TBHA 1JFVA 3KZVA 3NONA 4MWDA 1KKLA 1WXHA 5LYJF 1G20A 3E8MA 5AJXA 3RBAA 3T5TA 4H27A 2IITA 4TN5A 2F2TA 1TAHA 1W35A 2JK0A 3NRJA 4OYLA 1ORHA 4YRDA 3L7OA 5IVIA 1U9YA 1BVRA 4LZLA 1O5IA 1Y5IA 3FCCA 3OCXA 1N92A 3SJAA 3D81A 4NARA 2F3PA 3EQ2A 3CWCA 4ZKDA 1TUEA 9GPBA 1U0JA 3BRCA 1C7FA 2YIJA 3CQ9A 5HF9A 1L5HA 3UWDA 4G3XA 4C0WA 2NZ2A 4CNQA 1KYIA 4DSZA 1C29B 3WRWA 1K8YB 3R1IA 3AYXB 4PN7A 4YRKA 1PG0A 1SUAA 4L9SA 1UXIA 3EYWA 4R2WA 2ZBVA 3KVOA 2BOVA 3AJAA 4YRFA 4NPAA 3IIJA 1RZVA 4WCDA 4H1UA 4X8HA 2JGMA 1GCGA 1TQ6A 4BFUA 5EUCA 3G8CA 3AV3A 3HLKA 4FBGA 4Q9KA 4ZOLF 1ILWA 1JSRA 1QF9A 1KYXA 2DFNA 3F67A 3H05A 1JWLA 1I2ZA 1KMMA 3AJEA 1E5XA 3PQ7A 2ACVA 4YIHA 4C1NA 5HZKA 1EFRD 4QOIA 1TEVA 3F4BA 5H9WA 3TMKA 4MS1B 2VK2A 4WFKA 3VVLA 4MEJA 4AJJA 5HBRA 2Z6VA 3GEBA 1KU0A 4B2YA 1CR0A 3M49A 3EX7C 3OWHA 5AUNB 1N1GA 2ZZQA 4OLJA 1UP6A 1MLDA 2WWFA 2E4VA 1DUVG 1PCXA 3CR8A 1AF4A 1OPRA 2CLOB 2V1XA 4FDMA 5BUZA 4B4DA 5JTTA 1Z2DA 3VJMA 4B75A 1M6EX 2JIZD 4G56A 1GZ7A 2G25A 3PSHA 4Q3DA 3KOOA 4TXNA 3W4KA 4ZMRA 4CKZA 1PJCA 2IYXA 3E05A 1G4HA 2GJ8A 5FFNA 4QPZA 5ECGC 1L4NA 3AF5A 3VNAA 4MWTA 4F2GA 1CZRA 1BN7A 3I9NA 3IDOA 4RFSB 1JRLA 2PWPA 2VHWA 3QXHA 1WKVA 5EQJB 1QHFA 4LDPA 4QU5A 3WGYA 3DBHA 4K9MA 4RADA 1YL5A 3UJPA 4RANA 2O4UX 1L8OA 2GBLC 4DMMA 3LSYA 3TRDA 1NN1A 4LXUA 4DW8A 2WUGA 2JLYA 1DWQA 4O2RA 3JQGB 4DMUB 1DFIA 3H94A 4IJWA 4ZCLA 3HUTA 1UPAA 3NAMA 3Q9SA 4A10A 4O6VA 5CFQA 3R3ZA 1PX0A 3O8RA 2QN9A 3GUYA 3MTEA 4XPZA 2BUBA 4UMVA 1PFYA 3ROFA 3DMFA 5C5IA 4P6YA 5K2OA 3EZ7A 4IVQA 1OAOC 2B0CA 4BTVA 2X7HA 4BO0A 3JYOA 3R41A 3PI6A 4R98A 1OCEA 2JLVA 2DX7A 3R8CA 5A71A 1QH1A 1ZW6A 4BVHA 2O2XA 1P5JA 3E82A 3BORA 3EZ9A 3GJ4A 3ML1A 4LJLA 2ZT8A 4QUBA 2HQOA 2BAGA 3IAHA 4YN3A 3VZPA 1SOVA 2IH2A 5B5SA 3A26A 4OYRA 4CVNA 2G0NA 3CUKA 2Y67A 5KW9A 3OFVA 4Y1FA 1VJCA 2F17A 2H2FA 3E7WA 4K6HA 3AX6A 1WXFA 2YVKA 4CDRA 5B3LA 1FC0A 2A88A 4BTLA 2X0KA 1JI3A 2BBWA 5C8YF 3D3JA 4Z4WA 1IZ8A 3CLRC 4HWKA 5E2IA 4OGFA 4NFHA 1T2AA 2P75A 4QHTA 2QN7A 2R8ZA 3HDQA 3L7AA 1VL6A 3WWDA 2ADMA 4TXLA 3AF2A 3QTTA 2I3GA 2ZDGA 1KY2A 1U2DC 3JD0A 1ICIA 3BAZA 3VNUA 3UK1A 1GGMA 4JB0A 3WXMA 5CJ2A 4E0BA 4Q1DA 1EX6A 3FWKA 1A8UA 3K72B 1V3VA 3Q3VA 1U9JA 4CEHA 2ZZMA 4WH0A 4DDKA 2VYFA 5H0IA 3DUFA 3N2NA 3LA8A 5JISA 4XN0A 1HYGA 1V16A 3RJ9A 1MC8A 3OTHA 1BAPA 2CBGA 2Q6TA 1LPPA 3OG9A 4C2TA 1J9GA 5FOVA 3GLKA 3HJGA 5T8KA 3WZ2A 4JBGA 4CMAA 3I9OA 1QHYA 3B2QA 3H1FA 4CU2A 2WSMA 4EB3A 3VHLB 3N5CA 4WIAA 4YX9A 5ICGA 3AIOA 1QO0A 2POQX 4CLOB 2Z5GA 3CUVA 2P27A 4IJ5A 4O5OA 4BO4A 3PQ5A 2EFJA 2Y4OA 3G8DA 5I7SA 5B3JA 3RUCA 3CP8A 1MAVA 3EXG1 4KI7A 4GM1A 2NO6A 3UWOA 2FPSA 2IXTA 1GLNA 2PSJA 3CRVA 5JDCC 2ISQA 4S35A 2FG5A 3O1HB 2OD9A 4ON9A 5ALKA 1EVJA 3PENA 4HBZA 3MRSA 1BXGA 1G59A 3GFVA 4Z1MD 3IP3A 1NFRA 1TCVA 1TEHA 1H85A 5AHXA 1B16A 1JUDA 4F93B 5TPZD 3QUCA 5CPBA 3A4MA 1CEEA 4MPTA 1VIDA 2GZMA 2ZRKA 1A98A 3DZCA 4R2LA 3QFTA 4MYDA 1W0KD 1EVIA 4M2LA 1G9TA 4X63A 4F2PA 2ON6A 2RD2A 2VTDA 3AO0B 5TDHA 4C4RA 4ZJPA 4YYEA 1JIVA 3M8KA 1A7KA 1LV7A 1JXAA 6ABPA 5DI9A 3ZLJA 2JCVA 3R0XA 4HUQB 3HYNA 1NP7A 1P31A 4Q7JB 4TKOB 4MB0A 3G0BA 1RYYA 1QJCA 1MO5A 3ORYA 3PPYA 1U0LA 4Q4HA 3TJMA 2JGDA 3LBIA 3QZUA 4PLVA 5T4FA 5A2QA 4JL5A 4RMNA 5HOQA 1L7AA 4EA6A 5BW6B 5A5DA 1UMKA 4LZZA 1L4LA 1TCUA 1BH6A 2Y1KA 5E4YA 2WUEA 5I51A 2YC2C 3CW2A 3CRZA 3I6ZA 3KQUA 3NDJA 1T1GA 2HT6A 4XYEA 4D57A 1G8MA 2WKRA 2XOXA 5LU8A 3S1SA 3MHPA 2CEAA 1I30A 3TEMA 4G5GA 4MLDA 1JW9B 1OBOA 1P3Y1 1RMTA 3W7VA 3C74A 4TXMA 3WWOA 5C51B 1VBFA 1TPZA 3U62A 4UHJA 6GPBA 3ICWA 5HQJA 2RKOA 5LMCA 2BKEA 4S3MA 3PUWA 3W2TA 4BJ5A 2NVWA 2DETA 5KDLA 4X7FA 4ZV7A 2A5GA 4QEZA 5BORA 3MSCA 4DPKA 2H1OA 1ZD3A 3G13A 1QQTA 1ZJYA 1ZRNA 4H4CA 4LMPA 4BFYA 4HGYA 1WDWB 4CTOA 4H0NA 4IGKA 1FNCA 1QRTA 1N1DA 3JW8A 3VO9A 3G9TA 3ND9A 4FCVA 3DVSX 2VLIA 3PQ2A 5AI5A 1YQXA 2OXRA 3K9GA 3KHKA 4HVTA 3R7SA 4Y1RA 2C2KA 2QD5A 3ENKA 3DAFA 2XZOA 1M2HA 1V3UA 1T9GS 2D7CA 1N25A 2ERXA 3TWOA 3WRXA 4JJ4A 1EP3B 2C29D 4LXXA 4F8JA 1NJ5A 2SKEA 1CYEA 1OYYA 2I7CA 4HNAA 3PA2A 1E5TA 1JQBA 3EXEB 2JKZA 3HUEA 3KL2A 3WTBA 3K9WA 1TECE 3DBLA 4Y2RA 3Q3GE 3EHEA 4EVIA 3ZGZA 3LUDA 2R84A 2W6JD 1PHRA 3NOOA 3LLUA 4V39A 3PXGA 4OBXA 3NWBA 1G2OA 3UGKA 5JPDA 1T0BA 4XIFA 1GTMA 1G5FA 2JRCA 3QLUA 4I1RA 3F8SA 3ESCA 1JXOA 4MRAA 3SY8A 4TSKA 1D4ZA 2F3TA 4H7FA 4JLVA 4EW3A 1XDZA 4OOXA 4NH4A 3S2UA 1ZC3A 4MCAA 4M9SA 3QLVA 4MS3B 4HV4A 1KEPA 3FXAA 5HP4A 1IXRC 2FWIA 2GCGA 3BJZA 4PSUA 1L5KA 1SHZA 3ZDRA 1TK2A 1DC3A 1DQRA 1ZRSA 2I2DA 4LBYA 4REMA 4JD5A 3K16A 2OZLA 4JC8A 3RVSA 5GINE 1RHKA 1Y89A 4C21A 1NVGA 4KIUA 1DE0A 5LQMA 1PG5A 3VU0A 2HL6A 5JATA 1NQVA 3PJFA 2I87A 1U4NA 3ZLBA 3MGAA 4Y9TA 1YZ3A 3CYFA 4LE0A 5EE0A 4CTJA 4EUFA 5BQXA 5KVSA 2DYKA 5IC4A 1A95A 1D4FA 3V8PA 1ZKDA 1N0IA 2FEWB 3C70A 2BFDB 2YJ5A 3U9LA 1ATZA 1HDIA 3QBJA 1VKJA 4L72A 2WMYA 3GN1A 3CCFA 1C30A 1UK7A 4L1KA 5J5VA 5C31A 4UEOA 2LD4A 3ZE0B 2HXYA 4ZEMA 1S1CA 3TOZA 5CPFA 3BWEA 3VPCA 4Z0PA 1SBQA 3AF1A 1UMDA 3EH2A 4P2NA 3CNHA 2Q2OA 1H1DA 4Z4EA 5B58T 1TIPA 3L8CA 1IMOA 4J2OA 4ZAVA 4V0ME 1Z2AA 3VGJA 2YHIA 2CBZA 2R25B 1RP7A 1T9KA 4Y6PA 1YMUA 5JQGF 2P6UA 4GOND 4QBKA 3HFGA 1OFUX 1H1LA 5A62A 4CLDA 2YNMD 1Z2EA 3BGOS 4XQCA 4DLNA 5L3VA 3NG1A 5B57C 1MVNA 2RB5A 3IX7A 1PQUA 3FTNA 3AYZB 3RG2A 4AKGA 2A78A 4NIMA 3A6FA 1PF7E 3WLNA 5EWJB 4DXDA 4BB5A 3PC8C 3T38A 4FDVA 4KAJA 2D0IA 5JAMA 1U2QA 2JBWA 4WKOA 4GKVA 2R5FA 1NW7A 3U4HA 1RP1A 1L4EA 2FA9A 4QYIB 3CVOA 3DAGA 4B7AA 3ENWA 3GLQA 4K8RB 2F3RA 2D54A 2X5OA 4M0FA 3TUZC 1XEAA 3NTVA 4JCCA 4JKIA 3TLXA 3UMRA 1L5NA 3V4OA 4TMXA 1QFYA 4YP5A 2HRDA 2W0MA 1I6LA 3INNA 4IVNA 3IHTA 4I3GA 3WHKA 1CJMA 2JJ1D 4OREX 4QNNA 4LI0A 2G83A 3A6HA 1PIWA 4LJ9A 2EW2A 3CPSA 1QLJA 2RK3A 3EW7A 3EOZA 1TTTA 3G5UA 2PRZA 3SCZA 3SKYA 4UTRA 3JZDA 1G3RA 3ABQB 5GV8A 1ORDA 1TD1A 1B93A 1VFNA 1ZOSA 3PWTA 2ZJ5A 3LPLA 4QYTA 1KP2A 4YWHA 3WYCA 4B8YA 4L9RA 2VHEA 5JVDA 1LRLA 4LOHA 3SEAA 3ZUPA 1NYQA 3WRVA 3AVYA 4Y2TA 3TD9A 4E70A 3OLVA 5FWYA 4FYMA 1PZEA 1POXA 3IKLA 4YIKA 1JQJC 4X8MA 3ZHYA 3T56B 4RA6A 4LNUA 1O97D 1PNQA 2OVFA 1UKCA 4FILA 2DECA 1YJ5A 4DRYA 4AQYB 2PLWA 4Q3LA 1GKKA 4XE5A 4JMLA 4AMYA 3HJHA 2QZ9A 2P3LA 3U3RA 1HO3A 4N8SA 4YPFA 3RVPA 4YMWA 4N49A 1U1CA 1M7BA 2XDWA 1ADYA 1DIHA 1G20E 3BTOA 3FFBA 1VPEA 4KWHA 3CZAA 3AJDA 4PLTA 2Q2VA 2JLUA 3G0HA 1NXTA 2IT1A 4J0KA 4A2QA 3UH1A 4JITA 1N2IA 4BNWA 4FEEA 4YI5A 5J35A 3ZU6A 1NLYA 1H94A 1YIAA 2QENA 3IPCA 4RPLA 1N5LA 3FZYA 4JUBA 5DBIA 1QONA 5EI5A 4DA6A 1UJ2A 4P1ZA 5A9SA 1DCKA 5FO0A 3ILYA 3KTOA 4A8PA 4O02B 1BA3A 4J7AA 4I9GA 3E20A 1RKUA 4D9JA 1KE1A 3C6YA 3X1JA 1QRAA 1RYFA 4B9EA 2EIXA 1JMKC 4CIAA 3LS2A 3GFSA 4JI0B 3KXKA 4P7FA 4JSRA 4KHPB 1QUEA 3DO8A 4JZYA 1XL0A 3ONVA 3TW0A 1QYIA 2PUWA 3LDAA 2IE8A 5E7IA 2H5IA 3L43A 4C0AC 1V8DA 3L8ZA 4NV3A 2CFRA 1T15A 3C48A 1U7XA 1QMGA 2ZM5A 1RWOA 3W5VA 4JA0A 3HKBA 5L4LA 1TA0A 5EG5A 5EE9A 1SCBA 1L9XA 1VM6A 1Z37A 3O3MB 3BPSA 1T8PA 1YOBA 2JJ2D 2P2LA 3PGXA 2ZYVX 2FR8A 5ALIA 4DIEA 2GJKA 1EGMB 4BMCA 1Y4AE 4HXEB 1DZIA 2JCXA 2OP1A 4QT0A 5L7TA 1Y98A 3UHOA 2I6QA 4A8JB 3AFNA 3RYIB 4B3DA 4DC9A 2IHJA 2DY0A 3BK7A 3ZWPA 2GESA 2ZVDA 3GJSA 4N5MA 1FDVA 4Q24A 5FDFA 3KJXA 4JI4B 1YI8A 3LUBA 4KLRA 5K0NA 4U2DA 1YB6A 3PU6A 3JWIA 1A82A 3QW4B 4MWSA 1R8QA 4GD3Q 4BQSA 5B7GA 4GO1A 4C7JA 3A7DA 2OUKA 3IUBA 3NVMB 4AI6A 4K3VA 4ZU1X 1H23A 3PUVA 4XJXA 3SMVA 1OFGA 4O33A 1JECA 3DV0B 4L15A 2QVXX 2YYZA 4H1TA 3N87A 3R5SA 1WMAA 2DPYA 3WWPA 3HN2A 1NMEA 4LS3A 4WBNF 4ZYYA 1FJXA 4ZOBA 4DKXA 1ZVQA 4JB3A 1YFLA 3VSBA 4IS3A 1SH7A 4G07A 1N77A 4A91A 1ICEA 4ECEA 2G7ZA 5E4JA 2G72A 4JCOA 5IT4A 3S29A 1CQIB 2BJWA 2GZRA 3TNYA 2DQSA 3RTCA 3EEYA 1C0LA 1OI3A 2WDZA 3VOTA 2CV1A 1HETA 3BXFA 4PZAA 2QWXA 2CYCA 1EGQA 4XLZA 4F06A 2VZLA 1E2PA 1EK1A 4ID9A 4P0TA 3JQCA 4GMKA 5JD4A 2D2IA 3AR5A 4EPXA 4J4HA 2BPOA 1H8ED 1JLMA 2C82A 2WU3A 3A1CA 1C3OA 4J9UE 4KZPA 4HPXB 5KDOA 1XNQB 4ETWA 4Y1EA 2X4LA 3A8TA 5COAA 3N2GB 5EHQA 5EZ5A 4RLQA 5FFMA 2XRFA 4BC0A 3BMQA 2B30A 4LUCA 5KQMA 3A6DA 2WWRA 2QL9A 3HR8A 2IODA 1ZO8A 2YR0A 1U2PA 2AKAB 4DMFA 4B1FA 4M1EA 2J0SA 2NZUG 4EX7A 3SEFA 2ZUFA 4BTEA 1IUPA 1Z39A 1UDWA 3W8FA 3WAJA 1Q0UA 4YUYA 2FSUA 1F7UA 3AFMA 4HRXA 2H9AA 1L4GA 2F7SA 4DLAA 1Z3IX 1Q0RA 3P52A 4DADA 1WF6A 3KQYA 4W8HA 1EAYA 2YTZA 1AY0A 2CUTA 2H1LA 1SPXA 4X0EA 3M3DA 5K4GA 1UQRA 2Q0HA 3U4DA 3FCEA 4PLCA 4C5AA 2Y71A 3LYHA 4L08A 1EFLA 3CG4A 3R6KA 2OWDA 1KZ4A 1YZVA 5BO5A 5K8VA 2I54A 3PX2A 4RMHA 4EUSA 5SY6A 2YQ4A 1T6ZA 1FDWA 2YVAA 3EQ9A 2TYSB 3HSSA 5LP6B 4DXAA 4Q4CA 1C8KA 1U2TA 1JFFB 4JELA 2J1LA 2OEPA 4BUJA 3W5HA 1Z74A 4N4AA 3L41A 4IV8A 1ZH2A 4JT8A 4U7JA 1YLOA 1JMYA 1GPAA 4I4IA 5TGZA 2H1SA 5DN9A 3IAS1 4BZPA 2QJRA 1ZR2A 2O7RA 4M7RA 4QX6A 3MLBA 2Q6IA 1SQ5A 2AI2A 1BMFD 4IFBA 3IT1A 5E6RA 1JB1A 3AB7A 1NIPA 1IG0A 1QH9A 3OO0A 4HGOA 4IO1A 5BV1A 3QX3A 4W5NA 1Y63A 2EZTA 1SB9A 1JDPA 4R1PA 2Q46A 1PVOA 1RAIA 3U16A 2JFXA 1CLUA 4MS4A 4GQNA 4Y0VA 5L45A 1CUHA 2RC6A 1VQLB 1YGPA 5F5XA 5IM4A 1A1SA 3ENNA 3OAAA 3JCZA 4IIDA 1Z5WA 4QV2A 3BZWA 4J75A 2A5JA 1ZM2A 3CFYA 3HPQA 1GZ6A 3V8VA 2QMUA 2ZYTX 3ILSA 3CRNA 3TOCA 4P25A 1PQWA 2ZI3A 1W1UA 4HL6A 1E6CA 4CM9D 3V4RA 3DNMA 2VPZA 4QLAA 5FUWA 1LK7A 1N6HA 2RK6A 3FKSA 4TTIA 3AEZA 4ZVMA 1C9MA 4G0YA 1Q1BA 1ZVKA 3DTVA 4LMBA 3DO5A 1R64A 4MVJP 4OU5A 3VPAA 4DV0B 4LVUA 3TLYA 4PYOA 1VRCA 3L6OO 1MVLA 2BDTA 4HMQA 4A0HA 1QU2A 5LQAA 5DCUA 4J76A 4E94A 4F2HA 3H2YA 1MPTA 1AU9A 1OH8A 2X22A 3TZQA 1E1RA 3EWAA 1M2VA 3GNSA 2J08A 3HC7A 2AFRA 4J4BA 5HDQA 3W3AD 2CLDX 2RHJA 2HRBA 3MWKA 5ICSA 1Y1PA 1HQKA 1OVGA 4KO4S 4OPSA 5JAPA 4D9HA 2Q1TA 5AESA 4XA8A 2ZWVA 3PA1A 4EHNA 1Y1TA 1HT1E 2PU5A 1NXQA 4HEA1 1WZEA 4U3JB 3ZIDA 2W9XA 3NB0A 3SS9X 4BJ6A 1EK0A 2QVBA 4B6SA 4CWAA 2OO5A 1SWWA 3MYYA 4HH4A 4KQEA 3Q11A 3TM4A 2H63A 2VNKA 3JZIA 4L0DA 4EI2A 6PFKA 2VT7A 1XD2A 3AUTA 1RAEA 3NKLA 3PJEA 1AUVA 4XQGA 3RU2A 5B12A 2A1IA 4UEQA 2WWWA 3OZRA 4N0MA 4BX3A 2FJUA 2GM3A 2Y66A 3O21A 4MVJH 2XR1A 3IOEA 4GC9A 2K7FA 3CCSB 2YWFA 3EIOA 1J8YF 3AUFA 2OBFA 3OT1B 4F3CA 4C2UA 2Q45A 3HI4A 3X1XA 5C2JB 2MJLA 1WXXA 5I7EA 4DCGA 1WUKS 3OY2A 1O54A 1SCUB 2YWHA 1LF0A 3TECE 4KKXB 2AMLA 3FGPA 3DYVA 4QDTA 3A2KA 2IZ6A 4JP3A 3CNNA 1BJRE 4UMFA 5B2ZA 1U0OC 1DLIA 1DPGA 4BVLA 3GHYA 3T3PB 2OZPA 1Q2XA 3FYUA 4W82A 5DK6A 3HO1A 5BN3B 1XSEA 1RPZA 1KI4A 2CHEA 1UP7A 4BX0A 3DB1A 1A9XB 4BV3A 3LHKA 2VI5A 3OIUA 3Q8LA 3F6BX 1DAHA 2FUCA 3V1KA 4BQPA 3F0TA 2NU8A 4B3JA 3HHEA 1X42A 3ZXSA 5JXJA 3HUFA 3UAYA 2GCNA 4BCCA 2WJHA 2IHNA 1O2DA 6LDHA 1KOGA 1XAJA 3C6XA 4BRWA 1LBHA 3NIDB 2QX6A 3OKFA 1DBPA 1CZUA 1O0CA 2GDJA 3SF8A 2BF4A 3D6VA 4D79A 4QDZA 1OC4A 2VDVE 3QF7A 1TAQA 1XCMA 2ZSHA 4M9XA 5JAHA 3KUDA 2FSSA 4Z9FA 1KGSA 2VDKB 3MUEA 4BEBA 1W48A 2A57A 2QPLA 3C3PA 1YFKA 4LRSB 1V5IA 2PHZA 4X97A 2OHFA 1F14A 2D2EA 5GTDA 1XEFA 4XYLA 3MTBA 4YP9A 2ZYIA 5SYMA 4FLEA 3E35A 3UUWA 1F4VA 3F6EX 4BMVA 3TAXA 4X9XA 4KVGA 4WX2B 3VH1A 4W1RA 4C05A 1KVUA 3KWFA 2XE4A 5KPDA 4EI9A 1X1QA 1A9QA 4M0CA 4R2HA 3D6MA 1V11A 3E0XA 3WYFA 4R7TA 1RWNA 2Z3VA 5ADHA 4XKVA 4KB5A 5I47A 1IWBB 1CIPA 2PT5A 3GEIA 3PEUA 3PUZA 4JLSA 4QULA 2QN2A 3KQVA 3S0JA 4C4SA 1AMUA 1EUCB 1OH6A 1MW8X 1RLIA 4YJFA 1ZK1A 1V1MA 3N0XA 3I1JA 4P31A 2I34A 1CJCA 4FKBA 1QP8A 4BLRA 1TYZA 2HF2A 1OTYA 1QZXA 2OBXA 1NPTO 4ZT2A 4KLCA 1YHNA 2VVTA 2OHIA 2W0SA 3GJTA 2VTKA 3V32A 3ZDAA 2O8BA 5KDDA 4Z4FA 4OQYA 2IBMA 1DTWB 5JADA 4P0QB 2AE1A 2NSJA 1J06A 3A05A 3H2IA 3WS7A 4BWFB 4RACA 1GGVA 4YXWD 1TQ2A 3IDQA 4F85A 2PEYA 1NI4B 1DAKA 5JR3A 2EQ5A 3WTCA 4C0JA 1WB9A 1T29A 4OGGA 1M72A 4OQLA 2H1CA 1TMGE 1YS2X 2ZG6A 1W0CA 4NBKA 2AN4A 2HJHA 3A9WA 4CI0B 5KHLB 1DX6A 1WSDA 4DJFC 4R8SA 1QAOA 3OCZA 2NYAA 1XYVA 5FTJA 3URKA 3GLGB 3KVNA 1IXZA 2H7YA 5DEOA 3FNHA 2ZKIA 3SJCA 4RJTA 4CMCA 4E2WA 4KDEA 3KQHA 1VQ9B 4NPCA 5AXBA 3AUYA 1N5RA 5JSUA 1S3FA 2FSHA 3R2JA 5JBNA 2VQFB 2WF7A 1JZSA 3VJKA 1S2DA 3D2AA 2A0KA 5K0GA 1X92A 4F72A 1MHTA 1L3IA 3LUGA 2HNKA 1EZZA 4C14A 2C31A 1KYQA 1R3DA 4NS1A 1XXHB 5BN4A 1WZCA 2BKVA 1O5OA 3P2JA 3JYQA 4B35A 1VI2A 2SICE 1P4MA 5CDGA 3I5AA 4MV8A 4MITA 4XAQA 4C9BA 1GGJA 1XTIA 2P9TA 3WGMA 4CLEA 3VAAA 4HB4A 2H31A 2TECE 3OW2B 4AO6A 5K0ZA 3ED1A 1MJGA 2EYUA 3CTPA 4OMDA 4AD8A 2YS6A 4JQYA 4FQ7A 5LFAA 1TU0A 1X9GA 1SZPA 3CR7A 4NS4A 1RWWA 1ZCFA 5KI6A 1RXCA 4Q9HA 3RAFC 1DWUA 3LNNA 3FR8A 1NRJB 1NF8A 2RGGA 2C83A 4X71A 5TGDA 3TCNA 3OCJA 4MW5A 2ATIA 5IAEA 3UF0A 4F3YA 2XT0A 3QVSA 1WZ2A 2AJCA 2JH3A 2ZRJA 2J7PA 2JEOA 3HTXA 3WGZA 1ORRA 2D1RA 4JR2A 4NBSA 4IOKA 1X7ZA 4KODA 1NXPA 4RZIA 4WXPA 3Q6NA 2HF8A 3F90A 3F98A 2CRVA 1J8DA 2VDUE 1TIKA 2VH2A 3C3JA 1CQJB 5ALDA 4ESEA 3TVYA 2ZIEA 4MGYR 4MROA 3K9HA 4F46A 2FDCA 3E9RA 1LSUA 5CYOA 4DZTA 5TF4A 3TLKA 2FX5A 1E2FA 1AQLA 1HPLA 4WZLA 1QP0A 4BVFA 4R8VA 1QG2A 2QD3A 4G0PA 2QMOA 1Y8ZA 3CMAB 1ZW1A 1VG1A 2VP3A 4FE7A 5KYUA 2UYOA 5JROA 2PUVA 3I37X 4N9QA 2PFSA 2XGMA 4BDTA 4WZ6A 1XGKA 5I7UA 1MW9X 1IHXA 1YE3A 3F6PA 2PGAA 3E2MA 3NTLA 4JBIA 4JJFA 1YMQA 3WIDA 2OV1A 1EI9A 2OGWA 3C3EA 1ECCA 1LNQA 4KXWA 3UPUA 3MB5A 5HGXA 3GA7A 3S2EA 2RGNA 2O8VA 5G4KB 4B87A 3U7HB 3H5IA 4XKWA 1TYBE 4KFSA 1ZOIA 4ZVPA 5IYZB 2WDPA 3CUEF 5LDHA 4HAVA 4EITA 1YS4A 1Q1NA 2ZTSA 3JD3A 3UC9A 3KALA 1BDMA 1Y5NA 4RHTA 2FUKA 2ZIZA 4AJLA 2HMSA 3ICQB 1T3LA 2OHJA 1KVSA 3K6SB 1GZUA 4DF3A 4HEJA 3GCWA 1BU5A 1E7RA 2F8LA 4DE5A 2GEKA 4ZT7A 3B60A 5IH7A 2QTTA 4DDTA 2OB2A 3HEBA 1LLFA 4DG5A 1IEQA 4EPRA 3EUFA 4Y2QA 3F3MA 1YVDA 2I71A 2A1UB 3JD2A 4TS4A 4W9RA 3FPAA 3KZMA 4M6WB 2MYUA 3IQGX 3T41A 2H4XA 3ZZUA 2Z95A 4MW0A 4RZUA 4X1YA 1Y3AA 3S7TA 1I2CA 1ZN2A 1ARZA 2R1TA 3A14A 4R69A 3ZHRA 2JI6A 4D4MA 3VI4B 3X1WA 3IVAA 3PPVA 3TSOA 4URVR 1AUPA 4MYSA 5DZSA 4MIEA 3DNPA 1B0ZA 4EFDA 2QZPA 2RBEA 5A9RA 3ADBA 1KMHB 4JHXA 1ANKA 3CNBA 4MTCA 2J4DA 1AHNA 2NU6B 2GOYA 2WFLA 3ZHCA 3VPXA 5IKPA 2R1ZA 1P6XA 3JARB 5TS3A 4IDDA 4NNPA 3VYSB 1NUSA 3DUWA 2BLLA 4FCWA 3ZZMA 2VTVA 4DRXA 1N33B 3PGJA 1P4AA 3UG7A 3OE5A 4MP3A 4TL9A 1A5BB 2I8CA 5FPHA 4BBAA 5FXMA 2QGNA 1VYHA 2JARA 4E5SA 3GRVA 4KQ6A 3DHWC 4FU0A 2AJDA 521PA 4A0SA 2OSBA 4KUGA 5CEEA 3BRQA 4JLPA 1EVYA 1HE2A 2HFJA 4OXIA 4J2TA 1FU8A 2X3YA 2VQEB 1MEOA 1P18A 4Q1CA 3CB2A 2O0HA 4U9IS 2IH4A 4XDZA 4AN4A 1JHVA 3LQ2A 5KTSA 3IJPA 4BBPA 4XFKA 2R00A 1RRVA 5KVVA 3BB3A 5L3RA 2NZVG 3R7WB 3SZGA 2C5EA 3O8OA 1D6JA 1KH2A 2OGZA 4ZICA 1V4VA 5BSTA 3PUNA 1OPXA 1XZAA 3L40A 1E1LA 4ZRDA 2F1OA 3AM1A 1NJFA 2FSFA 3NJ4A 3NVAA 1NR7A 3QVTA 3GBSA 2R6JA 3GJ5A 3ZHSA 2I8LA 4RPIA 2XODA 4KRYA 5BSVA 1GFWA 1O95D 1O0SA 3F9RA 3KSAC 2OUIA 4PLHA 4HWGA 2HMTA 3GZNA 2ADFA 2QLMA 3TIXB 1V7CA 4KGDA 4RC9A 4BJHB 3CCUB 3I6MA 4BZXA 4MK4A 3FNQA 1Y0RA 4I8IA 3WKAA 1T1RA 2IHTA 3UJAA 3EFOA 4IPTA 2XE7A 4B3TB 1D7AA 2VZ8A 1UT8A 4RO0A 3QEBZ 1R4NA 2IW3A 4GOKA 2A0YA 1K4MA 2ODAA 2FP4A 2WYOA 4JXKA 3ZE7A 4JUIA 4R40A 2WRZA 1CVIA 1YJQA 1BGVA 2EF0A 2ZI6A 3QM1A 3VO2A 4IHJA 4UBJA 3TAHA 2YNMC 4ZQFA 3FMVA 4V2UA 4NE2A 5CHEA 5H83A 2JRLA 3R3SA 3WIBA 1IJEA 3IA2A 2PZFA 4BKUA 5IT9A 1E58A 4F97A 1ZDMA 1TT7A 4I4LA 3KYJB 3UOWA 2J30A 2L69A 4U00A 1F17A 4XIGS 2YWRA 3WQRA 1PFGA 3CZ4A 4ZRNA 5G1PA 1UIMA 3U7EB 1LFAA 1PT9A 1JHQA 4DCVA 3NNNA 3ZK7A 1VQ6B 2ACEA 3L6CA 5M7EA 1OBVA 1CUSA 2IIBA 3OZ7A 1JHDA 3T9BA 1JHRA 3KK0A 2B4KA 4WJLA 4YT8A 4DUGA 4A0FA 1HT2E 1PW7A 3ZLUA 1U6JA 4ZI7A 5F64A 5KB3A 4ZYVA 1Q3HA 3C3YA 3GRAA 5EVJA 2XDYA 2ECFA 4EI8A 1NHGA 3FUWA 4EUHA 5AFSA 2NV2B 2XQIA 4WKPA 4ZVOA 4W5HA 3TDMA 3HRIA 3E7PA 4TKUB 2D7DA 4NCKA 4A6XA 1RHQA 3UFXB 3QU7A 4XOTA 1P1HA 3RCBA 1WR8A 2ZOSA 2GT1A 2JD2A 3LC2O 4Q82A 4IVPA 4HNGA 5EIBC 3OI7A 1QVZA 3NBZC 3W9YA 5TEWA 2F8MA 4MW7A 6CHYA 1TPYA 4O59O 2Q2QA 5EHNA 5SICE 3DHNA 5D5PA 1F60A 1O6ZA 1Y8QA 1O97C 2FPKA 3FNFA 3KM0A 3PRHA 5DCYA 5EC8A 3V33A 4M89A 5JC1A 3UUFA 4MQ5A 1QC5B 2DLNA 3ITKA 2YY7A 4DBLC 2DBVO 1DO2A 4KMRA 4CTMA 1W0JD 2WICA 4CIYA 2ZTGA 3O5AA 4GXRA 2CE7A 5D1NA 1IOWA 2C3OA 3VR6D 3C87A 2DFTA 3H2ZA 3AVXA 2HR1A 1NKSA 1NKVA 2EZ4A 1H3NA 5LM3A 4CKCB 1XU7A 1MXHA 2JCBA 5IP5A 4KP7A 5JG7A 4C30A 4F04A 1TVCA 2XQGA 3JQEA 4OLFA 1GTSA 1BDIA 1UBTS 1DC4A 2HK6A 2O3TA 3WGNA 1P2VA 1FNSA 3GT4A 4KWEA 3RVBA 5EXTA 1OLUB 1QIJA 3TVDA 1SD5A 1WUIS 3IAXA 3Q7EA 3VU8A 4LHEA 4DA9A 4DZZA 3SWWA 3T3OA 3G02A 2Q50A 4C08A 2X6RA 3CTMA 4YRMA 2EZ9A 3B2NA 4AG5A 2DPLA 2QR2A 1JG2A 4C04A 3PUMA 1VL8A 4YMTA 1QYCA 1TJ4A 2ZK7A 3CR3C 2FWPA 3TBKA 1ZU5A 4OU4A 1Q83A 5FKJA 4P98A 3NGMA 3EGIA 3F46A 4LMRA 4BLUA 4KVFA 1D4AA 1DG1G 1B8OA 1N2CA 1OYVA 1T2DA 4US0R 4PGMA 2YRXA 5E6UA 2Y1DA 3FIUA 3MAGA 3AUAA 5HKLA 2N1BA 4M53A 1N8KA 2XUOA 4IWYA 4LGCA 3ZV4A 4G8JA 4CKXA 2HMWA 4UNQA 4PTLA 3IEKA 2ZS7A 1DBIA 4Q7EA 3HV2A 4DWOA 1KXJA 4KOAA 4M1QA 4RHUA 1T9ZA 1F0KA 5SY4A 4EKIA 1ID8A 3KUUA 2CJFA 1BMQA 1CUFA 4FDAA 4G7XA 4KE7A 3H6HA 3NXKA 3TTSA 4EKNB 1ZOLA 1NZJA 3GRCA 2QRMA 4LDAA 1N6RA 3C5VA 3MZ0A 1WBDA 2OYCA 3PQCA 1KVTA 4AJEA 1L3BA 3ZHVA 4B48A 1U2GA 3NM5A 2B7CA 3CF4A 3H2KA 3VR3A 2GBGA 3ZS8A 4MP6A 4MV9A 4TX1A 3N0VA 4OFWA 2JGKA 3G49A 3OMWA 5K0TA 1M6YA 1SC6A 3VPDA 3ASTA 1NBHA 1PT5A 1ST2A 3CPEA 3F71A 1KI9A 4EMUA 3IXMA 2KM1A 3ASSA 4P3YA 1FX0B 2VDWA 3JQ9C 1JIXA 4L07A 2O5EA 2D5AA 5F4OA 5K1ZA 1ZSYA 6REQA 2F4NA 1WV0A 1F8XA 4MVJE 2FK7A 1IPEA 1KXZA 4LC0A 5EIOA 5JCOA 3H19A 4DJ5X 4W7IA 4RXTA 4O08A 3WGLA 1P1BA 1VQ5B 2YVUA 3DAYA 4ND7A 4TMTA 4ALLA 4MV6A 4L0CA 2FRDA 5KWVA 1Q86D 3VZDA 4FHGA 4DUPA 2H06A 2C9ZA 3NC1C 2DIEA 2G7MC 2V6GA 5H7XA 1TTPB 3L04A 3RKUA 2WSSA 3HBJA 1E3TA 1OFHA 2DWUA 4AZVA 4OFZA 3QOXA 4DV2B 1HEIA 3OICA 3KIPA 4PS0A 4C07A 4AO8A 2H2GA 2R96A 3B2EA 1IVSA 3NYWA 3W5BA 4EMSA 2AW3A 1RPNA 2BEKA 1T0JB 4KL8S 1KZYC 5FORA 1YQDA 4DMHA 3B6KA 3GYBA 1Z7BA 3DDZX 3WO1A 4N3NA 1CE8A 2JZOA 3R76A 1SBTA 2FUG6 3BGSA 3ZHTA 3JRNA 4Q6BA 3AKDA 1S89A 4KFUA 1XTQA 2HMAA 2X5NA 5J2TF 2P30A 4QXMA 4DB2A 3V5NA 3E3AA 1GD1O 2IA5A 3UKOA 1W5BA 3VISA 3TVTA 3JU4A 1V6CA 2C2ZA 4BO3A 1E0AA 4QOHA 3MIIA 2Y8EA 2PKWA 4N18A 4DK1A 4YFVA 1FDRA 3TZKA 3V9PA 1AA6A 5BQ3A 4UU0A 5FV4A 4N6NA 1RBZA 5GONF 1FYXA 2HZBA 1OI7A 4BGEA 2FW1A 2Q4EA 1J0DA 2FMUA 2FB9A 2WTMA 4FHFA 5HG0A 5C8YB 1JFRA 2I29A 1NL3A 3S44A 2JIOA 4GPTA 5KINB 2PSFA 2RGDA 2V6BA 1PDVA 1JDTA 5CDHA 2VPWA 3TLEA 4ERNA 3AF6A 3I01A 8ABPA 5B36A 1NBIA 3I58A 4JH0A 2B8TA 1E20A 3S40A 5LYYA 3BXHA 4C0XA 4NAHA 4HTFB 1U04A 1U7HA 1USVA 1YHZA 2GZ3A 3PYMA 5FNVA 4BKPA 3PT5A 3ETLA 3V1MA 2JS7A 4CTKA 4OXNA 1DKRA 4TS9A 2CNWD 3RANA 1GFSA 3CURA 4R9RA 2RHRA 4MQEA 1DELA 3U40A 5KOHA 4A8JC 5LXTF 3A3NA 2CLLB 2GVDC 2KBFA 4RVCA 4AVYA 2G4LA 2PKQO 4YONB 2N47A 4B8WA 1YOVA 3RUIA 4ENPA 4N76A 2PXAA 1G0OA 2QRVA 4KLAA 4N5IX 3ZCXA 3THWB 4U02A 4RETA 5DIZA 1A9YA 4MHSA 3IGFA 1AGPA 2XUAA 3LY7A 4U8GA 2XMSA 4RK6A 5CA0B 3V46A 4IDCA 1KIAA 5FOTA 2O8EA 2XT6A 3TE6A 2CNOA 5KQLA 3ONEA 5D7NA 4EMBA 4C0KA 2OFPA 3ENQA 4FYWA 1CUVA 4YROA 1KDRA 3OKCA 2G9ZA 3GUZA 2W2MA 4QUEA 5AKXA 5E7MA 2C2XA 1MABA 4N82A 4Q6WA 3T7TA 4PO8A 1JE1A 5K3SA 1YBMA 5CT9A 1E79A 4Z51A 4BXOB 2B6HA 4NTZA 3D0KA 1TM1E 3VC2A 1YJ9B 3K2QA 3QX7A 4I50B 1SBIA 2DEUA 1I5RA 3TTTA 1XA0A 5FNZA 1H5NA 1RI5A 8ADHA 5KYWB 2CUZA 3KTDA 5C81A 1EUQA 5JAIA 1J9ZA 2I2FA 3I0NA 1D8TA 3MRVA 3RABA 3VFDA 1A7UA 1KI7A 2EBUA 2BY4A 2YMLA 1W4RA 4MARA 5IANA 3I8SA 2AXNA 2GKOA 2JAXA 3TH5A 2H4ZA 4CQMB 5EJ5A 5K8CA 2Y2VA 1TVKB 3WB0A 4L0MA 5ALXA 2ODNA 1OAOA 1X7WB 2Q1UA 2RJ3A 4ECAA 5GADl 4YA6A 1QHHA 5JSYA 3WYEA 1I7NA 1T36A 4KDCA 2ZUEA 2GYVA 4YGXB 1TI7A 1VRWA 3RYFA 3JVDA 3HKEA 2IC5A 4P4SB 2HNBA 2O8FA 2POCA 1E98A 1O57A 1U3FA 4TLLB 1L9KA 3TQOA 1CR4A 1XRNA 2Z5LA 3F7MA 4LZNA 4NMHA 4CM8B 5TRDA 3WNCA 1G5QA 1XV5A 1ZP6A 5H70A 5JS2A 3RUPA 5HYVA 4QM7A 1SNYA 3L0ZA 2ILVA 3OE1A 1RXUA 1IG3A 1VI5A 4OK5A 3VR5D 1NPDA 1DQPA 1JHMA 1UBFA 3A58B 3K6JA 3VNVA 4IP0A 3MBKA 3PNMA 5KQGA 1RI4A 3VTFA 3KCNA 4EO4A 1C1HA 4E03A 4X8LA 5A5GA 3GCXA 1P1FA 1U11A 4E6EA 5JCJA 2O2SA 4H18A 1D2GA 1B0PA 3PIIA 4IHAA 4F1WA 1P1KA 2I9PA 4R0MA 1BYIA 1O03A 2Q3JA 1QHSA 2ZI5A 2VNIA 1VHEA 1HY3A 2IVZA 2QM7A 2XVXA 4BPRA 1VE3A 3GMSA 4PYRA 1HNNA 3F4LA 1DDOA 4HR7A 2X7XA 1UFKA 4F5ZA 2PUEA 3K9BA 4JI2B 1J0BA 2X77A 3NR2A 4QARA 4RD1A 1GV1A 1JQAA 1ECFA 1U2DA 2XYHA 3B12A 3HB7A 5LP6C 4P08A 5AW3A 2DUUA 3B9BA 3FWNA 5H1YA 3LKBA 4J7XA 5IJXA 2F8SA 4ROSA 1V39A 4QHYA 3GFFA 1WZUA 2ZEJA 3MBIA 4GX0A 5JALA 3WLQA 1EFAA 3ETNA 2JHAA 2R751 3DFKA 3DP7A 2EWWA 2EAUA 4TVOA 3P2IA 1ISIA 4KN5A 1PK9A 4HRAA 4JB2A 2IJGX 4ND8B 4LJ7A 1R8XA 3ZDQA 4UAVA 1BDBA 1P2GA 3PNOA 5HIKA 2KB0A 2PKCA 4RVOA 3G4SB 2M9MA 1MMFB 3D26A 2HV9A 4UBMA 5D51S 1FF9A 1LDGA 3G3EA 2IHVA 3D0RA 4KJXA 4KO2S 4URZR 1KR5A 1FFEA 2ZWMA 4G1MB 4PU0A 3D8HA 4D9IA 2J32A 1PU2A 4MEAA 4P3KA 1G8KA 1RRPA 1XKTA 2BEWB 1X1DA 1KS9A 2LZ0A 3DLPX 3FMFA 5FI3A 4CMKA 4U6SA 1SELA 1IEVA 2GAJA 2JLWA 3NIWA 2NX2A 1EAMA 1WXEA 4GX5A 4O2BA 4EEXA 4N01A 4LF9B 5JDCA 2IHZA 1Z68A 1O96B 2ID7A 4ES6A 2AOXA 2P7IA 3CCMB 5DHPA 3CMCO 1M6VB 3I34X 5C7LO 3SVZA 5BV7A 4OM8A 2YH2A 2WPDA 1Z82A 3EMDA 1MJ5A 1WETA 2QYTA 1FP4A 2IY9A 1CZKA 1R0RE 3KSUA 1U2ZA 3PKIA 3RGWS 2WZQA 9LDTA 5K20A 2R1VB 1SN7A 4BNIA 4RA9B 5ICFA 2I91A 3GCDA 5AKLA 2VA8A 3BWBA 4CQMD 4CGYA 4ZEVA 1T0UA 1ZGBA 3LV8A 3ODPA 1FTNA 4KXFB 3MA0A 4FHZA 5JYBA 1XMVA 3ZW8A 5U9CA 4Y9RA 2B34A 3A4NA 4IGFA 4CTNA 4E88A 5DLQC 3WLRA 3TGLA 2QTNA 4D4GA 1PE0A 1VG0B 2ZR7A 1F7VA 4RE6A 5BW5A 2WAMA 3GP8A 3QE9Y 3ASUA 4QPCA 1E1QD 2OQIA 4P5PA 3P7MA 3SHTA 3R7DA 2IZ1A 1NJID 1RVDA 1VFPA 2YFQA 4OHZA 4YVFA 1ULZA 3HXPA 4KO3S 1N08A 3C24A 2YJ3A 4QRIA 1P33A 4PSCA 2ZJ7A 2EFDB 3NWEA 1S4QA 1OI2A 1R3UA 5B3KA 4KAAA 3VMMA 3KJIA 2HLPA 3GT3A 3R6WA 5DU2A 3ORRA 3E53A 4ZGWA 1BHQ1 2OBRA 1H2BA 2BEVA 1WW8A 2I3BA 4DR4B 2GNPA 1JVBA 4AUEA 1K8AD 3DHYA 3DMPA 5AOAA 1XDUA 5IC6A 3V48A 3OPYA 1Q50A 2V45A 4M1KA 2RGYA 5JS6A 3KLMX 5KAPA 1OWPA 2DHCA 2OY0A 2YZMA 3CUSA 2GK3A 2IIVA 2YFHA 4K6MA 2WVJA 1HM5A 3DBVO 3M7IA 5K05A 1LNZA 3V8NA 3ZVNA 4EUNA 3QXCA 2XD9A 1XELA 4AZ3B 1X8LA 3UFBA 1Z4PX 1B15A 4L5JA 4LN1A 4BGUA 2V5VA 1ETHA 1N8TA 4F9TA 1JILA 1E63A 4KHZA 4CMIA 3C8DA 3D8NA 3F9IA 4ZN6A 2YMQA 5BN5A 5JPCA 2ZI4A 4TRNA 3EQ8A 3ZI7A 4MVWA 3KSBC 2BRUC 3WOVA 1N2EA 5CDTA 1E7QA 3FY4A 3G0DA 5F1YA 1XQBA 1T4MA 2AFIA 4HE5A 1T1JA 4IWNA 1PD0A 1PEDA 4Q21A 2R79A 2VO1A 4ND4A 3VZBA 3ELYA 4B32A 3ADDA 1QIHA 3WZMA 4GM4A 4JBHA 1JSZA 1G38A 1WCV1 2O3QA 4IIUA 3OU7A 3J7AC 2K7ZA 1I13A 3V4PB 3KJEA 2Z6AA 4G6ZA 1KZ9A 3D9QX 3Q0TA 4G85A 5FL7A 3BSSA 4NJEB 3K94A 1QTRA 1RCFA 5C52B 2PPLA 5K0LA 2QE6A 2R6CA 1EDZA 1VLVA 2Q9BA 1JT9A 3L1HA 4P8RA 4MX8A 1E0DA 4ZV4A 4C6TA 1WXIA 3KR9A 2OKCA 2ZAIA 5F12A 3KZKA 5BYJA 3RRJA 3V6LA 3DLAA 3BWCA 4MV4A 4EX6A 5HQ3B 3MWFA 2WAXA 3FROA 1V5FA 4CM7A 4RDLA 4LRQA 1VMIA 4JLOA 3IEXA 2H4YA 4HGNA 3CG0A 3DE6X 4PX2A 3S28A 1B1AA 3P94A 4OX9B 1EUDA 1E32A 1U8XX 3V3TA 2EGUA 4PSVA 2YL2A 1VG8A 4RK5A 5EHGA 7MDHA 1YJNB 3H8SA 1Z5PA 2OKGA 1Z8NA 2G17A 1R12A 3G2KA 3N3AC 3ONUA 3LRTA 4MCJA 4AKTA 2ZZKA 4D0GA 1UDAA 1L5GB 1SVKA 3S27A 4AXXA 1P5HA 1TKRA 5A4AA 5HZBA 4NE9A 4ARBA 1MJHA 4MKHA 2HWXA 4BMYA 4W5RA 1G6OA 3UB2A 3WIEA 3D7SA 2ZT7A 4KR0A 3MPOA 2QLTA 2ZWIA 1WX1A 4RKWA 5FPPA 2QRHA 4P3PA 1VLYA 2COKA 3CX8A 3WNQA 4O4HA 3MGKA 3T5DA 1JKJA 1RJGA 5IT5A 1J21A 4X07A 1VLZA 4UUAA 1NXSA 1QKIA 4FW9A 1J56A 2SCUA 3KU4A 4INZA 3T7KA 1NOIA 2EF1A 4UTNA 1ILEA 2QTLA 2HB6A 4WASA 1WU7A 3N75A 4J3JA 4NCJA 3KELA 2Z58A 2NPOA 2H00A 1Z6TA 3MK31 3SJZA 1U7WA 1QMPA 4M3NA 3G88A 4MUBA 4ZIRA 1M0EA 5ELMA 4X20A 2Q4RA 4JI3B 2FZWA 5C1BA 1ZVMA 4TWIA 2PSDA 2HF9A 4INAA 2VCYA 4JV5B 1P2FA 3KVYA 4NDZA 3UEOA 1U3UA 4AYWA 3WKEA 4RQUA 5JH7A 3TAUA 2LCFA 3DFFA 4IMPA 2H4JA 5A3JA 1YS1X 3GQBB 3PC8A 3VSEA 5KNBD 1ZG3A 3C7KA 1YBHA 2JHPA 1MF7A 3TLBA 4KFRA 3KDPA 2QL5A 2VBIA 1DJLA 3OIVA 4D41A 1DJMA 2BBSA 3DT9A 3A4YA 2ES4A 3ON5A 4HX2A 3GEGA 4JQOA 4B3CA 1COWD 1SZDA 2VYND 5FLYA 4O29A 5I9TA 5KOYA 4W6ZA 3KT0A 5HXAA 5KWSA 3G2HA 3M6FA 1M0TA 2QAJA 1ECGA 1Q7GA 3G0IA 3KPVA 1YR3A 3K71B 4MOWA 5F9FA 4Z9BA 3WBFA 4Q05A 5TV2A 3A2LA 2J45A 4JI1B 2O6LA 2PA0A 3HCNA 3ZCQA 1R0LA 2F67A 4BLTA 4WBNB 1NW9B 4CCYB 2YN4A 2GX6A 4AZ0B 4B4VA 2XNHA 5CXXA 3TQSA 4G0NA 1Q22A 1PBTA 3ANNA 1XZDA 3KKZA 3E70C 4L2IB 1GO2A 4QQFA 3FSJX 2V9CA 4TTQA 4Y6SA 4NBLA 1JQ3A 5DGHA 3CVYA 5ARBA 4HLDA 4IY1A 1J4AA 1PK8A 3EQZA 1SIBE 3GD7A 4OB6A 3C1AA 3QEMB 1NMQA 2JZNA 1HLFA 3PF8A 1YJBA 1S9DA 2OCPA 4QU0A 1XU9A 2CNLA 4HX9A 1G20B 2CKMA 3IUQA 3GGCA 5EJ8A 1T5LA 3NRBA 1HDOA 1JSCA 1NURA 1RXYA 3C3XA 3ICEA 2Y9PB 4I5DA 3I32A 1JH9A 3B1KA 2WG2A 3FPLA 2HO4A 2NUAB 4ZVNA 3IR7A 1QLHA 1YDGA 2CW5A 3VDXA 3TF5A 1O95C 1N32B 1FK8A 2YWBA 1AZSC 3U2QA 3NUZA 3ROEA 3GPDG 1GL6A 1VOTA 4MR8B 1HLPA 1ZEMA 3BREA 3OE7A 3I45A 4YACA 4U7DA 2GS9A 1O8BA 2HSWA 4C5CA 5AVWA 3SLDA 3VOSA 4RDHA 3RUEA 2BSQA 2ID8A 4GOXA 5JQWA 3DYBA 4NBNA 1GV0A 3R9XB 3AUJB 4YUZA 1ZK4A 3W8DA 4BKOA 1CUUA 1F51E 1XC7A 3E8SA 1ENPA 3L06A 4M46A 1CW2B 5F51A 1JIUA 5EXSA 3SYTA 2GB4A 2XE8A 2XOEA 5AUQA 1CQZA 2JIDA 5EMJA 2WWIA 4HO1X 1CRZA 2QQ0A