2I1LA

Crystal structure of the c2 form of fad synthetase from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
289
structure length
267
Chain Sequence
b'VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSKFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase/FMN adenylyltransferase
molecule tags Transferase
source organism Thermotoga maritima
publication title Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima
rcsb
total genus 62
structure length 267
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2i1lA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2i1lA01
4JYZA 3AIIA 1Q19A 4MUGA 1B6TA 3CVWA 4HK4A 2GOYA 3CVUA 2EJCA 2GM3A 1FYDA 4U63A 4ZCTA 3COYA 1IQ0A 4NX2A 1JEDA 4MWEA 2CYCA 2X0KA 3P0HA 2X1LA 1WXEA 4TS1A 3COVA 4K0RA 3E27A 1YUMA 2R5WA 4MUNA 1X6VA 1NUSA 2EL7A 4R2MA 3MXTA 4R0NA 3RBAA 4DE5A 3H9CA 1F7UA 4NATA 5TEVA 1H3FA 4YMIA 2C5SA 2YWCA 4RUKA 4RPIA 3AFHA 1G8FA 2X1MA 3LE8A 2VTBA 1COZA 1EE1A 1IQRA 3M5WA 1EUYA 1EJ2A 3COWA 1M1ZA 1WKBA 5K0TA 1MJHA 5A8AA 3GMIA 1NZJA 3QE4A 1NYLA 1T9GR 3A2KA 1U7DA 1YULA 1K97A 4HJXA 1N2EA 3D6VA 3MUEA 2QJFA 3U1VA 1R6XA 1VBMA 4NAHA 4JXZA 3LOQA 4PBRA 3IVCA 4NZPA 1VLHA 2X3FA 2P3MA 3COZA 4OUDB 1J1UA 3ND6A 4AQ7A 4MW9A 1J1ZA 3OTWA 1NB0A 2XRZA 2D54A 4KPUA 2A1TR 1YIAA 4J75A 1M8PA 1JZSA 4XSVA 1F4LA 3GUZA 2CV2A 3AKZA 2JANA 4MVXA 1IRXA 4ZCPA 4PBTA 3IODA 5BNZA 3X1MA 3UK2A 2AG6A 4UZFA 1G8GA 1M8GA 3G59A 1QJCA 3CVXA 2A1UB 3HL4A 1GZUA 2IP1A 3FWKA 3VRHA 4ZCRA 1D2RA 4CT0A 1J09A 1GPMA 1PG2A 1ZH0A 2A1TS 3C8ZA 1ILEA 3NBAA 1NUQA 3DLAA 4ND6A 1G8HA 2BYTA 1P4MA 1O96A 1ZUNA 2XRYA 5AHWA 2E0IA 3AL0C 1O94D 1OWNA 2QJTA 4MAFA 3UMVA 3UY4A 1I2DA 2PFSA 3TZLA 3RJZA 2DEUA 3FNRA 3CLSC 3P0IA 4HPWA 5FNZA 4MW4A 4ZT5A 3RHSA 1M8FA 5HUHA 4Q93A 3VGJA 1U7XA 3KT3A 1N05A 1I6MA 2AKEA 4WSOA 1EFPB 4G5YA 1KH1A 4EFKA 3K9WA 1T9GS 1N2JA 1UFVA 3Q4GA 4EG6A 4MWDA 1FFYA 4ZT3A 3IMEA 3IVXA 3GLVA 2WB2A 1TYCA 4BWVA 1JECA 4ARCA 3P52A 1MB9A 1MC1A 4DDMA 3DPIA 2QTRA 3ZXIA 3TNJA 3ZIUA 3IDFA 1OWMA 1KQOA 4OUDA 3Q12A 2NZ2A 4MW7A 1N06A 2CUZA 4G6ZA 1PFWA 5KHAA 1LI5A 4MQ6A 5JBNA 1WZ2A 4U7JA 3IUEA 2DXIA 3FY4A 1OD6A 2PZAA 2CV1A 1VL2A 2VBVA 1KQPA 1PFYA 4YP6A 1OBHA 4DJAA 3AG5A 2E18A 1O0CA 2CT8A 1Q77A 2OYNA 1SURA 1OWLA 1O97C 1OWOA 4ND7A 2VBUA 2VTBB 1XNJA 1QTQA 1O95C 4WNYA 1N08A 3MLBA 1KP2A 4DNXA 2J4DA 3HMQA 1JIKA 1X8XA 1QU2A 2ZP1A 4MW2A 4MWBA 4MUEA 1U3DA 5TGTA 4DDHA 1H3EA 4F3RA 3ISJA 4XFJA 1M83A 1IFXA 3FI0A 1F7VA 3DV2A 2YWBA 5A89A 1H3NA 1RQGA 2J07A 1QU3A 5IHXA 2WSIA 1WQ4A 1I6KA 4PBSA 5K0SA 3RK1A 1NURA 4EG7A 4KR6A 5J5AA 1GLNA 3AG6A 1WXHA 4ZCQA 4EGAA 3QTBA 1VBKA 2PZBA 1NUUA 1TYAE 4MVYA 4XFDA 2QUJA 2OQ2A 4L2IA 3X1JA 3CLRD 2AZXA 3SEQA 3HGMA 1YIDA 1JEEA 1MAWA 1VBNA 3IOBA 1S4MA 3BL5A 1OBCA 1MBZA 3HFJA 3ILVA 1F9AA 4DDKA 3PNYA 3LCJA 2PG3A 3CLTC 3D6UA 3CLTD 3BNWA 4EG1A 2E89A 1G59A 4Q16A 2A7XA 4QREA 1O96B 2CSXA 1YUNA 4ARIA 4MULA 2D5BA 4JZYA 1MB2A 3FG9A 3PNBA 3CLSD 3H05A 1KH2A 3P0JA 3KT0A 4EG4A 1N2GA 2BTEA 4A91A 2B7LA 1QQTA 2IJGX 3N2YA 1J20A 3UC5A 1GAXA 1QRSA 3K32A 1N78A 3A4IA 4KKVA 1N3LA 1N2IA 4QRDA 3SP1A 3I05A 2E21A 1NSYA 3IOCA 3ND5A 1KAMA 3HV0A 4L2IB 4JXXA 1WOYA 5DEOA 5LLTA 4U8HA 1TQ8A 4E1AA 4CDNA 1JGTA 3CTAA 1PG0A 5F23A 4K03A 4I6GA 2TS1A 4H3SA 3MLAA 1KR2A 2DLCX 2G36A 3N9IA 1T6ZA 3A05A 1GTSA 2IELA 1BS2A 2NSYA 1TYDE 5FO0A 2ZUEA 4I6EA 2DETA 1IH8A 3PNVA 3N05A 3FH0A 2HZ7A 1TFUA 1K4MA 3Q10A 1YI8A 1DNPA 1V8FA 1ZH6A 4YBRA 3RFFA 1JILA 2O8VA 2RE8A 2CV0A 1NUPA 2DPLA 4AS1A 1O97D 5DB4A 3TQIA 3KT6A 4EG8A 2A88A 4MUJA 1O95D 1NUTA 4EG5A 5A88A 1IHOA 3KFLA 5J59A 2H29A 4MUIA 1IVSA 1IQUA 1M8JA 1MOPA 2Z09A 3UOWA 2I1LA 2OV4A 3NV7A 1N75A 3IUBA 2QJOA 3CR8A 3PRHA 3IMCA 1ZJWA 4DLPA 1EFVA 2DUMA 4MWCA 2HMAA 3TZEA 1Q15A 4X0EA 4P2BA 4EG3A 2WQ7A 2A4MA 2QTNA 3IH5A 1HYBA 1LI7A 3FHJA 1TEZA 3INNA 4EF6A 1WXGA 3SEZA 1GTRA 3ZJVA 1N07A 1Q11A 1O6BA 3A04A 2DR2A 1KORA 1GN8A 4S1OA 4CQNA 4MW6A 1Y42X 2A84A 3CLRC 1K4KA 4OJMX 5H16A 2DERA 3S3TA 1JHDA 1MAUA 1KQNA 3ELBA 3H99A 1QRUA 1N77A 2D13A 3L92A 4NAUA 4HJRA 3CLUD 1JZQA 4GRIA 4YP7A 3N8HA 3IOEA 2Z08A 1EFPA 5DASA 1LW7A 1OWPA 2V0CA 3KT8A 3L93A 5HUJA 5LM3A 4ZT7A 3FDXA 4ZT4A 3RK0A 2VBTA 1N1DA 4MVWA 1TYBE 2PZ8A 1J70A 2A1UA 2YXNA 1QNFA 1WY5A 2QTMA 1PFVA 3ZJUA 3MMXA 4YP5A 3FETA 5TEWA 1XJQA 3CA8A 5LFAA 4QBTA 1NI5A 5KCMA 4MVCA 1EUQA 4ZCSA 4MW5A 2JAXA 1R6UA 3FIUA 2V0GA 1O94C 3SDBA 3G5AA 1NB9A 2RD2A 2PIDA 3TQOA 1QRTA 2A86A 5TS2A 3ZXSA 1PFUA 5J58A 1I6LA 3X1KA 1R6TA 3OP1A 3CVYA 3PXUA 5H7XA 3FOCA 4MUKA 1J21A 2J5BA 2J08A 4MUHA 2CYAA 3CVVA 1Q9SA 1KP3A 4NDAA 3SZGA 4ZT6A 1MRZA 3SYTA 3H97A 1T6XA 1T6YA 1N2OA 1XNHA 3NBKA 1O5TA 3H9BA 2PXHA 5IJXA 3TS1A 1NP7A 3F3MA 4KR9A 1N2BA 3JXEA 5DK4A 2YY5A 4G5FA 1M8KA 2O5RA 3ND7A 1U3CA 5EKDA 2JA2A 3IVGA 1P7PA 3IMGA 2H2AA 4UZEA 1WQ3A 4MW1A 1KAQA 2GKSA 1U0BB 5TRDA 3ZUGA 1ULHA 1WXFA 4J76A 1JIJA 1H1TA 4R2LA 1WJGA 2HGZA 4FZJA 1EFVB 4I6JA 1JMVA 2WQ6A 3ZGZA 4KR7A 5KWVA 3VU8A 1N2HA 4MW0A 4CDMA 2QUIA 4F4HA 4JFAA 4PY2A 1XNGA 1O0BA 4MUFA 1K92A 1EXDA 2CFOA 3ZJTA 4MLPA 3SZ3A 3G6KA 4GU5A 5HG0A 1WXIA 1KKUA 3CLUC 3HZRA 1JIIA 2ZUFA 2VXOA 1V47A 4ZT2A 2VBSA 3DO8A 2Z3VA 2J09A 4KPUB 2QUKA 2CYBA 1A8HA 1CT9A 1KH3A 5FO1A 2QUHA 3QTTA
chains in the Genus database with same CATH superfamily
3BGWA 1GZSA 1U8AA 1QH1A 2VQ3A 3DUFB 3E5MA 2Z8YM 2GOYA 2B2NA 4HK4A 4O4JF 5BVGB 3EW9A 2XXAB 3ETGA 2WUFA 3WTBA 4F2WA 5FYQA 3AL3A 4IHJB 4BQPA 2Q6OA 2O50A 3OOYA 2XDQB 5K0EA 1QVFB 1A9PA 3I5MA 5AK6A 1VG9B 3DBHA 4YCBA 3RPEA 4GPBA 3RQSA 1YJWB 5HKAA 2WMNB 3NKLA 1Y5RA 2GAFA 1U0RA 4TYMA 3TUIC 1P1IA 4WK4B 4GF5A 4ALJA 5JCZA 5KX5F 3AB3A 5BWLA 3SJZA 3R41A 1CEEA 3COJA 1G9SA 4HSGA 2A78A 4HE6A 3HUTA 3AJAA 1C30B 1P0CA 4I1SA 1D9XA 1RLTA 2BKLA 4MVJM 3MQ2A 1K1EA 4OA8A 4P5EA 1BOFA 5DF1A 5IBCA 3O8LA 1D8TA 4FILA 2EWVA 4GZMA 1TIPA 4HZUA 3IEMA 1M2VA 1X1AA 1QH1B 5ADUS 5AQEA 2Q1SA 1MIHA 1QG2A 3RBAA 4Y9SA 1WG8A 2WE8A 1OX4B 1LW6E 1YNSA 1DBVO 3PCTA 4LHSA 3NFYA 5KYNA 2VG8A 5TEVA 1IUKA 2HCFA 2HUPA 2UYGA 1W5FA 4IDDA 1E2BA 4TPKA 4E08A 3BULA 3DTVB 4GLBA 4KDCA 4DCTA 1FLDA 1TCBA 3BOSA 1HKUA 2QRJA 3FVRA 4HTAA 4LG1A 1H5NA 3T9AA 2YKGA 2FW1A 2B8JA 4G5SA 3PEFA 1JKMA 5EJ8A 5TT0A 3ZY3A 1E60A 4CKYA 3A1SA 3BD9A 4K9QA 5EMHA 5DWVA 1RIFA 4PYNA 4EPRA 4H16A 5C0OE 3GLGA 5CBPA 4PGAA 5CX1B 4C04A 4BNIA 4HYTA 5G4KB 2JI8A 1U65A 4PAAA 3GZNA 1LS1A 3IKTA 4N54A 3IVCA 3ZU2A 5A9SA 5KTKA 5NLLA 1Z26A 3B89A 2W93A 3COZA 1HURA 4FYMA 4IDBA 3VR3A 4BNKA 4NABA 1PR4A 1G63A 3C5WP 1Z68A 2W2TA 2XITA 2AJ8A 1NB0A 5F1PA 4Y1EA 3ICEA 1I2MA 1WNFA 1SY7A 1ZJ4A 1M8PA 1YX2A 2X6XA 2PGDA 4RVCA 4YUAA 4ZOCA 1PGPA 5ALDA 1KSHA 2XUAA 3DOHA 2FOLA 2QYTA 3DE7X 2AR7A 1XXHE 4UM8B 2P62A 4F72A 3KSDO 5F35A 2ZSDA 3G8CA 3DQQA 3W5AA 3ES9A 3A1FA 3EDQA 3O7MA 3RK4A 3X1MA 1QQBA 1G8GA 3D2AA 4BX3A 4I36A 5E1BA 1P3Y1 2I4NA 1XMOB 1WVMA 2EGHA 1H6DA 3F4KA 3HA3A 1QAMA 2VYVD 4XR6A 3CCSB 3RRMA 1WBDA 4PG7A 1PQ4A 3HJBA 4IH1A 5JAHA 1XD2B 1XU4A 1PGNA 1WBJB 2PKRA 2GEVA 5JXJA 1PUIA 4AKIA 1QPBA 4FOOA 4JLJA 1HNNA 3ISVA 5B3AA 3AF2A 4PNHA 1UD2A 5AICA 4HQ0A 1ZESA 4EYKA 1X1TA 3FJ1A 4AMVA 1VKRA 4RWEA 4UTXA 5FP0A 2AQIA 3OTIA 1N1MA 2G88A 4X00A 3IAS6 1CRLA 3UPTA 1VG1A 3FAZA 1GT91 1XCOA 4FFMA 2DUJA 3F6BX 4JJ6A 2QJTA 3ETDA 3LUBA 1G3MA 2VHUA 4N6NA 3VH2A 4C0AC 5FA8A 1I4LD 5LD2C 2DFVA 2KE5A 2DOGA 1NJ2A 5L3SB 1RWOA 2BFEB 2PS3A 2JATA 2RGDA 2IV3A 3WYEA 1JDBB 2OOSA 2OZLB 3RLIA 4ARSA 3WGVA 4CHGA 5E8RA 1UR5A 2Q49A 2W6CX 2AQ8A 4Y2GA 4DLLA 3G8AA 2KSQA 5KX5B 1UBOS 2YVKA 4UNQA 2WWWA 1OZFA 2NTJA 2QY9A 5BUCA 5JXHA 4KYUA 1CF4A 4RSHA 5CXSA 1U99A 4RAQA 2QZZA 3H5AA 3KVOA 3C1OA 4DNFA 4RKEA 1VZ3A 2V03A 3UUEA 2O1SA 5F4MA 3DKPA 3B1VA 3RDPA 4ITVA 2EF1A 5IDYA 1SUSA 2F1IA 1S89A 3AETA 3BKXA 2H3HA 2ZI7A 2DB3A 2OLEA 2XUHA 4LUCA 4N5MA 5TGDA 2KM1A 2D2FA 2ZUVA 4G8DA 4EZEA 5KHLB 4XLAA 3VC7A 5L3SA 2ZTGA 1WU7A 2DKFA 4HH0A 4O5AA 5FFNA 4IGAA 1J2EA 2TMDA 2ZKIA 4AN4A 5JC1A 2AEFA 4CUZA 5IMBA 1DCFA 4C20A 5CA0F 2RIRA 3Q1LA 2PNFA 1OXMA 5F2EA 5A7HA 5KVAA 3BIJA 1RQPA 4MQ5A 4P08A 4WK2B 4KE6A 2CV1A 2QIOA 3A4VA 1Q81D 1TRKA 1X1DA 2EP5A 2Z6VA 3QRWA 4IOJA 4K6OA 4LJ9A 4MO9A 4NS1A 5SZIA 5I7HA 3OAAA 5DX0A 2XT9A 4LZWA 1SURA 5IJWA 5AM4A 3OQNA 4DV1B 1PNOA 4HFJA 2JN9A 3OZUA 3L7KA 4BNVA 3PFKA 1X0XA 1GPKA 3G0CA 1PF7E 4J1NA 1QTQA 1ADGA 1EP2B 1NBMD 3BA1A 4AC9A 4L78A 4Q9KA 1Y3CE 1GILA 2G09A 4NYMQ 4IWYA 1RD4A 4G1EB 5DE3A 4DEYA 1SBIA 3JS5A 5EQJB 1J0EA 3EGIA 3QEAZ 2ATEA 2GLTA 1JAXA 2C5AA 3EOBI 2I4OA 1U3DA 1AH2A 4OHFA 4MV1A 4F3RA 3Q6MA 2X8LA 4ENQA 1E9CA 1EEHA 2OECA 2XCOA 2Z4RA 4NCHA 4ZZ1A 4BVAA 3K0SA 4Q9NA 2YV1A 1KRXA 3E22B 1A88A 2QAJA 4FEYA 4I1UA 4LRWA 2J07A 1EXMA 1DLIA 1ZZGA 1ACLA 2WSIA 3C3MA 4BV8A 1I6KA 1HTTA 3BD7A 1F60A 5D8DA 5T4FA 4TYPA 3ZKAA 5LMZA 4EHNA 5JYDA 2W90A 3RRJA 5K0SA 2C2ZA 4JYMA 3DDOA 4YELA 1YFLA 1EE9A 4KR6A 3ROEA 2HMTA 4S1VA 1RRVA 4D82A 4IIDA 4K9OA 2QRPA 2FKNA 2DPYA 3KKEA 3HU5A 3U17A 3UAZA 4C0WA 3C39A 3AY3A 4DA6A 2FW6A 3PA8A 2AEEA 2J3DA 4LPSA 3W6NA 4R83A 3ZDDA 4C7KA 4FXPA 2AZXA 1S1MA 3AW9A 1U2SA 2R62A 1ICEA 3R24A 4N65A 4NC9A 1S4MA 4TKUA 1FP4A 4DG9A 5EA2A 4CEJB 2I7DA 1C0LA 1KJWA 3CCMB 1C0KA 2AI3A 4FNAA 4GOKA 5GADl 5LMUB 4L02A 4R8KA 1VHQA 3DKVA 1VIMA 3IRVA 4X7PA 1QVVA 1YT5A 4HBGA 4JVSB 1RZVA 2QAIA 2NAFA 2AMVA 4RV9A 4HGRA 1HMPA 3SBOA 4POOA 4XGIA 4YR7A 5CT9A 1VFPA 4CF6A 4KPFC 3E84A 4C4ZA 2WOOA 4A2WA 4AULA 4DQVA 1X7YA 3GGDA 4PZPA 3R3XA 3UZUA 4G4SO 5EZYA 2GK7A 5TMPA 4OY3A 4MB0A 5BV7A 3REGA 2EJVA 2Y1GA 2JGIA 5K6AC 3L8GA 1A50B 2ZSFA 3LSYA 2NSHA 1RYMA 4KEAA 4B8WA 4J0HA 3UC5A 4YY3B 4ZTUB 3KKMA 3HPRA 3IDSA 5JAQA 4C1BA 2CNLA 1OPXA 5C4IA 2G1KA 4HYQA 3H1TA 3OPVA 3LAWA 4J03A 4OXIA 4ALKA 4HT3B 1UXHA 5HQ3A 1IIRA 2H1FA 4PO8A 3L4JA 4G0ZA 4B7ZA 1A9QA 2JVIA 3TLEA 1FS6A 2V3WA 3FPGA 3TRIA 1W75A 4RGBA 121PA 3PNMA 3BMQB 3PC6A 3FYSA 4L2IB 1B41A 4BAGA 4NPHA 3BORA 3DVAB 1L5SA 3FLBA 2BY4A 3L1HA 2BEWA 4XB6B 4R1OA 2CXSA 4CV1A 3A4NA 3ER8A 2PUDA 4JJKA 5CR9A 2FEAA 3DOUA 3BDAA 3GPIA 2XYRA 1VHLA 2ZJBA 3SWWA 2IZ7A 4RTOA 3A05A 2R4QA 1TZMA 3EVAA 4HLQB 3BD8A 1BMFA 1CYEA 5KOJA 2VT7A 4KSBA 4EVQA 2HNAA 2JBWA 4QUAA 4YRCA 1IH8A 4BMYA 3VR6H 3GOQA 2YHBA 1RLOA 1ZK3A 1T3ZA 3HCOA 4GEKA 3TJMA 3UT0A 4A6EA 3IXLA 2OCIA 3A28A 4ENTA 5FTNA 1JXQA 1NOJA 1M0TA 1JJIA 1IBRA 3LQFA 2PL9A 5TRTA 3PPWA 2RE8A 2XCIA 2CV0A 2A3NA 2DPLA 4H3HB 4RXUA 4HAUA 5LD2B 5DB4A 5DP2A 5E38A 3C4JA 4EG8A 1TZKA 1TIBA 4DUYB 3K09A 1WB4A 4RA9B 4R81A 3A1NA 3BBLA 4IFIA 5TF0A 2YIMA 5ITWA 2YHAA 4YJDA 1NU8A 1XMJA 2R48A 5E4YA 1K7CA 4NICA 1FDIA 2IHNA 4TN5A 2I1LA 1DC4A 3A7EA 3CNHA 5FOTA 1ZP6A 3U39A 5HE9A 3IMCA 3OPYA 5EJ9A 1NQTA 5CVDA 4QHTA 4DPMA 3EVDA 4DLPA 4N0DA 2X7JA 3KQVA 3WNZA 3MWYW 2ZITA 1ZW1A 2AKYA 2P5UA 1DPFA 2YWFA 4JLAA 3OH8A 4OHUA 1ZM7A 3EEFA 4OB6A 4DLYA 1Z35A 2ZBQA 1PEKE 4Q24A 2EERA 3GEEA 4FR5A 5C51B 3ZD6A 2GLXA 1FPQA 1UKZA 3DMYA 1NYQA 2X13A 4ZK2A 4YRAA 2YRFA 1QYWA 4IJVA 1MO5A 2A3RA 3KKNA 3VJKA 4US0R 1J8YF 1X8LA 5BMOA 4CQNA 3GRUA 1PJTA 4JP5A 4LAFA 4O2BA 3E8XA 5H16A 3KUUA 3SSNA 3WHLA 1Q74A 3NEPX 3DYVA 1Y5NA 4GI1A 4PRKA 2ZCVA 4I4TA 3OKPA 4B32A 3U3RA 1O8BA 2DECA 3X2EA 5HM6A 5KTSA 1IN7A 1HZJA 2W5UA 4CKXA 5T57A 1U0LA 1OI7A 1KZLA 1MH9A 3KYIB 3L79A 3MERA 4II7A 3PDUA 1Q14A 3AR7A 3PKIA 4RELA 4WA7A 2AI2A 1N5DA 2A33A 3KT8A 4JVOA 1YV9A 2C8KA 2XADA 1D2HA 1SU6A 4IQ4A 5AKYA 4DMRA 4Z8XA 3ZHRA 4ZICA 5KB3A 1XCGB 3TPFA 3G2HA 2QVYX 3W6OA 1YF3A 2FJ0A 2Q5FA 3SK0A 5IYPA 3RM3A 1E4EA 4PS0A 3WGLA 4ZT4A 1NR7A 3ZNQA 2QT0A 1YJXA 1FFSA 2HRQA 2P4SA 2JK0A 2Q5HA 3STHA 1YO6A 2JGRA 2YS6A 3PD0A 3HTXA 4MGEA 5I3CA 2OV2A 4ZAGA 4GNKA 3MMXA 4DWJA 2HTEA 2NQTA 3U6KA 2ZEJA 4FKBA 5ALLA 5GPBA 4Z53A 4XX1A 5MGNA 3VSBA 1COWA 1PRYA 2OHVA 3WLRA 2Z6UA 5E3HA 5AJTA 2BGNA 5IW8A 3NIGB 4N03A 3SC3A 3WGOA 3OIDA 4EYGA 3QKIA 1NULA 3REFA 5FPQA 4DIBA 1II9A 2Z5FA 3KEFA 1AUOA 2WT9A 2PD6A 3K53A 2ZT6A 3NKFA 2RD2A 1GPJA 4HXFB 2OQVA 2NO7A 4RCVA 3RW9A 4C89A 2I78A 2PMCA 2B1RA 1DO8A 3F9IA 3EUEA 3ZXSA 1DAKA 3L0BA 4IIYA 5D3QA 4DG8A 3MRSA 2A0FA 2J7PD 3BA6A 3BXHA 3PEWA 1CEXA 3IFSA 5A71A 3UNXA 1L2TA 1TCVA 4ZJZA 4XD7D 1PWZA 2RHBA 4W82A 1BDJA 4KKXB 4JKIA 1DT5A 3W5BA 2BFCB 4LZPA 4MRMB 5FI3A 4XX0A 4NSNA 4IJQA 3UK1A 4DHWA 1D0IA 1BX1A 3WRXA 2ID4A 4PG6A 1D07A 3TS1A 3X43A 2IOFK 1V8BA 2FPLA 4GXRA 3GX1A 1AKVA 2VHWA 5AI8A 3RR2A 4DSTA 1HLPA 1RSZA 3U7FB 3FXAA 4WXYB 3TQCA 1NMQA 3N6RA 2G28A 4NF2A 3BHJA 3RRNA 1LVUA 1PJAA 1G55A 4M9QA 4Q3BA 5CT4A 4P6YA 3CSUA 4YA6A 3SHQA 4D46A 3IXQA 5B2ZA 2B1IA 2V3VA 2IS2A 5EPOA 3BMCB 5BWMA 2CHGA 4ISBA 4ER7A 1F0YA 1OX6A 3D3WA 1MJGA 1MT3A 3FRHA 4UXHA 4EPVA 3M6IA 5J2UF 2HNKA 3A3YA 3P4YA 3IALA 3JD4A 4G0WA 2XWJI 3QW2A 1COWD 5ECYA 3ILYA 4MA0A 2IS4A 3SZLA 3C4QA 4ZAYA 4CZ2A 5K0ZA 2WF5A 1IN8A 3IPLA 2J0UB 4XIIA 1T0IA 3QX8A 5SZKB 2V4UA 3ASVA 1U0EA 4YDSA 5SZJA 5TY0A 2P5YA 4IDAA 3NGLA 1CQWA 2P65A 5COAA 4ND3A 1J8QA 3E05A 1N6KA 1Q6ZA 1IJFA 4P2NA 2I99A 2VZEA 4OD0A 4QSMA 4UW9A 3W06A 1EXDA 2AIRA 1A27A 5GM2A 1M0SA 4EJ6A 3KXPA 2Y1OA 1RFLA 5DYGA 1RCTE 1TO2E 3G6WA 4CLRA 5HZAA 2LVBA 1N5LA 3MW8A 3UQYS 4XWOA 2ZUFA 4FFBB 5BSMA 3WTCA 5BP7A 1C8BA 2VK4A 4URYR 4X71A 3RWOA 4YT5A 3T4EA 4B6EA 1XMQB 4I4TF 5D86A 1GFSA 2OENG 4KPUB 4AIIA 3U3MA 1V7ZA 3QENA 3A7DA 3CUKA 1XZCA 4HNGA 4I66A 1MA3A 3ELWA 4J0IA 4L4YA 1I01A 4FGZA 3FUVA 5AOVA 3PEUA 2XB8A 1W5TA 5FEMA 4RENA 4JC5A 4I81A 5DI9A 1ZHHA 1E3SA 1CE8B 3EQZA 4FEAA 4CMIB 4KUEA 1KC3A 1SXJD 3VR2D 3TRKA 3CVWA 4AWAA 1VGQA 1EHCA 1X9HA 4MR9B 3GG9A 4N76A 4G67A 3SQOA 2PU5A 4EUFA 4F1JA 3LOUA 2CVOA 2GM3A 1FRFS 1FYDA 4MV4A 1YRQA 4WOBA 3GPDG 4I08A 4CLRB 2CHQA 3O47A 1XROA 1XXHB 1LBSA 3RSQA 1E4VA 3FCAA 1BXKA 3HXKA 1ZITA 5CNMA 3SPXA 4GR5A 5I9BA 5LXTB 4N3GA 3OF3A 1CRWG 3S2IA 3TAHA 2OG1A 1EVKA 3PCRB 5LZ8A 4A1OA 5A2GA 4I1PA 3LVQE 3J7AC 3COVA 1L8XA 4TUYF 5DZSA 1V2HE 4PC6A 2DX7A 1V5WA 1LK5A 2Q3CA 4NE9A 4WZKA 1R12A 1X87A 3PVCA 5CLGA 2R5WA 5FAXA 1X6VA 3JAMA 1ESMA 1HK7A 1FVXA 2RK6A 3UCFA 4BFYA 1NQXA 2Q5LA 5CFPA 5ICGA 4JOSA 4FK8A 4IJWA 3RYTC 3ZW8A 3BCUA 1UKVY 3C6KA 4Y6PA 2XMSA 5EWMA 1YJBA 1P5FA 3T9DA 3RRFA 2QP3A 1CFJA 4WBXC 3FUTA 4FDLA 2Z1NA 4RANA 3E9YA 3ICWA 4IJ5A 1JPUA 2NZVG 4UM9D 2SKDA 3V4PB 4EHBA 4KLNA 2MSKA 2FW9A 1RXSA 2R0QC 1NLUA 4LV8B 4EKGA 4UHCA 2PLNA 3O9VA 3OFNA 1V37A 2H4XA 2NUTA 1T8PA 2EZTA 2V8OA 2WMYA 4IDNA 3DCYA 4CKZA 4BFVA 3EFBA 4OG2A 1XFOA 2JJ1D 4OYRA 5EZSA 1MVNA 1XWFA 3AEQB 2Q3MA 3U1VA 3LT1A 4V24A 4H18A 5FLYA 5FTKA 4UTRA 3L5OA 3DAYA 5C3MA 2EIHA 2W58A 2ZIZA 5D00A 3VDRA 3ZKWA 4BJ5A 1N34B 4NOKA 3RODA 4EYEA 4L8WB 4Y2QA 1L7OA 1WCXA 2X3FA 3DAGA 4L3VA 2PKEA 4TLMB 3RJMA 5ICSA 3PLNA 1TTPB 3B8EA 2DWUA 1PSDA 5WRFA 3WAJA 4JLWA 1ZG3A 5MFPA 2VH5R 2GGSA 5LVAA 2YV3A 3KU4A 1C0PA 3SM9A 3EXFB 1XKLA 3JVIA 3JATB 2GVZC 2IXDA 1E99A 3RYIB 3RJ9A 4Q9AA 4G9BA 2H85A 5FR2A 3TDMA 4AJ1A 4HNAB 4HDQB 5EKSA 1C9EA 1Y9EA 1YR3A 4UATA 5BV0A 4BMSA 3N0RA 3P2EA 4LGVA 4ZHQF 5DWDA 3N0XA 3IJPA 3AEQA 1F17A 2AG6A 2HL6A 1XIVA 2JLSA 3R0QA 1GCUA 2BISA 2VUTA 4GXNA 2FSIA 2BMDA 3AEZA 4V0SA 5H3LA 1K5HA 1XFAA 4LJ4A 2XE6A 4D8TA 4Q03A 2O3SA 1ADBA 3E9RA 3F3YA 2A58A 1L3CA 1CJKC 4RQUA 1MIOB 1VM6A 4IYRA 3COPA 3BXZA 1QR2A 1AC5A 5EKUA 4D3XA 3ZWBA 3QVUA 1H94A 2WHYA 3MIZA 2N3ZA 4PXAA 4ZYXA 5I5EA 1GL7A 2JAQA 4OLBA 1MABB 3WXMA 4PVCA 4KYTA 2LCQA 4MTCA 2QVCA 4YWHA 5KNBA 3NTXA 1TZCA 4Q7JB 1O96A 2QG4A 2B0JA 2ZANA 3GA7A 3URMA 4LTMA 5GJBA 3P71T 1H2BA 5IH3A 3RU2A 4RAOA 3ADBA 1P6QA 3AL0C 4TL8A 2X0NA 4RK1A 1Q0UA 2Z5LA 3JAKB 2C2GA 3UY4A 2Y92A 4D74A 2BGKA 5IYZA 4D9NA 1V4NA 3HBMA 4Z4FA 1SC3A 4XE5A 1O03A 5BVHB 4HBZA 5LL6P 4MW4A 2Z8XA 5ADHA 2WFAA 1DQPA 2ZS7A 2VSYA 3CZ4A 1I14A 5FNVF 5DM4A 2E87A 4M0FA 4Q18A 3TH5A 3V1KA 4KQIA 1K7FB 4B84A 3FWYA 2RAUA 2HHJA 4HC4A 2ACVA 1C41A 3W2EA 1ULZA 2PCLA 4TVSA 3FFWA 1NQAO 3L7CA 3QYAA 4RF5A 2DHDA 1Q1AA 3HP4A 2AA3A 2AZ4A 3LF1A 2WHQA 4NYJR 4OI4A 4XMYA 3ZHSA 3E53A 3HVUA 3QHQA 4UNIA 1CDOA 5C3UA 1JU4A 3LCUA 2F6RA 4FDVA 1S2LA 1J2YA 3WBFA 4EMTA 5HDBB 1MC1A 1DWPA 3W2HA 3PC2A 1I0ZA 3O2SB 4DDMA 3S8EA 1RYEA 2BL4A 1DBRA 1JJ2B 4RSGA 1KWKA 4QM6A 3RHFA 1YRYE 2O2GA 4W5HA 3S27A 4MCHA 3VYWA 4WLUA 3L6CA 2WVHA 4B8ZA 5CVTA 3RC9A 2WFLB 1C3EA 5F9FA 1S96A 3EZGA 1QYCA 4G6ZA 3WNQA 1B26A 1FLVA 2PXXA 1JQBA 3BT7A 2ST1A 1DJNA 3U7RA 1YHYA 5BSVA 3Q85A 1GUZA 1OD6A 1YQ9A 5DI3B 3RC7A 5H4GA 2GO7A 3ZE8A 4ZMSA 5I4CA 2BI4A 1L7PA 3MPUA 4NOJA 1MEOA 4BXOB 1LQUA 1N5KA 3DBLA 5JVDF 2BGWA 3IQGX 1QF9A 2FRVA 1T4MA 4CMGA 2P67A 2PMWB 3EXAA 4RF4A 2A94A 1KQGA 1CDDA 3K1YA 4NFSA 1I1OA 3ZIAA 1U9ZA 3WICA 5M7EA 1XNJA 4WZEA 4KIJA 4AO7A 1SCQA 1Z0JA 1W1UA 4F2DA 4WJLA 3C45A 4YAJA 1P17A 4OV6B 2HHLA 3I9NA 2FCAA 3T3HA 5DGHA 1E7YA 3D81A 4H35A 3HUDA 1ZD5A 1W29A 4MW2A 4Y7DA 2IL1A 5DTJA 4ZOEA 1HYEA 3TFQA 4KO4S 4H1TA 2AFHB 3B6KA 4BLQA 3MT0A 3OG9A 1O9BA 3MFYA 1O0SA 2YWBA 3ZLVA 5FFFA 1SVOA 2EP7A 4PG4A 2C59A 3Q6NA 1L9KA 3A1CA 2RIPA 3R0ZA 3O4VA 1Y5LA 2XTMA 3RK1A 2JAWA 3WLNA 4AS2A 5JNVA 5EKXA 2RI0A 4IH9A 3F3KA 4FYHA 4EBBA 2HQBA 4BRWA 1H2FA 2I6GA 3UWOA 4EX7A 2KBEA 3TD9A 2OZPA 1HFJA 3HJGA 2Z4TA 1P45A 1T6NA 3B48A 3C1TA 3IDQA 3GLUA 3IDAA 3O92A 3QFCA 4GGPA 3T7JA 4C7VA 2QQFA 4ABTA 2I8AA 1T15A 4MYUA 1L5NA 2H00A 2O2YA 2AL7A 4QOJA 5FYDA 3S1AB 3UHOA 4WXRA 1CNMA 5FOVA 3TEMA 3DC2A 1H2ZA 3OZFA 5IFLA 1JR2A 3IULA 1RXIA 2H1SA 5JAUA 3OZWA 1PE0A 5JCJD 5AVZA 1HBJA 3B12A 2AFHA 3RUPA 1UT8A 2IV7A 1R5NA 1T0BA 4ZXPA 4UVIA 4DLRA 2HR1A 3MEQA 3ITEA 4Z4SA 3ACDA 3LT4A 3JQ6A 4ASUD 4B3HA 1CZKA 2WD9A 4QREA 3S2FA 2J5RA 5EPEA 2Z9CA 2ID8A 4JX8A 3ETEA 3C15C 2GA8A 2D5BA 5DYYA 2PKCA 3CPSA 2AF4C 5I6DA 3HYLA 4LF7B 1BMFD 3FOZA 5A4KA 3WK7A 3NIWA 4C7MA 2AJTA 2E3JA 1GARA 5KO2A 4ZO8A 3KHKA 4C4PA 3WGUA 2CHFA 1CJTC 4AURA 3K9HA 4S04A 2QL7A 3N76A 1Z56C 2QP4A 4KKVA 2O4CA 5HF5A 1N2IA 5EYPB 4N7JA 8AT1A 2HU7A 4PTYA 4TTTS 5H8WA 1ZZEA 2HSWA 1P2SA 3EA0A 3UH0A 2HCJB 1A1VA 1U1EA 4UMVA 1IHYA 3A6FA 2C99A 2F1OA 5CBKA 1MOZA 1RMTA 1T9KA 3PL5A 1QV9A 1PT8A 3BZWA 3CN9A 3G9TA 1NNI1 3FFTA 1FUYB 4R71A 4YAUA 3CTAA 2P1ZA 4QNMA 3JQFC 3EEIA 4L7VA 4K03A 4W1RA 3SD7A 1JLRA 4OOEA 1L4FA 3IQHX 3NDRA 3GHHA 1IJKA 1I4DD 5FI0B 5AOCA 2DLCX 3D7MA 3PITA 2QVLA 4A8PA 3LKVA 3DT8A 3T7TA 1YA4A 2N0SA 5TQ0A 3GAZA 4G5RA 3SSMA 2CK3A 1XQ1A 1EI9A 2A9KA 1MC8A 3V7AA 1G17A 4PHFA 5IARA 4JVLA 2GA9A 1SVIA 3N05A 3BXGA 3QLUC 2HB6A 2PANA 1TFUA 2WKPA 4J9VA 3U4AA 4XPIB 2CHVA 1FNSA 5AM5A 4U7DA 3ZY4A 5LZ4A 1N5JA 3K35A 3NX4A 1YS9A 2GEDA 3BCSA 3QBTA 2QNBA 2YN0A 4AF8A 2ZUWA 1Q92A 3V2IA 2GPNA 3K70D 4E5NA 1VPWA 3G0HA 2B8EA 1EIZA 3L8FA 3BMOA 3HACA 4HS4A 3W1EA 1FSSA 1HI9A 2HLHA 4PLZA 4P93A 1ILWA 1T0UA 2GJ4A 4AJKA 3M9LA 3GOHA 1TI7A 5SYAA 2FRDC 3GRFA 1L6IA 3C3BA 5IAOA 1DEXA 1MPTA 3DLPX 3HCAA 3MJHA 5EJGA 4F96A 1IOWA 3KP1A 1CQIA 4M46A 1RYDA 2HF8A 4TV9B 2VP9A 1EFAA 4B3MB 3EPHA 4ZVNA 2VJMA 4AMYA 5B6PA 3ESAA 3V1MA 3VAZA 3K30A 2MOKA 4A15A 2B1GA 2QS9A 3RVQA 3T1QA 4BIIA 1XKTA 1P2TA 3VO2A 2VAWA 3UEOA 4B6PA 4IZOA 3NCTA 5EHGA 2ZZEA 3A04A 3TI9A 4OBBA 2AMFA 4NKRA 3G1UA 1M1XB 2NV2B 1K6IA 1R4NB 2AMYA 4P0PB 4KTTE 4MJ7A 3TQRA 1DEOA 3UJ8A 3V8MA 4DBLC 1EK0A 3PQ8A 3UKJA 2R1TB 2C42A 3S3TA 4ZGBA 3FWZA 1FJHA 3OQMA 4TSFD 5F98A 5ALJA 4F85A 2C83A 5IT4A 1B2LA 4PEVA 4LFBB 4QIHA 4YP7A 3EIEA 2YINC 2CCKA 2C7GA 4LCBA 4MVJD 4BQIA 2J3HA 1JFRA 1ZAKA 3U4GA 4U00A 1OXUA 3RVJA 2B7CA 4C05A 2B8WA 2ESRA 2OXEA 4BN5A 1L8AA 4GDFA 4UUMA 3LK6A 1RQNA 1WPRA 3O8OB 4X7EA 2YV5A 4IIXA 3KHUA 1SKYE 1NU6A 3VR6A 1T5LA 2CXNA 3FWHA 2ZZMA 4G1UC 5ARDA 5IYZF 1IEWA 1Q0ZA 4C4RA 3IKJA 4PO3X 1KI6B 2QN2A 2OHHA 1GRNA 1XALA 4MVWA 4UUPA 1PV2A 2PZ8A 4MR7A 4S1NA 3OFKA 3RG2A 3K1TA 3L7IA 3HVHA 1X7XB 1TL7C 3A3OA 3IB6A 1DKPA 1ZA1A 1PFVA 3WMFA 4WFJA 5C5DA 3TZKA 2WM9B 3LYLA 1O9GA 1S3FA 4YPFA 4BATA 2VJCA 3A14A 3UTDA 3VH1A 3BVPA 1GOTA 2AE2A 1ZNQO 3H5TA 9GPBA 2GNPA 2HMSA 2ODBA 3AHDA 3O4HA 2VSOA 4MW5A 1G7SA 2J4FA 4R1MA 1ZRSA 2F3RA 1V26A 4DJDC 1BQ3A 1CBUA 2WYWA 4FSXA 4I4TB 2NYAA 3D6AA 5IWAB 1R15A 2I1WA 2RAPA 3EK2A 4L8FA 4QLAA 4DW8A 4JOQA 4ZEOA 3R5XA 4Q7LA 3SBEA 2UZ1B 4I3FA 2P2DA 1G21E 4PHTA 4QEKA 3K2BA 1SUCA 3K05A 1MZPA 2ZRQA 3JALA 2W2VA 3M4NA 1DRJA 3GQBA 1L5VA 3THYB 4HXEB 4OX9Y 1HV8A 1J21A 2CEKA 2J08A 3I0NA 1UC9A 3F8TA 2QTLA 1BU5A 1W6UA 2AGVA 2P8SA 1BN6A 1UINA 2EEZA 2AH5A 5TPZD 4E1AA 4US2R 4XN0A 5HZBA 1Q1NA 4KKUA 1VOTA 1GY8A 2B4RO 1NBMA 1M90D 1T2DA 1IJBA 3AVPA 3G7SA 4UHKA 4PYRA 5LQDA 2IKSA 2BKAA 3PUZA 1KERA 4RFLA 5DK4A 5TNXA 1DX4A 3ZWPA 5KNDH 4RJLA 2HN9A 2WG0A 4QPCA 1K08A 1ECLA 5KREA 1ZR4A 1MHPA 4UM7A 3TL3A 5EMNA 1UC5B 5EUBA 5BN3A 1GQ2A 3FJYA 1MG5A 2X53S 4YCAA 2H1OA 1ZMXA 2E55A 1VSUA 1F8XA 3HI6A 4REMA 4Q3EA 4ZEMA 3LNNA 1GQFA 2CJYA 4WOCA 4CF4A 1NE2A 1IN1A 1YJ9B 2BZ1A 1YI2B 5AK3A 4LDAA 5AM0A 2PTGA 4P35A 4N7MA 5FH9A 3HMKA 5PGMA 1TVEA 1G0OA 5HA5A 5EE3A 1UK7A 1BDMA 1EM6A 1T4DA 1T9DA 2DHQA 3WB1A 5HWSA 5K3DA 5MF6A 4XM2A 3JYNA 4B34A 4D5EA 4DCNA 2XE7A 2P0AA 4KV9A 2IITA 3CB4A 3C6MA 3DDZX 4ZKEA 1NW3A 4Y67A 2AF3C 1VRVA 2XDYA 1O57A 3LU1A 4N18A 4BJ3A 1XT6A 2QUIA 5KSPA 4DLVA 2G1PA 5T41A 3NUZA 5G3YA 3TIIA 5KYKA 1QKKA 1AUPA 1PL0A 1TKRA 3IA2A 1V1RB 1UBKS 3RAFC 3IPAA 4LYYA 2J87A 2WIKA 5DNEA 3RS0A 2IHBA 4KLAA 3E20A 1K5PA 2XECA 3VC3A 3AF4A 1VCNA 3GZJA 2XUZA 1VIYA 1Z62A 4QJ4A 1P9LA 4NU5A 5HTOA 4RS4A 1DDIA 2HF7A 2AXQA 1H93A 4ZOQI 5L3VA 4CGZA 1U4OA 3BXPA 3EODA 3PUJA 2CCJA 5B2EA 4FFNA 4MVJG 2WAMA 4Q9HA 4ZC8A 1YGPA 1Y1TA 5EFOA 5JWRA 4FBLA 3FUWA 3CT6A 3H2YA 3W8DA 4B8YA 2WRZA 4PC3A 1K5DA 2QRHA 3BFVA 5CEJA 3IP9A 3P96A 4US1R 1QVAA 2HJWA 2OLKA 1Q19A 3MMZA 1J2UA 3DEJA 1CG6A 3EIQA 2R65A 4L5CA 4UCFA 1U4NA 3PPYA 4B43A 2CE7A 2WA1A 3NASA 2FSSA 5G0TA 3UXYA 4D3YA 4HYYA 2HPVA 3SBDA 3ADKA 2BEUB 2VDJA 4ZP1A 2V6BA 1WF6A 2EIXA 2D3NA 1IZ0A 1LSUA 1NW7A 3U7EB 2QRVA 2ZOSA 3GJTA 5KSOA 1KTIA 4HQRA 4CCSA 4AJLA 4CM6A 4F97A 3VZPA 1W47A 1K86A 1OXXK 1VZ2A 4CG3A 2O59A 3Q9SA 4QXOA 1PBNA 4XDHA 1AHPA 4QKQA 1RPNA 4HZIA 2CYCA 1OUMA 2RHMA 4MWZA 4TLDA 4XAQA 5LKRA 4TQ9A 1TTHA 4UREA 3U3ZA 5A0TA 2GZMA 2GBIA 2QX8A 3EVTA 4OK3A 4TS1A 4U9IS 1EUDA 1NSTA 3AP1A 4URZR 4RK0A 3UXMA 3PXCX 3MTDA 4ZV9A 2C4TA 2VHZA 2QTBA 1CZOA 4LC0A 3WP0A 5B6JA 2QUBA 1GRVA 3K4QA 1F4VA 3STVA 3ORSA 5DRTA 1RPAA 3OT4A 4MUNA 3LY9A 3ZYCA 4GIBA 1U81A 3KSRA 3TOXA 3AIOA 2E4UA 3MXOA 2EGUA 3FF1A 3NZEA 5JPIA 2RHLA 3AO0B 1OYWA 4DT1B 4ZJUA 3KAPA 1A2KC 4Y1GA 5K51A 1JF8A 2VDLB 2VOEA 3GT4A 3GUVA 4RPIA 2PZGA 1UOPA 3AFHA 2ZIGA 3KXDA 5D6NA 3VR3D 3OCWA 3V2UA 3PA2A 2QBYA 1X7HA 5AVJA 3UT5B 4PGFA 2FEPA 2BMEA 1IHPA 1TXGA 1YK0A 1IQRA 2GLUA 1BGXT 3CF6R 4ZZ3A 4I55A 4XYLA 3TG2A 5EMKA 1WDWB 1NLZA 3P19A 2IXAA 4TS4A 3ZTWA 4X62B 4PZ9A 1O7JA 3GJSA 2GS9A 2FMHA 1D7AA 1NYLA 3KXLA 1MB4A 1RI5A 4EO7A 1QYDA 1BOOA 4X3OA 2ZDQA 1IN5A 2P1RA 3NEJA 1VFNA 3AHIA 3HWX1 3G79A 2IV2X 4WN9A 4JKYA 1L4UA 2ORWA 4MB2A 4BEWA 2CLCX 1IZZA 4KWEA 5G40A 3ZNPA 2JFGA 3UJPA 1T1RA 3S40A 4OMCA 1DO2A 4RY2A 2NUBA 2DBZA 2BMJA 4J6EA 1QTNA 4IEIA 2RHTA 4TTPA 1CIJA 3K2EA 1M6HA 5LWQA 1YR8A 2CZQA 2M1ZA 2QD5A 1GCGA 1P75A 2F8LA 4LE1A 5LZ2A 4B2IA 1Z0ZA 2NVOA 3NBUA 1RKVA 2WV7A 5L7WA 1GA1A 2EZ9A 2G07A 3I2YX 3AK4A 3IDZA 3H75A 4YHBA 2XVMA 3OQVA 2Q99A 3BCHA 3DGFC 3HUEA 3EVCA 4ZCPA 4M0EA 3IUMA 2ZIUB 3NHZA 4TLCA 1NGSA 3GA0A 1NONA 3IBGA 3AV3A 4RVUA 4YQEA 5I7EA 2PE3A 3DBOB 2BM1A 2VPIA 4PAWA 5TDHA 2BOVA 2H4HA 2IP1A 1I7LA 3GO4A 1ORRA 5G1OA 4MUMA 4MPPA 3GXOA 2A7QA 4G85A 4F9GA 5A5FA 1L8QA 4P3XA 1L5RA 2DWOA 4OQXA 1U8TA 4I2NA 1T2CA 4M98A 2R6DA 4GBMA 2JS7A 2DT8A 3TLKA 4M38A 3U3KA 4TMKA 3ZWVA 1ZD4A 1O2DA 2R6HA 3D26A 1GGHA 2WG2A 4ND6A 4WESB 4BKOA 5FDFA 5A6SB 3DFUA 4QJIA 4Q6BA 4AUKA 2R6GA 1DRUA 4PS1A 4UBIA 2IYOA 1NW9B 3OZ7A 4QYIA 1VYTA 3TKLA 1H65A 2F9FA 1CY2A 3WJ7A 2XUOA 1R0CA 4IO0A 4M0UA 3OKXA 4E1VA 2JJMA 1PZHA 3GFTA 1I7DA 2FR8C 2X22A 3AGQA 1UXJA 4WPGA 3EOZA 4JENA 5DYTA 1A4UA 3TZLA 7AT1A 1J0XO 1MW9X 2YHIA 1CEYA 1TEXA 5BQXA 1TGVA 1C3LA 4QAQA 2R96A 2WM2A 3OHMA 1RTTA 4U3JB 4ZMBA 1V0FA 3QJGA 3H94A 3HKEA 3ZWXA 3CF0A 3I5YA 1GVHA 4EKEA 3MJRA 1GPH1 3HDVA 4UOQA 2ZQZA 1SO8A 4W5RA 1IAVA 3E3AA 4G5YA 1NI3A 2VF8A 1IIBA 1U94A 2I8CA 4B73A 2H2HA 1SKUA 4ZWNA 1CHDA 4II3A 1ONSA 3LCVB 3RSSA 4BE9A 1J1IA 3GRZA 4BUJA 3KJIA 5JSYA 2K4MA 3UIEA 4MYSA 4E2YA 1VA5A 2QEXB 3GAMA 1QTRA 2IODA 1YB5A 4JJAA 1I0LA 3Q9NA 1UXGA 1MB9A 5EZ5A 1UBGA 1JJFA 5KVQA 4JS0A 1XYVA 2MSNA 1M6NA 2ZR8A 2P9QA 3H83A 3NWBA 3QXXA 1AMUA 2P68A 3PDIB 1T26A 4YCSA 2B6NA 1GTMA 3H7AA 4Z99A 1THGA 2R7NA 4OUDA 3Q12A 1JV2B 4MW7A 1N06A 1V6SA 1QG0A 1IDN1 4HDKB 5JBNA 3AHEA 2ZXIA 1N7GA 1SBTA 1NA5A 4ENWA 5B30A 1RC8A 1IL0A 4KBYA 1X94A 4YVFA 5DM1A 4XYGA 1EB9A 1P5RA 2ZJ0A 3D3EA 4D4KA 1K6XA 3GSIA 4J8PA 3LZCA 4QBGB 1Q77A 2TECE 4WBNF 2WHPB 3QPCA 1OWLA 1T34A 5JANA 5MN4A 5EIXA 4QJBA 1KI3A 3IUNA 2F64A 3B85A 1VIDA 2XBLA 2XWQA 2C9ZA 1KRHA 2VK1A 2CUTA 1PYDA 4FMBB 3SY8A 1B0AA 1GGNA 4IPTA 3Q3AA 3U4HA 1NX6A 4E51A 3A2LA 2HEGA 4ZGWA 1BVHA 5JD6A 1VXRA 5F73A 3N39C 4J2HA 4DS3A 1JIKA 3RVRA 3G5LA 3QFFA 2VSXA 4FW8A 4HX9A 5KSWB 3PUKA 1YITB 3EVGA 3FTDA 4F2HA 4TKLA 1C4WA 3ESZA 1E6CA 4N5IX 3L82B 3KRTA 2HA4A 4OYHA 16PKA 5TPWB 4YUWA 4ZGNB 1ZJ5A 5I3ZA 1EVIA 2NGRA 5JD3A 3OQOA 3C0KA 3LC1O 3MCVA 4QTTB 5IHXA 4IG4A 1JWBB 3RSCA 5CEEA 3SLDA 1S4QA 1TB4A 2HJGA 3ETCA 4B9AA 5G4LA 4RZQA 2ALJA 4P9SA 1G1MA 1HO3A 1WXHA 2MSCB 3CFYA 2QDXA 4AVYA 1XZDA 1ZRHA 1DX9A 3D64A 4M1KA 2C8VA 1ZCFA 3K9GA 3OLZA 4JJEA 2PGOA 1QH0A 3DHVA 3AF6A 1QIGA 3X1YA 1AZWA 4LXQA 4GC9A 3QNUA 1KSGA 3ZCPA 4TKVA 4RTLA 1YU6A 1F9AA 3ZIAD 3MTQA 5FEUA 3IP8A 4X1YA 2PX6A 3DULA 3ESXA 3EZYA 2LCIA 4N0PA 3EXHC 4ND8B 3DE6X 5L8VA 5AKLA 1UMDA 3GF4A 4KE9A 1GG8A 3THSA 4TSRA 4FB4A 5CBPB 3CCBA 5B3JA 3K6SA 3TTWA 3VTKA 1XKXA 1A5SB 4M0LA 1PT5A 4MV6A 3GZNB 3A0UA 4O0LA 2NVWA 2HLDA 1P91A 3PQ2A 2X9QA 1M9NA 4Y6QA 5AK0A 4M1OA 5J5VA 1NP3A 5BPFA 4Q12A 2ZZKA 4EHFA 2HTFA 1DBIA 3D4NA 3E2PA 1KC1A 2ZRAA 2Z1DA 2Q62A 4OOVA 3N2GA 5LA6B 4ZQIA 4J29A 4QRDA 4MQBA 2PRZA 4K1XA 1C2YA 1PT6A 1G60A 2GQ0A 4Q3KA 1V9SA 3KTAA 3OPOA 2D7CA 3A8IA 3UN1A 1EG2A 1SHZA 2OEPA 2QAGB 1EP9A 3HV0A 5KNCD 4JXXA 2II6A 2PH3A 4U8HA 4FGWA 4W5WA 3I12A 4WACA 3A3GA 2C8LA 5IHPA 3OHSX 4D4MA 2B8TA 1AKWA 2PS1A 3N2ZB 5ENVA 4PCVA 5DTIA 3MJFA 4NXMB 3QUSA 4KXYA 1GTSA 4TYQA 4BXOA 2HIMA 1T2FA 4GPIB 4FE3A 2HA6A 1DC3A 5IJAA 1V3UA 5LOVF 1F51E 3AR6A 4I6EA 4MP3A 4ZGGA 2E6KA 3ANTA 2AFIA 2EQAA 1JJ7A 3AKDA 5DBGA 5HOEA 5K0CA 1IPEA 1V35A 1KZHA 2RGAA 4M1TA 3RBXA 1IM5A 2QZ9A 3KJGA 3C8MA 5LNK1 1R66A 1ZH6A 5EJ7A 2IDKA 2JHGA 2NNLD 3I6IA 3TSWA 3RTBA 4QL3A 3ZY6A 5B57C 3IHLA 4RTQA 2NG1A 5H83A 4TZTA 3H8VA 1B43A 1JSZA 1Y1PA 2X85A 2PD3A 1GEGA 2PAAA 2OB2A 2CMGA 3WJ1A 2YBDA 2R8ZA 4WZBE 1DDGA 3Q2KA 1EINA 1R0SA 1J2TA 1OROA 1JLSA 2XMZA 3D6NB 4NZYA 5J59A 4AM8A 1K98A 5K8IA 5F4JA 5EZYF 1K0FA 1FNNA 3PPVA 4C2BA 2CXQA 4NCXA 4HNUA 5F3WB 2WMDA 3ZD7A 3PL1A 1OCEA 1VQNB 1UP4A 2XDAA 1WPXA 2DJ5A 2HMAA 4XONA 4KRFA 4RZUA 1TECE 3PNSA 1HYBA 5DIZA 1Q1GA 3K2QA 3RF7A 2CMKA 3I6YA 1NY5A 4ES6A 4BEVA 1YMQA 1OFGA 1TMGE 4JDPA 1R6AA 4EW2A 3GNTA 1E2PA 5J23A 5ED4A 3WKBA 3LLUA 5CXQA 1SIBE 4XSHA 3AU9A 1ZVVA 2IYEA 4MW6A 1OIVA 3MQFA 3WO1A 3T56B 4OXRA 4QEZA 4DZZA 1JHDA 4OHPA 3TXXA 1QB8A 3CCJB 2IH4A 4FFRA 1RVV1 4WXMA 3RFCA 3SQXA 1VMEA 2QGZA 2UZ0A 4Y6OA 4XUGB 4QE3A 1YFZA 2GRAA 2V6MA 1Y3IA 9ABPA 3K8OE 4F21A 3NP9A 5DTEA 2IZ5A 3VYRB 1D4FA 2W7TA 3EC2A 4TM8A 4Z7JA 3L93A 1W0CA 3IJEB 4Z8YA 3C98A 5C18A 4QQNA 3N8IA 2WYRA 2H06A 1HLDA 5A9RA 2OBNA 5CH3A 1NKVA 3JQAD 4V03A 2XI4A 3BPSA 3Q40A 5LUAA 1N0IA 2VBCA 2B9VA 1XNRB 2A1UA 2ZDHA 4HWGA 2ZUCA 1EIWA 2V7GA 4S2UA 3PUMA 1QNFA 2FFQA 4BNGA 4D5GA 4Z4QA 5IUKC 1RI4A 1N9GB 2I1QA 3ZV3A 1D0VA 2J31A 1DRWA 3FNQA 1R18A 4OP2A 4RHYA 2C0PA 2WY2D 1HUQA 1A8QA 2GSWA 2CF5A 1JBEA 2VPWA 1E2JA 3M1AA 4Q3LA 4EEXA 3WYNA 4DRXB 5EMMA 2IW1A 1XXLA 2QTFA 3UJBA 1KTVA 3F74A 3OESA 3OT5A 5HS4A 3T3NA 3A8JA 4B31A 2FXVA 1P6XA 5C7OO 5J1SB 3O3OB 4DMCA 3FLEA 3V4LA 4V0RA 3QELA 4EELA 2A57A 3FZEA 2IU4A 1BVYF 2V4ZA 5JS7A 1SOWA 1KMIY 1DQNA 1ZU5A 4KX5A 4F93B 3PQFA 3CG0A 1F2TA 1E1CA 3GJ3A 1PQPA 2OSBA 4GM4A 4JB0A 3OM1A 4AJ9A 1F3OA 1JU9A 4RFSA 4EVIA 1T9AA 2IWRA 2I2WA 1UEXC 2Q4TA 4G2TA 3ONYA 1Z2PX 2QI9C 1Q9SA 4NCIA 3MILA 4ZT6A 4KKSA 1DC7A 3L9WA 5CU7A 1MRZA 1QRDA 1DIHA 3NC4A 1XJ5A 3OU2A 3ZWKA 4H6PA 4KQJA 5IH7A 4JI0B 1SCUB 1V5EA 4H7IA 2GXSA 3D4BA 1ZSYA 4PZ0A 1ZH2A 1K28D 4P22A 1RLMA 1JSLA 1XWIA 2E4ZA 2R2GA 1KFEB 3JQGA 3KKLA 3NOOA 4P80A 4WLOA 5F3RA 1M0EA 3OE7A 1OLOA 2CB0A 3R6KA 3BDVA 3GYBA 3U3DA 1W49A 2IUYA 3FOBA 3CESA 2VJLA 4TKMA 3BK2A 4CJXA 1FJXA 1ZLXA 3R3ZA 3MS4A 4BNMA 4AJIA 3GFPA 3I61A 4UEJA 1AS3A 4TYWA 1FYWA 3IMGA 3TGWA 4KO2S 4ZHQB 3STTA 4F06A 1E63A 1QYXA 1U11A 3FTCA 5A4AA 5HZKA 4MW1A 1FA9A 2OBTA 1R7RA 5EP2A 2V5VA 3S5JA 3FVQA 1F8GA 3NBXX 4GKKB 3I5AA 1XV5A 1ULHA 1JXOA 1Y8AA 4IF4A 1HZZA 2I76A 1U1FA 5BN4B 1H1TA 3ZD8A 5KHOC 1NKTA 1EFVB 1NIPA 5L3QA 1FSFA 2BMFA 4I6JA 2HHCA 4NL4H 1S1CA 4QULA 4YHHB 1GG5A 1RYBA 1I1HA 3IPCA 3D7LA 3VU9B 3JVVA 3HJTA 5ILOA 2YUTA 4IF6A 3WDLA 3A8KA 1FQOA 1NQUA 1GR1A 3HPQA 4LQLA 3THXA 1AXEA 2QG6A 3EFOA 1XNGA 1EP1B 2CLEB 1K92A 5JI2E 5BWCA 2RGGA 4UVDA 3MJCA 1WXDA 3O8QA 5LU9A 1DINA 2R7LA 3F7NA 3WIBA 3HZRA 1ISJA 3ZBTA 5TV2A 4LN1A 3T1TA 1HDOA 1CSEE 1HGXA 2ZRHA 3D7NA 1T8SA 3GBVA 2PZFA 3RUCA 2A14A 2X4GA 3A3PA 3SIPA 2R5NA 2JFZA 2YCLA 4GE0A 3QPVA 5T4HA 5LKAA 3PXBA 2YFQA 4CMHA 1KIAA 1ZNXA 1LZKA 1QH8B 1E1QA 1U0OC 2Q2QA 5F7ZA 4ZYUA 3L1JA 1PR6A 3FROA 3G1TA 3PG5A 1J90A 1LF0A 2OZKA 5LZ5A 2VJPA 2GRJA 2CDRA 2AOXA 4EB6A 2IEZA 2NX2A 1L7QA 1BX0A 2QRGA 4K7JA 1H2WA 4KVFA 4X7MA 1T3HA 2VH1A 4CEJA 2O8FB 3KSMA 3RNLA 1IOVA 2VP6A 1TJNA 4RY9A 3SEAA 2IDMA 2QDKA 3QPBA 3LJKA 4OU5A 4XJVA 4AG5A 2XV1A 3BJMA 4F8JA 4L5YA 3RROA 2ZB3A 5HJ5A 4JODA 5JDCA 4QQKA 3N5KA 4TT8A 2OILA 5EC8A 1L3BA 4EECA 4NBWA 3CP8A 4HGQA 1W5BA 4E22A 2E2WA 4P5PA 3LIIA 2BGGA 1IN6A 3EZ2A 3IP5A 3PQ4A 5D3ZA 1Y8RA 5EVCA 4CQMA 4DSZA 1YACA 3JZAA 4HEA1 4EO4A 3H3FA 4K0RA 1PO7A 4P1ZA 1YUMA 2RC5A 2GPSA 2R1VA 5JZ9A 3ND9A 1WP4A 1TT5A 2ANCA 4U0JA 1N2ZA 2ZYDA 4YJ3F 3SSAA 4LRXA 4Y0NA 5CDFA 4MLZA 4DLWA 2R68A 1TJ5A 1X7WB 3A1EA 4XZ3A 2IU0A 4OQNA 3TZBA 4EY7A 4GSLA 4MP8A 1WOMA 4KAJA 5BOSA 1Z45A 3INRA 4A73A 4X8LA 5CX4A 1GZ3A 3EJWA 5CRIA 2WKWA 4E94A 4BO8A 1G8FA 1NYRA 4Q37A 1XZEA 2JLCA 1NN5A 2NSDA 2ODNA 3A4TA 3T0GA 1P9NA 5JZVA 3VTAA 2ETXA 3QVKA 1Z25A 4JQZA 4OHOA 2C7RA 3HZOA 4DYVA 1T36B 4OHVA 5DHUA 3G9ZA 1BEEA 3UOAB 4DQKA 3O26A 2IKQA 2YOHA 2Q7OE 3WGYA 2GXUA 4CKCA 1PN3A 4O5OA 1Y8QB 3IS3A 3QE4A 4LVNA 2OCYC 1IC6A 2QJRA 3L1VA 5F7JA 5AW5A 4ZVRA 5EHIA 5D5PA 3J7TA 3PQ6A 5KWJA 2I5PO 2NU6A 1RZRD 1N8SA 2MWMA 5IK2D 5IM5A 4F9FA 1U2DC 5AUPB 2C31A 2RONA 5T5QA 5JYEA 1C1XA 2WVJA 1A2QA 1QAOA 2JDIA 1PJBA 2X4IA 2Y2VA 3KK0A 3O94A 3O8DA 2PH1A 4O4JA 4DY6A 2H4WA 1KYTA 1EHYA 4AP9A 1USGA 1Z6XA 2JGJA 2VJBA 3SE7A 1IZ7A 5C5EA 1GPDG 2EW1A 3OD5A 1U2DA 1KHHA 1QVZA 4OAOA 1JSXA 1Z37A 2H9IA 1WOOA 4NARA 1EYZA 4UUBA 3NT4A 2OYCA 1PW7A 2FLKA 1BE8A 4ZDJA 2J33A 1USUA 2Y1WA 5IXYA 1ZQ9A 2REXB 4JBGA 4KVAA 1KPHA 2JANA 3PRYA 2P5TB 5HGXA 5HRCA 4XOTA 1DC5A 1H2HA 3A9UA 2D3WA 1LB1B 3OPYB 2LZJA 4GR9A 3GVIA 2GM9A 2PH7A 1FNMA 4UZFA 1KMHB 1DKUA 3JWGA 3OEED 4PTZA 4WECA 1SHJA 3FZQA 3ND8A 1KVUA 4BTLA 3LGAA 4MOWA 2R7MA 3NW9A 5A06A 5ITSA 1D4OA 2DPGA 4ZPXA 4IO1A 4QOIA 2FR1A 2GWHA 2ZWVA 1OLUB 2O4UX 2RHHA 1GUFA 3DV0A 1JFVA 1NN3A 4IJKA 4FI3F 4P4TA 4CCYB 1J39A 1USVA 2BR5A 2DAPA 2FZEA 1GKLA 3DDHA 4S2EA 1ILEA 1G291 1NMZA 1NUQA 1SWVA 1ZNYA 4U5XA 5DNVA 4RK4A 5B6IA 3AJDA 3OMXA 1SXQA 2X5XA 3LSTA 1Z29A 3PPIA 1GYPA 1QGOA 3V97A 4KLCA 1AN9A 4AICA 4FXUA 4YYEA 4E4TA 4QYWA 4CEHA 2WF9A 3MAJA 3DTVD 1JDUA 3PFGA 2VJDA 4YFYA 4F1WA 3C24A 3PR3A 1A4RA 2BMAA 3OQBA 2IE8A 2EJTA 4GGMX 1HTBA 2W2KB 3DW3X 4HB4A 4Q4CA 1H8ED 2DEUA 1EAYA 3FM9A 3GEBA 3FD8A 4NS4A 1VMAA 2AZDA 4OHBA 4R9RA 4G97A 1DU4A 3WRYA 5LQUA 3QXCA 3VGJA 1VLOA 3KT3A 1MAVA 3W3AD 1I6MA 3L8EA 2YWGA 4HADA 4QC2A 1DXHA 4CLOB 1EFPB 1K8XB 4HDRB 1ZD1A 3GJ5A 4U2EA 2QVBA 5B1DA 5CURA 1WXWA 3EMVA 5B1HA 2WT4A 3K4HA 4EG6A 3MJSA 4IQ8A 4Y2UA 4ZANA 4EY3A 3U49A 3JQBA 3GLVA 2IHYA 3OU7A 2J67A 2G9NA 1B1CA 3I9V1 5A0VA 2YMLA 3TMYA 1FNDA 3CNBA 1NFQA 3CX6A 3IR5A 3L7NA 7GPBA 3SJBA 3IEIA 3AHHA 1JS1X 4WKGA 1FC0A 3X2SA 1KEVA 4PC1A 2CLFB 1JL3A 4WLVA 1A9SA 5LNK6 2HBYA 5H02A 4LWZA 1FEZA 3B3FA 3MBKA 1AQIA 1VL6A 3FBWA 3TD6A 3STUA 3AUSA 2TMYA 4U7JA 3AF3A 5LYYA 1TVKB 2OLJA 2PUBA 4WBNA 1L5FA 4AXXA 5IAEA 5M29A 2XEXA 2VJIA 3LUPA 4YP6A 1E0AA 1KQPA 3DEKA 1H4SA 4HD8A 1YZQA 2CT8A 1RJ9B 1XJWA 4GOMD 3CUYA 4AMUA 1FXUA 2M6RA 4IRUB 1X7ZA 3AOGA 4MINA 4XLFA 2VTBB 3IVAA 2ZPAA 1ZL2A 3CMCO 3FYDA 4IV8A 2D3LA 3ASRA 3OKFA 3IL2A 1LPBB 1VJRA 2ODEA 2FWRA 4WKBA 4R2KA 5E6UB 1P1BA 3U80A 3FCSB 3RSGA 3M6XA 1QANA 5LJIA 4TZ6A 1ABBA 1HEYA 2HPAA 2MU1A 2P78A 2V5AA 4S24A 1NR1A 2M2IA 2YCBA 1H3EA 1CIVA 1GPLA 2Q1WA 4YAWA 1Q84A 2VCEA 2ZRLA 2G0AA 3MUOA 3BH0A 3FBGA 3ORHA 2FX2A 1IFXA 4GZ3A 5I8WA 2R4UA 3H0KA 3EQ9A 4RSRA 4EG0A 4PLFA 1JR6A 1XD8A 2J3EA 1D6SA 3IKVA 1W5EA 1A9ZA 4UXIA 3KZMA 5B1YA 2F9LA 1P18A 1ZDMA 1R27A 4XW2A 5H1YA 4WOPA 1ST2A 1UK6A 4AB1A 1PR0A 1STOA 1M34A 1ZCJA 3KSUA 2XGJA 1G6OA 2XPCA 4BLTA 4MV7A 2GK4A 4PGGA 4TLBA 2HJ9A 1WHSB 4K9RA 1LZLA 3I52A 3R44A 4GMKA 4QODA 2ZSIA 4B3GA 3G8DA 4KXMA 4ZV7A 2WHPA 1PZFA 1AF7A 3DF7A 3R76A 1EX6A 1W0KA 4BNNA 1TU0A 4MI3A 1CP2A 2ZAGA 3W79A 2GNAA 1KA9H 3T5MA 5F1KA 1OBCA 4OI2A 2J3LA 3PVZA 3TTSA 1YS1X 5B7QA 4R2WA 1H1DA 1BE6A 221PA 3AKEA 4EABA 9LDBA 3DZFA 4WFQA 5KU1A 2IIVA 3RO7A 2NUTB 3FYTA 4KWIA 2IU6A 4BX0A 5BV1A 1YE5A 3KX2A 2UYHA 3GN1A 5IVKA 2AN5A 3ACCA 2HF9A 5EHNA 4BBPA 3PNLA 4CYMA 1ADYA 3RYCB 4YNBA 4ARIA 2MHCA 4FQ8A 4BIMA 3IO3A 4ETNA 1DAEA 3G17A 3ZDXB 2HAEA 3LLSA 3HR4A 3MUFA 1XA3A 1L5MA 2EJWA 2Y4NA 4JITA 1Z0IA 1U1IA 3TW0A 1NW4A 1WMEA 1YDHA 5LMNB 4O3FA 3ZV7A 3HKDB 4GMFA 5JAPA 1MKYA 1YCGA 4B7CA 1RYFA 1EFRD 1X38A 1QFYA 2I1VB 4JVNA 1J33A 4JUBA 3KSAC 1WPGA 3C4VA 3FAKA 3ONWA 3ROFA 1HRKA 3LC2O 2C2YA 3BL8A 3HN6A 4D1YA 3WRXC 3OZSA 4Z4GA 4N3NA 2C57A 1QCZA 3PDIA 4X7BA 1ZGAA 1XGKA 1CZUA 5K3SA 1Z4PX 3KZXA 1C1YA 1Q0LA 5H0IA 2Q2WA 1U8ZA 2EATA 2E48A 2YVQA 4CDNA 1WR8A 3RYHA 2Y0BA 3HCBA 3NKVA 4CG1A 2TS1A 3OE5A 4WY8A 1XRNA 2Y1CA 3KC2A 4N5HX 4QU5A 1GGJA 2AYYA 3T3GA 5B37A 3S81A 4E7PA 3WGTA 1ATZA 4BYMA 4DARA 4WLFA 2W00A 2WVGA 4C07A 2CVPA 5JD4A 1GEEA 3WAGA 3K7EA 3FH0A 1NJ5A 3DPSA 4C0QC 2AHRA 3ORRA 3GT3A 2FY8A 1M7BA 1P29A 5COQA 1MQSA 3CO0S 3IKMB 1PR3A 4IP0A 3VJLA 1HT0A 1L7MA 2WVAA 1NNLA 1E66A 1UJ4A 3DXXA 3EUFA 4BLRA 3GLFA 1KDYA 1YRWA 3GRRA 2HWKA 1KMNA 4L5IA 4ESEA 4B3SB 4AZWA 5I7FA 2IZ1A 5I51A 4N49A 5GINE 2A88A 1E43A 1KI2A 4LF4B 1LX6A 2HJHA 3DHYA 3PGMA 4NPAA 4YRPA 3SE0A 3ZH9B 4B81A 3P2IA 5KSYA 1OYYA 1IHOA 4WRRA 3PEEA 4HY3A 4WCDA 3G49A 1M8JA 2XCLA 1YBVA 1PNVA 2OCKA 1JG7A 3QBVA 3W8FA 3LUKA 2YWXA 1E5VA 4AF7A 3PRHA 1WY7A 4FEGA 3ZEAA 3BBPA 4AZTA 2CD7A 4JV5B 2R8OA 5DPMA 4ZVUA 4HVTA 2FFAA 5FLEX 1Y7PA 1T5SA 1AXGA 1UBCA 1XPRA 2B99A 1L8OA 3KD3A 5ALVA 5IAGA 1XU7A 2C5LA 2C4NA 2J48A 4M88A 3RV3A 4R2JA 2XQIA 3I9LA 2DH6A 1PWYE 2BE9A 3T54A 4NJOA 1LS6A 1MORA 2HV9A 5AW0A 3ZHYA 2DR2A 2WZCA 2WU4A 1GN8A 3N0VA 1CUWA 1EDZA 3DR3A 1JNXX 4HH3C 4PX5A 1PK7A 1CJSA 1UDRA 2J3JA 4H2DA 2HV8A 4GKBA 3HDJA 4XR9A 1FK8A 3DBHB 1R4AA 3OM0A 4QSHA 1UAGA 5KJEA 3SZMA 5A2QA 1FJ2A 1ORTA 2PZEA 3IT0A 3M1YA 2ATXA 1NOKA 3CCVB 4KACA 4JIGA 3C3JA 4BYGA 5P21A 2OYRA 2K7ZA 4C9BA 3MMSA 4B75A 2MR6A 1ULAA 2ORVA 2QMQA 4F5WA 1TCAA 2PHZA 3F71A 4JOCA 3BJZA 1LPOA 2FN8A 2FW0A 4R8LA 4XM3A 1LNSA 2JGKA 4XNFA 3L06A 4HQLA 2PRIA 4BHTA 2J3MA 1C4OA 2FEMA 4YRSA 3NYRA 2WU3A 1XEWX 1DFGA 4MHTA 2BEVA 1E0SA 1CB7A 1GO2A 2VNJA 1OFVA 2FZ5A 1ZU4A 4OQFA 3WS7A 3ZJUA 1Z22A 4O2AB 3D5TA 4B40A 3HNOA 4DR5B 1F2UB 3QK7A 3DTVA 2Z5GA 4AX8A 4LYHA 3HUFA 3T4PA 4RIIA 3ZW7A 1CJCA 3V00A 1Z38A 2EEPA 1EBUA 1U3UA 4BQOA 4QXAA 1PDWA 2PZKA 2RGYA 3SF0A 3KR0A 2BLNA 3R40A 4EEKA 5J35A 3D6JA 4MS3A 4H31A 3G5AA 3SDBA 2PIDA 1W36C 1ZXBA 3U3XA 1P1CA 1OX5A 1QRAA 5IZCA 3QNMA 1W36D 4JI8B 3QE9Y 1C7ZA 1TKAA 4JP1A 1CLEA 3AI7A 2F90A 4KO8A 3FGZA 4PRZA 4G0QA 3BCDA 3TR6A 4HLDA 4GRAA 2OMKA 5FBHA 4JYBA 1RYNA 2D1TA 4LSZA 3NT2A 3U9LA 2J5BA 4PNZA 3H5IA 1RWKA 1XZAA 2C2BA 1F8YA 3CZCA 3K20A 4KN5A 5CDSA 3CVVA 4WZLA 4KFTA 2FR0A 2IXBA 2XT6A 5AKEA 5E6RA 2HK6A 2ZS8A 4JX9A 5CAEB 2BP7A 3PP8A 4EF4A 2JLXA 2PT5A 3TIGA 1QE0A 2W4IA 3VPHA 4XIFA 2OG2A 2XMGA 4NP6A 5HJ2A 1Q3TA 1PGQA 3F3MA 1U5AA 1X80B 2LGJA 1IM2A 3ONFA 3Q7RA 5CFNA 1L4NA 2D2VA 2VSFA 1LRKA 4FQ7A 4YMTA 5I47A 4OPVA 1EZZA 4LCJA 3UGTA 1W1IA 1KFJB 4PYKA 4J0GA 5HSGA 2G71A 2OGSA 4WOJA 5AJWA 5JR3A 1DCTA 1KKLA 3JZFA 3SFTA 3WYAA 4OP7A 5H3CA 3UATA 1CB0A 3IDOA 1YI1A 1T9HA 2G5CA 5DI3A 3CYFA 3B70A 3PYXA 1EH5A 1XHFA 1RACA 3IPXA 1UPFA 1I7QB 5AHKA 4OM7A 1ND6A 4YQYA 3KVNA 4PANA 4BO9A 1ODJA 2WF8A 2O8DA 2C2XA 4IVRA 3ZCXA 1LV7A 3SIRA 1RLUA 2P40A 4B0PA 2BP7B 5AKJA 3ZWQA 3DMDA 4QDKA 5DCLA 5ANRB 1SCIA 4MAMA 2DFTA 3K0CA 3NTOA 2ID7A 2H7XA 4PO1A 2WD8A 3K70C 4ZIRA 4BX2A 4P7FA 3VDMA 1Z2NX 3JSXA 3VU8A 5K6RA 1JNYA 4ZYVA 4IGIA 2PTHA 4BNDB 5TVGA 2HDNB 4MQ6A 2XJ9A 4PY2A 5JT1A 1RNLA 4IGEA 2ISSD 4A03A 3VZDA 3K6JA 5CXXA 4DNOA 4FIZA 4UUOA 3HKBB 3Q0IA 4DN6A 4FNGA 3HJHA 4Z9FA 3YASA 1QFZA 2YJ5A 3MJEA 3CF2A 5C1DA 1GXSA 1PNTA 2G4LA 3KO8A 3CX7A 3DMPA 4FFWA 4OLFA 5JTUA 2PUCA 3AC0A 1RM3A 2D2IA 2XMRA 3CEHA 3GUHA 4H4CA 4ZT2A 2X8JB 3PYMA 5GY7A 5JY1A 4WH0A 2IPOA 3OFSA 4FTWA 4LCEA 3GLFE 2G40A 2O9JA 3BFPA 2LKDA 1A8HA 2VIIA 1N9GA 1LLCA 2AEMA 3WBKA 1CFZA 1D6NA 5FO1A 3P4UA 4HUQB 4Z86A 3LUAA 3EIFA 3QTTA 4LJ5A 5JZBA 1ZONA 2HSEA 4PM4A 3T5GA 2PFKA 4JB8A 4BBAA 5A3RA 1SBYA 3KLPX 4BASA 1C1HA 2C2HA 5JDIA 5JOQA 1KAGA 2BRUA 3CKLA 2OCDA 4LXYA 2Q41A 5KDDA 3ZDAA 4J4BA 3UXHA 1Z4KA 1CUZA 3TSCA 2R47A 2YASA 4MGYR 3FCYA 3AFIA 3V9AA 1D2GA 2GSDA 2H9YA 2Y9MB 4CM4A 3THXB 1ZIDA 4D9KA 1R9JA 1E58A 1GCAA 1F6DA 2BFWA 1GKUB 3SJ7A 4NZMA 3AOEC 4AKGA 2WSYB 3G2PA 1GNSA 5JPDA 3MRXA 3C87A 1D0SA 1A97A 3L01A 4HG2A 1Y3BE 1VP9A 2EKLA 3P0HA 5IJ0B 2XJ4A 2WIDA 2X1LA 3PGLA 3NHKA 2KS6A 1E9SA 1GGKA 2NVUA 2R86A 4CDGA 4HLUA 3G1WA 5ELLA 5C7IO 3Q0EA 3VO8A 5CCDA 1U7UA 1YBFA 5EXTA 2PAFA 1NVKA 1Z6YA 5F1YA 4M86A 5CJPA 5K01A 5LQNA 1YJCA 3MXTA 4UPDA 2WWVD 3ASPA 1KOFA 2PNJA 1DPGA 3D2LA 2LTAA 1D9ZA 1GPBA 2HD4A 3NUQA 3OWOA 1DCKA 4DE5A 1F7UA 2QE7A 1LX7A 2X9GA 3NVDA 1B6GA 2Z0MA 4JLPA 2O2HA 3WA7A 2C5SA 5B1SA 3WE7A 4XUCA 1L5HB 2WUEA 1K9MD 1Q1QA 5I9NA 2I6UA 2VTEA 4QG3A 1UIRA 4WIAA 4LDZA 4Q7EA 1WX1A 3IAHA 3D2CA 4Q5IA 4C6SA 4RDLA 3QFSA 1HM5A 2O2ZA 5ADWA 3UPUA 3NHSA 2F48A 4FGJA 1IOLA 3GMIA 3LIPA 5C34B 5JZOA 3OPYI 1U7DA 3B82A 4G0PA 2P8JA 1U4SA 3AUYA 3D6VA 3T61A 4GLOA 2O8BA 3NHAA 2NO4A 1QWSA 3OZGA 5ALKA 2F1HA 2F67A 4D8VA 3C7DB 1MO6A 3GNQA 4FDTA 5GVSA 3A9VA 3ONEA 8MHTA 1MN6A 2W98A 4JA2A 1OB0A 1IZ8A 4RLHA 3CR7A 4C2AA 4A6DA 3HCCA 1Q7YD 2WJ6A 4S1WA 4MW9A 2H1RA 4GM1A 5E4JA 4AS3A 4DJ5X 3C8HA 1E77A 4ID9A 1EFKA 3DLTA 1C9JA 4J0JA 2Q0XA 4B48A 4J9UE 3O8QB 4PYMA 4WV3A 1RWPA 4TUYB 3PKJA 3T6KA 4GS5A 3Q1KA 3TO5A 1APBA 2O07A 2PO5A 3BEOA 1W5AA 2I2FA 1Y33E 2DBQA 4J1TA 4TTJA 2O20A 1UBHS 3UK7A 3LO8A 1A04A 1IRXA 1KO1A 3N7AA 4DXAA 4NZ9A 5KQSA 3I83A 5LQKA 3BGIA 3KQTA 3HRHA 2G5TA 4BZQA 3U37A 3HL4A 3EIHA 4CQLA 4UAJA 2VC2B 4YJ2B 1SFRA 3PEVA 4QTYA 2GYVA 3MWEB 5JJCA 5KYUB 1DWUA 1T9BA 4C3UA 3VX4A 4ENRA 1H0RA 2HZBA 3FFXA 1EX1A 2LRHA 1ZC3A 1B73A 3FYHA 2DFLA 5EJAA 3LPDA 1YTLA 5KNLA 4JJ8A 2X77A 4MJ3A 4YRLA 2QL6A 3E9NA 2GZHA 2QLBA 3EVNA 2J3QA 1WMSA 1B15A 1ZOOA 5CA0A 4CNQA 3ZVMA 2B21A 5IKXA 1JLLA 1U2EA 3ANNA 1RJEA 4PZZA 5FWXA 2L82A 1E5LA 3OZCA 5M3BA 5U4QA 1T3LA 3NRCA 4Q34A 3TIVA 6CHYA 4V1CA 1Q5PA 1Z06A 4C6HA 4QRHA 1I2DA 2PFSA 3PGKA 4DABA 2C04A 4E30A 6ABPA 3E18A 3BN3A 2UZAA 3D5QA 5JQGF 3PK0A 3RHSA 3SLKA 1N5RA 5KYUA 4U2BA 4D6YA 1HE4A 1EHIA 3AQIA 4OJKA 3NC1C 4F5EA 2AKEA 4WSOA 3LBAA 3KB8A 3P8ZA 1DKQA 1KMHA 2NPIA 3NUGA 4O0MA 5G53C 1UFVA 3JZMA 1MRNA 2BDTA 3B3GA 4PLPA 3FPFA 1X7WA 3LLVA 1FFYA 3FPPA 1OW3B 5I9SA 4FNMA 3QLVC 3ZVRA 3CBQA 2BM8A 1NLYA 2B35A 3DL0A 2WB2A 3NH9A 3MHTA 1W4RA 2P2SA 4U0KA 5TJHA 1SB8A 4ARCA 3HM2A 3A1TA 1YVRA 4MEJA 4JWKA 2C7OA 7MHTA 5JECA 3KV1A 2JK1A 3SJUA 3BG5A 4LZAA 2VHCA 3KB1A 5J2UB 5JU6A 1T36A 4OHZA 2D5IA 2HGSA 1DQSA 3ABQB 4L85A 5A3SA 4U7FA 1MTZA 1S3GA 1E3MA 3QLVA 1QGAA 3EY4A 3R09A 4KE8A 4P4LA 3CQ9A 1MC4A 3KOXA 4KIWA 3LVRE 4HVLA 2NUAB 2F1MA 4Z1MA 2CFRA 1EXVA 2BD0A 2BHRA 3GLHE 4Q01A 4EPTA 3Q9LA 1MOSA 2HOQA 2WA2A 5FT9A 1SKBA 3AG5A 5EJ5A 1VPVA 1YA8A 4OHKA 4Z4YA 5KYVA 2OQRA 1O97C 2YXDA 3INYA 1UZNA 2C96A 4JLKA 4ND7A 1ZS9A 5LYJA 2IYAA 4DUGA 4KPYA 1NJ8A 2CDBA 1LJ8A 2CVZA 4BEBA 3L8HA 5IDWA 3T06B 5K4HA 2YWRA 4NFLA 3KVRA 4LTDA 4B6QA 2CNWD 2Y0PA 2BMWA 1SD2A 1ZEJA 5C4GB 1XELA 3AR9A 4W5TA 2POCA 2HRBA 2GHIA 1UEJA 2WPNA 1SVLA 1B8OA 1DZ3A 4HLCA 5CFRA 4I1IA 4BNLA 4CR7A 4M7WA 2PY6A 2GCIA 4RDIA 2VF5X 5L51A 2CJPA 1NL3A 2ILTA 3E9EA 2XZTA 4I4LA 1JQ3A 4HDSA 4DCPA 1XZQA 3O1IC 4NJMA 4PONA 1LPAB 5T6BA 5CLJA 1L5OA 4QQRA 1P74A 4IOKA 1FB5A 1U5BA 4N3BA 3HCWA 4R98A 1QIDA 3D2BA 4XRRA 4ESVA 1EMDA 5EL0A 2BUBA 1ZWKA 1FPMA 1M72A 1R64A 1QVWA 2DKNA 3AXTA 3SZRA 1J99A 1A9YA 3QTBA 4IILA 1ETHA 2PQMA 4HPXB 3A3BA 2BF4A 4OLJA 4KDEA 1PTKA 3SS9X 3TRHA 4D96A 2CWDA 2AE1A 2WUGA 4HAWA 5ERXA 4HIZA 4RPCA 2CXTA 3ELUA 3FPEA 1V7PC 3OBBA 2GK6A 1JFFB 1BEUB 2ADMA 2XNDA 1YQXA 1OZAA 2FPGB 2NUPB 3NC0C 4QICA 5AKXA 1SIWA 5C2JB 1A82A 2VN8A 1V5IA 4RX1A 1ZA2A 4B87A 4AAYA 2OD7A 1OPRA 4OFBA 1EGAA 4MDFA 4R3WA 4GG1A 1ZI8A 3U13A 1Q0QA 4KLZA 4M99A 2ZU6A 1YUNA 2ONCA 3W77A 4CIXA 4MVJP 4JZYA 1W52X 3F96A 3DHEA 4M60A 5AKIA 4D0SA 1G8MA 2OCBA 1K3UB 1H9BA 1D04A 2B83A 2HSJA 3P0JA 4WHMA 3I2IA 4H4DA 4P58A 4JIMA 5SICE 1JA0A 5EHZA 3GLGE 4OPOA 4ZK6A 5IT5A 4XA8A 3GH3A 4X20B 1P4RA 4KODA 3D7KA 2X3UA 1IRIA