2I1LA

Crystal structure of the c2 form of fad synthetase from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
289
structure length
267
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Riboflavin kinase/FMN adenylyltransferase
total genus 62
structure length 267
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2i1lA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2i1lA01
2VBSA 1VBKA 3AFHA 4JZYA 4OUDA 4ARCA 1F4LA 2A1TR 3MLAA 5DEOA 3G6KA 4HJRA 2DERA 4EG3A 3QE4A 1YIDA 3ZJTA 4G5FA 3NBAA 1QRUA 1BS2A 2J5BA 3AG5A 3COVA 3QTTA 3C8ZA 4MUFA 3DV2A 5K0TA 4JYZA 1QTQA 3FDXA 1JIKA 1RQGA 3LE8A 4F3RA 1GN8A 2E0IA 3FWKA 4YP5A 1WXHA 3Q12A 2Z09A 2A86A 2X3FA 1N08A 1LI5A 2QTNA 2D54A 4JXZA 1NP7A 4HPWA 4MW2A 4Q93A 1JHDA 1OWMA 4QREA 4ZT3A 4U8HA 4KR6A 1QRSA 1F9AA 1HYBA 2TS1A 1P4MA 2QUKA 2D13A 2A1UA 1OBHA 1TEZA 4DE5A 2H29A 4NATA 1MRZA 1J1ZA 1N2BA 4A91A 3IVXA 2GKSA 3TQOA 3HFJA 2IELA 1O94D 2X1MA 1COZA 1O97D 4NX2A 5TGTA 4ND6A 1WXGA 4KR9A 1DNPA 3H9BA 4MUJA 4P2BA 1B6TA 4R0NA 1GTSA 5DASA 1G59A 1J09A 4MW0A 1FFYA 1EFPB 3AG6A 4BWVA 4MW7A 1CT9A 4ZCPA 1WXEA 2PXHA 3CLUD 3FH0A 4ZT5A 4EGAA 1G8GA 3D6UA 3GMIA 1IQRA 3H05A 1IH8A 3SYTA 2V0GA 2O8VA 5DB4A 3CLUC 1H3FA 5TRDA 1EUQA 1PFVA 2E21A 1MJHA 3GLVA 5J5AA 4ZCQA 2Z3VA 2PZBA 5FO1A 1IHOA 4G5YA 4QBTA 4MQ6A 2VBUA 2XRYA 1JZSA 3INNA 3IODA 2GOYA 1K4MA 4KR7A 1U7DA 5FNZA 3IMCA 4PBTA 1T6ZA 3SZ3A 2DUMA 1NUSA 1D2RA 2V0CA 1ILEA 3CVYA 1UFVA 4MWEA 2EJCA 1TFUA 1JMVA 1N2HA 3ND5A 1IRXA 4CDNA 2QUIA 2X0KA 1O95D 1NYLA 1EXDA 3SEQA 4S1OA 1ZH0A 4MVWA 3K32A 4XFDA 1N05A 4ZT6A 1QJCA 4MAFA 2JANA 3Q10A 2A1UB 5KWVA 2P3MA 3RK0A 3LCJA 4MUGA 1N1DA 4MW4A 3L92A 3DO8A 1Y42X 4GU5A 4EFKA 1YULA 3PNYA 4U7JA 1H3EA 3CVVA 3COWA 4H3SA 3MMXA 4HK4A 2DPLA 1WZ2A 4DDHA 3ZUGA 1R6UA 2EL7A 1MB2A 2DETA 3AL0C 1JZQA 2XRZA 3CVUA 3CLTD 2YWBA 4NAUA 1Q9SA 3N2YA 1JILA 3KT3A 2I1LA 3UOWA 2AZXA 1Q19A 3NBKA 1U0BB 5A89A 1O96B 1O95C 4KKVA 1EFVB 1WY5A 4MVCA 3NV7A 3AKZA 4K0RA 5J59A 4PY2A 3GUZA 4MWBA 3KFLA 1WJGA 4I6JA 4MULA 1O6BA 4ZCRA 2PG3A 2QJFA 3HV0A 1Q77A 4FZJA 1M8JA 1OWPA 5K0SA 3ELBA 1KP2A 4EG4A 3MLBA 1A8HA 3E27A 5LLTA 4JFAA 4L2IA 1NI5A 2BTEA 4PBRA 1N75A 4F4HA 4MVYA 1ZH6A 1KORA 3N05A 1MC1A 5F23A 4UZFA 4OUDB 1G8FA 2J08A 4MVXA 2VXOA 3TQIA 5LM3A 4CDMA 3LOQA 4G6ZA 2VBTA 1WXFA 1T9GS 3I05A 1TYAE 1GPMA 1JGTA 2G36A 4KPUA 1F7UA 1NURA 4WSOA 3RFFA 1TYCA 2CYCA 1N3LA 4ZCSA 1OBCA 3ILVA 5H16A 1T6YA 3IOCA 3A2KA 1M8KA 1ULHA 5HUHA 2OYNA 2B7LA 4DDMA 5IHXA 3UY4A 1PFYA 5JBNA 5BNZA 1ZJWA 4NZPA 4KPUB 2J07A 3L93A 1VBNA 2A7XA 1KP3A 2IJGX 2PFSA 4Q16A 4NDAA 1N06A 3P0HA 3A05A 2WB2A 1H3NA 1PFUA 1N2OA 3M5WA 4CT0A 5DK4A 1EFPA 3IVCA 5TS2A 1JIIA 3VU8A 1QQTA 1K4KA 1QNFA 1PG2A 3P52A 1GTRA 2QJTA 3TZLA 2VTBB 1H1TA 5EKDA 1I6LA 1KH3A 3ND7A 3ZJUA 2JAXA 3H99A 4K03A 1OWLA 4MWCA 3UMVA 2HMAA 5HUJA 1JECA 3P0IA 1NUQA 1X8XA 1M8GA 3DLAA 5AHWA 4RPIA 2PZ8A 4MLPA 4RUKA 3SZGA 5IJXA 3N8HA 1NB0A 5TEWA 4UZEA 5A88A 3ISJA 3RK1A 3SP1A 3IOEA 3U1VA 1MBZA 2AKEA 1OD6A 3OP1A 3CVXA 1Q15A 2A88A 4ZCTA 3HGMA 4MUEA 3BL5A 2J4DA 3ZGZA 4MWDA 1XNJA 3P0JA 1MB9A 2E18A 1I6MA 2CUZA 2E89A 3SDBA 3N9IA 1K92A 1PFWA 1WKBA 3CLRC 4R2LA 3IMEA 3KT8A 2CV0A 1WOYA 1PG0A 5KCMA 1EFVA 4I6EA 2PZAA 2CYAA 3TNJA 1QRTA 1XNHA 5FO0A 2IP1A 2X1LA 4PBSA 3ND6A 1VLHA 3Q4GA 1N07A 4E1AA 1U3DA 3D6VA 4MUNA 2YY5A 1N2GA 2RD2A 1V8FA 2OQ2A 2A1TS 3KT6A 1GAXA 3CLSD 5LFAA 4EG6A 1J20A 1J1UA 5KHAA 2DLCX 3K9WA 1OWNA 4R2MA 4EG5A 3TS1A 1K97A 4EG1A 4NAHA 3MUEA 2ZUFA 3HL4A 5H7XA 1SURA 3CLTC 3A04A 3KT0A 1VL2A 3FG9A 1I2DA 4YMIA 2QUJA 2DR2A 1IQ0A 4U63A 1O97C 1ZUNA 1Q11A 4XFJA 3S3TA 4HJXA 2GM3A 3RBAA 1YIAA 2RE8A 2CT8A 1IFXA 4ZT4A 1N2IA 1U3CA 4EG8A 2WQ6A 1EUYA 4ZT2A 1M83A 2WQ7A 2J09A 3IDFA 4AS1A 1IVSA 2H2AA 3HZRA 3BNWA 1JEEA 5J58A 4MW9A 1KAQA 1R6TA 2QTMA 4AQ7A 4DDKA 1KQPA 1KAMA 1WQ3A 4TS1A 4L2IB 2ZP1A 2WSIA 3RJZA 3ZXIA 4GRIA 1YUMA 3CVWA 1NUPA 3UK2A 2AG6A 1N77A 1NSYA 4EG7A 1O0BA 1M1ZA 3ZJVA 2NSYA 4JXXA 3RHSA 3FETA 1EE1A 3CR8A 3G59A 1FYDA 3FY4A 3H97A 4J76A 5HG0A 2ZUEA 1YI8A 4MW5A 2A4MA 1R6XA 1N78A 1J70A 3DPIA 2QUHA 1S4MA 3SEZA 4ZT7A 3X1KA 2CSXA 1KH2A 1J21A 3FNRA 1I6KA 3HMQA 2C5SA 2YXNA 4WNYA 1TYDE 3CTAA 4MUHA 3FI0A 1KQOA 2DXIA 3AIIA 4DLPA 1WQ4A 2HGZA 1T9GR 4ND7A 1JEDA 1NUUA 1M8FA 4QRDA 2QJOA 1O0CA 1VBMA 1KKUA 1MOPA 3IH5A 1IQUA 4OJMX 1MAWA 4X0EA 2OV4A 1TYBE 2CYBA 3H9CA 1GLNA 4MUIA 1WXIA 2VTBA 2NZ2A 1QU2A 3CLRD 1EJ2A 3OTWA 3IOBA 1NUTA 3MXTA 3QTBA 4ARIA 3FOCA 1O5TA 1O94C 3IUEA 2A84A 2D5BA 1NZJA 3IMGA 3CLSC 3G5AA 4DJAA 1V47A 3IVGA 1KH1A 2JA2A 5TEVA 1KQNA 4MUKA 4XSVA 4MW1A 3UC5A 3VGJA 1NB9A 1YUNA 2PIDA 3FIUA 4J75A 2VBVA 4MW6A 4YP6A 1KR2A 3PNVA 4YP7A 3COZA 4CQNA 2O5RA 1TQ8A 1G8HA 1F7VA 1OWOA 4I6GA 2BYTA 1M8PA 1T6XA 1P7PA 3F3MA 3TZEA 3ZXSA 1JIJA 1MAUA 1N2EA 3PNBA 1LI7A 1XJQA 3VRHA 3PXUA 4YBRA 3CA8A 3PRHA 3X1MA 1XNGA 2CV1A 3A4IA 1X6VA 3X1JA 4EF6A 3IUBA 2HZ7A 1QU3A 2R5WA 2CV2A 1N2JA 2CFOA 4DNXA 3COYA 1GZUA 2Z08A 1LW7A 5A8AA 1U7XA 1O96A 2QTRA 2DEUA 3FHJA 3JXEA 2YWCA 3ZIUA
chains in the Genus database with same CATH superfamily
1F2UA 4ZAFA 1PWYE 1JKMA 4JZYA 1UEJA 3MLAA 4Y9UA 4ZU3A 3O8QB 1II8B 1VE3A 1YBMA 2QX9A 4Q3CA 3RK4A 3W78A 3LYUA 1M34E 2B3TA 3HXOA 1OH7A 3D0OA 1JU3A 1NJSA 2J5BA 1PZXA 2NZUG 2Q4TA 3OURA 3SKVA 5I45A 1RCFA 5F51A 4AM8A 2IYUA 3IKLA 3QFHA 1MA0A 3QE9Y 2NO6A 2G5CA 3DEHA 4N0EA 4H7FA 3VH3A 3WJ1A 3ASSA 4X6LA 4A10A 2I9KA 3BIOA 3EEYA 3GFPA 4S1TA 3RGGA 2XSZA 1YBAA 3LUGA 3DL4A 5TPZD 5DXFA 3ZDFA 4G7WA 3LQKA 4BDSA 4Q1CA 1S0UA 3RBXA 3ENVA 3L7IA 3GQVA 3QM1A 4GQNA 1UMCB 5BSRA 4N76A 1IM8A 1CUEA 2IYXA 2E9SA 2NUBA 3JYQA 3BK7A 3JYLA 3P2OA 4UM5A 5A5VA 3Q6IA 1AHHA 1CQIB 3WHIA 1OI7A 3AJDA 2SNIE 3DZDA 3F9RA 5CFZA 4MRAA 5CCEA 3QPVA 3T3IA 5JALA 5EE9A 5CA1A 3KM0A 2PY6A 1CNEA 4AYWA 4LXXA 3H5RA 4NATA 1HFJA 3NANA 1IAQA 1KO4A 4BQNA 5JH7A 4R2KA 1IZZA 1QAMA 3LHSA 4DPMA 1GG2A 1KK2A 1PSWA 2B20A 4LMRA 3N2KA 1NRKA 1V48A 2C7RA 4ZOLB 3MIZA 1A77A 3TRJA 3TQOA 1BG6A 5AVVA 1FS5A 2L17A 1ANKA 5I4KA 1NRIA 3NW9A 1I7LA 4LQCA 4MS3A 3QMVA 2BMWA 1XXHA 3QIVA 1IY2A 4ND1A 4URZR 1KZ9A 3OHPA 1K5PA 1JQ3A 1RHUA 1NY6A 3HFSA 1Q7EA 1YJ8A 5CHYA 4DUPA 5L45A 1D2MA 4UUMA 4RD6A 1WDMA 3A1DA 3FYTA 1QCZA 2PUDA 4KXFB 1JP7A 1QKIA 1J09A 4NBWA 2XMRA 3Q8MA 3HRKA 2QUZA 1ISJA 3T1HB 1WMAA 3AVTA 2Z9CA 3AG6A 4ZEXA 1Y1RA 5IUKC 2QPOA 3EXHB 4BNGA 3RVSA 1GKUB 1JYEA 4URHA 4WK6A 5ULLA 2ZSJA 1UEIA 1R66A 1QIEA 3DE3X 3OIUA 3S27A 3RJTA 3NGLA 2DRIA 4GKVA 3SLGA 5TRDA 4QBIA 1X7HA 5LYJB 1K7YA 4I9HA 5FEUA 2BZ0A 2X8WA 2HHHB 1I9GA 5BW5A 4EY6A 4B3MB 4X62B 4GR4A 2RK3A 3ULKA 3BCDA 1KDVA 4OGLA 2OENG 5ITZA 3OBBA 5K03A 3ZVKA 1WV0A 3BTOA 2RGCA 3K9HA 3OPXA 1ZL2A 1U5BA 1B16A 2GILA 4LZZA 1MC8A 1OBOA 3NTUA 3PDIA 2XWQA 4UM7A 1GPLA 4I1YA 5K8CA 5FNZA 3OHMA 2VQSA 3VSBA 4ENPA 4Q6WA 2OEPA 4CM4B 5AJTA 3MJTA 3DMHA 3HO8A 1FUUA 3ISVA 1JIUA 4IIJA 3PNKA 5AJVB 1NUSA 5BV2P 1SBNE 4NYJQ 1YI2B 1C9JA 1UFVA 1HVXA 4LMPA 1RZUA 5A6SA 2IPXA 5DCLA 1PR1A 3M1IA 3WRYC 4OXYA 3W05A 1JDTA 3EVGA 3KQNA 3WJAA 3CCJB 2AI1A 4UEWA 1M34B 4B8WA 4LTMA 3HC7A 3OZVA 2NV6A 2C54A 5KTPA 1GNPA 2OM2A 3SEQA 5FOQA 1PNVA 2XUGA 3P9CA 5H59A 3F3SA 3EA5A 4MS1B 3ICCA 3T38A 1N05A 2J7KA 3OT4A 4JEUA 4QDXA 4XKWA 1NBMA 4UC0A 5CB8A 4CYMA 4BRUA 2PA3A 1JR2A 2PJUA 3VKVA 4ERNA 2WHPB 3WJ7A 4NV1A 2HUNA 5EXXA 2DSNA 4K40A 3WKBA 1VC2A 4HCJA 4GU5A 1KNXA 4GO1A 1X1SA 1YULA 1OW3B 1L5NA 1GZVA 1V7QA 1ORHA 2C2OA 1XGKA 2L69A 1DIRA 4GSYA 4IVPA 2B34A 4ZEMA 1P4JA 5ADHA 2CVFA 3WQHA 1J99A 3NHMA 3NDJA 2GCOB 4R5MA 5K4AA 4HPXB 2DPLA 1XU7A 1T2AA 4LZLA 2YIDA 3PBKA 3OIDA 5EJ9A 3KLOA 5D5HA 2EL7A 2F90A 1MB2A 4PC6A 3ETLA 5JZSA 5B4UA 4D82A 1VXOA 2FE4A 4I19A 5CLIA 2YJ3A 5G3YA 3OKCA 5FJIA 3K96A 3ZJ5A 1YAHA 2WABA 5EN4A 2APJA 4MDYA 1DO0A 5IFKA 3ONVA 4A6XA 5JAHA 2O5CA 3W5HA 2PT9A 5CA1B 1Z8NA 4JYMA 5I9LA 5KJFA 1W19A 3THXA 3G49A 5A89A 3OLXA 2BE9A 3HZZA 1GLGA 1T10A 1FUEA 3HJCA 3N1UA 4EGQA 4JOSA 2C3YA 4B74A 1NE7A 5EP4A 3BRWA 1PUXA 2C2BA 3C3MA 4MWBA 4P0QB 4CCSA 1EWYA 1RYBA 4D42A 3EB9A 1T8YA 5AW9A 4E12A 3LA6A 4U39A 1EG7A 1OXBB 2JGEA 3HV0A 5AVTA 4C2UA 1DC4A 2IBTA 4UDYX 3OJXA 4AO8A 4KV9A 1OGJA 1SXJC 2CXSA 3HXTA 1D1QA 3I9KA 3MLBA 1WQ1R 5BR1A 4P9NA 1JHMA 2QTAA 3JZAA 4B5KA 4NR0A 1LU9A 1SCBA 1VYVA 4EITA 3PUZA 5F1KA 1QZUA 1VE5A 1YB1A 3FYCA 4XYGA 2NOAA 4F96A 1N75A 1VMEA 3JAMA 1WNFA 1MC1A 3Q6NA 4XNFA 1U7WA 2P2ZA 5BQFA 1HT1E 2K7FA 1KEEB 2QY9A 3N6RA 4BGUA 1YBHA 1OZGA 3FMIA 2RGWA 3W0LB 4LSZA 4I3HA 2RHGB 2WAOA 1F06A 5T6BA 2FJPA 3OD1A 2ZL7A 1Y80A 3FDFA 5JJ5A 1XF9A 5HRCA 5JH7F 2J0UB 1YLOA 5D6OA 2XMCA 3T3HA 1BIFA 4WXRA 5CCBA 1UBHS 1ODCA 2D2EA 2G36A 2VJNA 3LHKA 4CMAA 1M2VA 1C0LA 3DTVA 3HNOA 4UUOA 4W7SA 4LY9A 1YCDA 1YFKA 5E3IA 3ANXA 3X2EA 4Q4AA 2BEWA 3EGXA 4QSHA 2XYRA 3C1UA 2QD2A 2B7LA 1GOTA 1J2YA 1FY2A 1ULTA 4ADSG 2REQB 2IH5A 2H4XA 2C4WA 2EJTA 5CM9C 4XGIA 1T8PA 5C5CA 4LYDA 4IKPA 1TLTA 3LTNC 4QGBA 3WI7A 4N0PA 4UBNA 1J97A 5DNYB 3DWFA 1RAAA 3PEFA 5FWDA 1OCEA 1K9MD 1IBSA 2CZCA 1WZUA 2RBGA 1C8BA 4BUCA 1SA0B 3CCEB 1R0ZA 2GN0A 2Y1KA 2F67A 3NATA 4DQVA 1J5PA 2IOFA 3R44A 3E3OA 1HGXA 3K30A 3LDGA 3FUVA 4U4AA 4Z0NA 3VOBA 2JH8A 1QQBA 4UPEA 1JIIA 2MSWA 3MQ4A 3CLVA 2QMYA 2M6KA 1BKSB 1HOTA 4Z4YA 1L0BA 1VB3A 1U98A 3FVWA 4EJSB 4IMRA 3TZLA 5EPUA 3PUJA 5CFOA 3FI9A 4B3DA 2JAXA 4KRXA 1XBTA 4K03A 5FBVB 1R74A 2Q46A 1GPBA 4MYHA 2OILA 3X2SA 5B6PA 3CW2A 1J0AA 4AKHA 5BOVA 1MNAA 4S0XA 4KAFA 4Q9HA 3VA7A 3H0KA 3CUVA 4PZ0A 1ZD3A 1CU1A 4FYVA 4CN9A 1EP9A 1TIPA 2D2XA 5IJXA 3VDRA 4PSDA 5AXDA 1P6XA 2X0IA 4MJ7A 4BZZA 2OTJB 4KWHA 2J5RA 3ZGNA 3ZE2B 5IAAA 4E94A 2AKEA 4D7AA 3DFFA 4CTMA 1LSOA 3JQ7A 3ORYA 2A88A 3PUVA 3IV9A 3QGMA 3MB8A 4P7BA 1QGDA 4JA2A 3ID6C 4MUEA 5DO9A 5GPBA 3WMFA 1J2TA 3LPAA 2BI8A 3HRHA 3FTCA 3K1ZA 4O59O 2G72A 4G63A 4Z86A 5FNVA 1JW9B 3TOVA 3BCHA 3ZWDA 4FLFA 4JOBA 1SULA 3UBTA 4WOKA 3LO5A 4XB2A 1JQDA 3FNQA 1WVMA 10MHA 2XUIA 3Q2KA 3K9LA 2H1RA 4BKQA 2O14A 3I5MA 4UNPA 1Q2UA 1FLNA 4EVIA 4RA6B 2PGXA 1P2UA 1L1RA 1MVNA 4WOPA 2QNIA 1E8MA 1Y3AA 3WMGA 2PMEA 5IT4A 1WEHA 3FPKA 1OVGA 4QUEA 3ANTA 3CWZA 1YRYE 3OKFA 4MPRA 2BT4A 3BH4A 1W44A 3KB1A 2BP7B 1EDEA 2OC4A 4B33A 1U9CA 4DFDA 3IAUA 4JXKA 2C0QA 2GFIA 3C87A 1U2RA 3H2IA 4OD0A 4C43A 3KTAB 5HFAA 1X92A 4G0MA 2LRHA 3CKLA 4FQ7A 3M8KA 4DBZA 1OFGA 2PX6A 3DVSX 1ETHA 3OZTA 4FXPA 2C2WA 1BFUA 1HYQA 1GAXA 4RZIA 1SU8A 1E2MA 4I4TA 3L8CA 1Y8QA 2O4CA 3K9WA 2YN0A 1T4BA 3COPA 1F4VA 2AK2A 4G1UC 3B60A 2VYVD 2V7XA 1O4VA 4F3KA 2XB6A 4EG1A 1KEUA 4YYEA 4KXNA 3F2IA 2FN3A 3MGCA 1SG9A 1R0LA 2C99A 1IYZA 2I76A 4RZ3A 3OLYA 3TVYA 5FDFA 4C7KA 3S8EA 5D7BA 4RPJA 1I2DA 2NUPB 1JAHA 4TT8A 3DP7A 1IQ0A 1Z75A 3F3KA 3L07A 3LTEA 4KRFA 3BUSA 1OXSC 1QTIA 1UPBA 1CYDA 3WGIA 4BVKA 2WJIA 3QVTA 3X0DA 2CJYA 1M6VB 2HPHA 3MWFA 1R10A 3KXDA 2NXCA 3FNBA 3REQB 1HKHA 1TJNA 2FQ1A 3K9BA 1QYVA 4BO4A 2HLNA 4GR5A 4I5GA 3TEFA 5LQKA 3IEVA 3T1TA 1MAAA 3NWBA 1U8UA 1QC5A 5F12A 2AI2A 3F98A 3GJ4A 3OIFA 3HZRA 4GI3A 2ZS9A 3WA7A 1L4LA 4KZPA 3D3NA 1YNOA 1V6SA 3SF0A 4U9HS 2IUTA 3ITDA 1JKXA 3Q9LA 4AQ7A 1XRRA 3CPEA 4PGFA 1WQ3A 2HU8A 3B2EA 3L1VA 3PFGA 2XIQA 1YZ3A 5J2TF 3N8NA 1EP3B 3F9IA 1GTG1 2IYZA 2JEOA 4WK2B 3TW6A 2C92A 2XB2A 3S2IA 4G0OA 1PDVA 5E38A 2R6ZA 2VUUA 3NBFA 4RXUA 5BSTA 3C3BA 1TKCA 5A9RA 5SY9A 4AL4A 5INTA 2I3DA 4J76A 3SS8A 3ZCXA 2Q1SA 1A4IA 3SHFA 5BW8A 2JF0A 1W76A 1QG4A 5EPOA 3TGLA 2DKNA 1BPLA 2W2QA 1RLTA 2BEJA 2RHLA 3KZ1E 5KMGA 2VH1A 5D8DA 1LUAA 4G5SA 2JIRA 2PRIA 1FNNA 4HDSB 5KAPA 4R0VA 4O2BB 2AEJA 2QRUA 1LDYA 4LJKA 4HAYA 2DQSA 3LYLA 3QU2A 4XB6B 2Z98A 5JARA 3KUUA 2OVBA 3AIIA 2M9MA 1ESDA 4DLPA 5I5GA 2B7CA 2V7UA 1A04A 3ROZA 5EZYB 4NE9A 4RXMA 2WHYA 1G8SA 1XMOB 1JEDA 1R5JA 1P7YA 3QE2A 1E32A 3PDWA 4FMCB 2W2KB 5IAEA 5L7TA 3P97A 1OXUA 4OVKA 3RAGA 4GLBA 3ZZTA 1XQXA 2XY4A 5FPQA 5JPIA 4B2PA 4RPDA 4RWEA 2JI8A 5D51S 3D6TB 3N87A 5H80A 2ZJ3A 3DHWC 2WWRA 2WYWA 5J3JA 1OAKA 5L40A 4WNCA 2VTBA 1LW6E 1R0CA 2W2LD 1YNSA 3MGKA 3QK7A 3LZ6A 1F6WA 2N9UA 2ZSUA 3WKAA 3I64A 1ECLA 4B3CA 4EYGA 1VKNA 1PTJA 2O8FA 1E5XA 4UDOA 4E5PA 1K6JA 1M34A 1E6MA 1NSTA 1U80A 3H11B 1MORA 3O8NA 4HFNA 4MQUA 3O8OB 5C18A 1EXWA 4OF4A 4TMFA 4RY2A 1FEZA 4QFCA 2X9GA 2OBFA 3GUVA 1EAYA 3IRVA 3S2UA 2IODA 3CIFA 1RYEA 3UC5A 4BNLA 4DEXA 1ZL0A 1Y5LA 3CYFA 5ITVA 1V2GA 1LZKA 3D54D 3GWZA 1JG6A 3LFUA 2FNAA 2FR8A 1OX4B 4H4CA 4W7IA 3W6UA 1V96A 1CNFA 2CMKA 1YE8A 1YA4A 3M33A 4JUFA 3ZQKA 1J56A 3AR7A 3RYIA 3IKMB 2UYOA 3VTFA 5GQSA 2EGGA 5BN3B 3R7WA 1XWFA 4M49A 1OWOA 4ZK2A 4EGFA 4I6GA 4WZAE 2H7XA 5AM1A 1EXMA 3JU4A 1A8SA 3AF3A 3PUIA 4UE3S 3AOEA 1JIJA 2XTZA 3CTPA 1XE3A 5TX7A 4C7BA 4CL8A 4KLRA 1WORA 2H63A 3RVLA 4QC2A 3ES9A 1SHTX 4TV9F 1XROA 3L7NA 3TSYA 3OQOA 1LLQA 4X5OA 3VZSA 2ZXHA 3THRA 4B6GA 3BL6A 4UJ5A 3CF2A 3OQ6A 3A06A 4F60A 3ANNA 4Q1VA 4YAEA 3RT1A 2K7ZA 2QU8A 4JITA 1X7WA 1UJNA 1VL5A 3HY6A 1OFHA 3B5IA 4IVRA 4CL3A 2PH5A 2UYQA 1MOQA 3TF5A 1B74A 2YWCA 3JXEA 4AD8A 2VBSA 3A27A 2GBLC 2IS2A 2DBQA 4CF6A 1X74A 4JBWA 3VX4A 5IANA 2H8GA 1FU7A 3PYXA 4KWCA 4PLPA 1G19A 3REFA 3GT3A 1G3IA 1QH8A 1I7QB 3KV1A 4D4GA 1E1KA 3L04A 4DM7A 2PS0A 1R3DA 2WA2A 4HPJB 1IN5A 2A0UA 3CZRA 1RWNA 3ZV6A 3VV2A 3M5PA 3W8EA 1XXHB 2DMRA 3SIRA 5J4HA 1MD9A 3DAYA 1Q0SA 3ZCTA 2ACEA 5JXIA 5U4XA 1I4WA 2A9OA 3IXMA 4K9MA 2VHCA 3C3WA 1M0EA 5CXUA 2I4LA 4LI3X 1GN8A 1WXHA 2P9HA 2IX3A 3O9VA 2P1DA 3UA4A 4Q7QA 3PX3A 1O54A 5ECDA 2VAVA 3VQTA 4BUJA 1LI5A 4EI7A 2ZYAA 3JQGA 2NLOA 1V3QE 3DZ8A 5LC1A 4HRYA 4YJ2F 1N2XA 3TTSA 1DBRA 3R3WA 4LG1A 2ZXIA 3SSAA 4DMRA 1B76A 1PVVA 4IIHA 5EYPB 4AMVA 4IDDA 3UAYA 4R98A 5K3DA 1NDQA 4IZ6A 4XR6A 2AQHA 2NUAB 2WM3A 3WGVA 1WKCA 5CCDA 1QRSA 3GV0A 3WYNA 2CSUA 4WKBA 3T5TA 1D2GA 2GF9A 1B42A 3GRZA 2EJUA 4E31A 3UTDA 3AHEA 1DTWA 4ZOLF 4F4CA 3E5RA 4U1RA 5EJEA 3A11A 1VPDA 4BXOB 2JEZA 1U1GA 4TMZA 2ZIVB 1RAFA 5LA6A 3F1KA 4WFIA 5BWLA 1HL7A 3LY8A 3E35A 3NH6A 4DABA 3GLUA 3PFBA 3PGXA 1CJKC 1K27A 1I33A 3GVJA 1U2ZA 1T5TA 3UIEA 4D4KA 5BQ3A 4RJKA 2LCIA 4LMAA 4ND6A 5HRAA 3GCDA 3DHVA 4OI2A 4OPMA 1PJ4A 3T3GA 1E2EA 1U7HA 4LAFA 2ZIEA 3WNQA 5DASA 5LZ4A 1GTSA 2BF7A 1ZUIA 3D4OA 1KZLA 4PXAA 3BIJA 3SMQA 4UM8B 5BMVA 1KEWA 1WXWA 3AY7A 5HJEA 1NNI1 2ATXA 2DFVA 4YACA 5F64A 4E46A 2GEVA 1W7AA 4F6CA 3WLQA 4UOZA 2BIFA 3P19A 2GBFA 3SI7A 4HBZA 4M0LA 3A31A 4WZ6A 4UREA 2XTAA 3M3DA 4D25A 2QTTA 2W2VA 1GGHA 5KTMA 2O8VA 1RC0A 2ZRHA 1JA9A 1XJWA 2JZOA 4KXXA 2ZCUA 5AI0A 5ALPA 1XDDA 5CD9A 4F4FA 5LP1A 1FX0B 4GBJA 2B98A 3OG9A 5DH9A 4GSKA 1R8SA 5JAOA 3VDNB 3II6X 3M2TA 5FO1A 1W46A 4OYYA 5IJAA 4RS4A 1SXPA 3URMA 1I30A 3BE6A 4MROA 1QANA 4GE0A 1OH5A 1TPYA 4ROTA 2HA4A 4YPOA 5LVAA 1U7UA 4RH1A 3NNSA 2OA0A 1RKQA 1QLHA 1U4SA 1DT5A 2CD7A 2GOYA 4EI2A 3OZEA 1EKXA 3W8FA 4RTOA 2GZ2A 4Y6RA 2IY9A 3UGKA 1LCIA 3WXBA 3D2CA 4H6PA 4C1BA 5KO2A 2H6EA 4OKSA 4FMDB 2PLWA 1Y1PA 2VQ6A 3AJRA 2GRAA 3DBHA 3EDRA 4V3BA 5G3ZA 4BV9A 3ZI7A 4P31A 1XKXA 1AQLA 1JMVA 3IDAA 3HP1A 2HSJA 2J3HA 4GGPA 5EKUA 5FBLB 3SX4A 1ML3A 4CKYA 5CG2A 2FPIB 1P9OA 2JH3A 4GWLA 4ARZA 5KOJB 1APBA 3TWOA 4GH5A 3V1TC 2ZVJA 4M76B 3T9CA 4G0ZA 1H9BA 5AVQA 4JGGA 4RO0A 5HGJA 3NIFB 2ZBGA 5IDYA 4LF6B 2NTJA 5K0GA 3KUCA 4CCWA 4C0LA 1USKA 2AR7A 1E94E 2Z5LA 3T34A 2QXUA 4V3CA 5IRCD 5HWSA 5LZ7A 2Y1FA 3S28A 4PC7A 2PVPA 3U3XA 2BC9A 3WGMA 3WRXA 3ADBA 4UHBA 4A0HA 3MWEB 2XCUA 3DFUA 1MFZA 4TVKA 4KBYA 2QE7D 1AXGA 3KU1A 4QOHA 4TZTA 1V6AA 1U9IC 4U7JA 5IX8A 1S3IA 1RRCA 5LP6C 2OVFA 4RZ2A 1RP1A 1CDEA 2WSYB 1RKVA 3VMMA 4DG8A 5FWYB 1PG5A 5FORA 1Z7GA 3JD3A 4KH1A 2QQ0A 2GEUA 5DGHA 2QV7A 3DULA 5BWMA 2W37A 2B1RA 4I1UA 2VDVE 3TLBA 3W7BA 3T3OA 1M6YA 2D1QA 4ICIA 4CMKA 5TXGA 3RGWS 1DGQA 1RWPA 3KR0A 1PT7A 1WXXA 1SVLA 3LUKA 4TUYA 4IMIB 4KMRA 1UJ2A 2DPYA 4HDOB 1JBQA 4FEAA 5DNEA 5BYBA 3LCMA 3EVNA 5CPFA 2JKZA 4PHHA 4UEQA 4MVCA 4UUAA 2FSVA 2EL9A 4PCVA 3GLIE 4WKNA 4HATA 5BWBA 2WWTA 3GFRA 2FSPA 3R3XA 1SQ6A 2CDRA 3A1VA 4IF6A 4A2WA 4DCSA 5THXA 1LA2A 1TZBA 3S2FA 1PGJA 2QJFA 4X60A 4G4SO 4ZGGA 3DAOA 1C8LA 5ECWA 3T7IA 1R8QA 2ZIXB 3G0CA 1L8XA 1LF5A 1MDFA 1TF2A 2OCGA 1YDWA 3FNIA 1H1DA 3TL2A 5DBOA 4B4OA 4CNQA 3CUTA 1AZLA 1T25A 4DRXB 3MCTA 1PD1A 4GWGA 1XFDA 1LPSA 1T5OA 4CKCA 4LBWA 5LLTA 1EVEA 1BMQA 2O0HA 3NHUA 5HJ5A 3CQ9A 4C01A 1DVRA 2OXRA 1KFJB 2XZOA 1U1DA 1NW3A 2JLQA 2I7XA 3L6EA 1JHPA 2OORC 4XR4A 4XN3A 4BLQA 1NT4A 1CLEA 2ID7A 2VAPA 2E55A 3TM4A 1M6EX 1LDEA 1KO8A 4MX8A 2J08A 2C3MA 3CCVB 3P9XA 4JSYA 4DL9A 1U28C 4MJXA 5A3SA 3GBSA 3QPBA 2Y1DA 1PKEA 1N6PA 3JQAA 1YS9A 3IR6A 3I05A 2PX8A 3P9QA 1HV8A 4FKMA 4IQ4A 5FOUA 4I1SA 4QASA 5JD6A 4KO8A 1LWNA 4UZSA 3AF1A 4JYPA 5KDLA 3RFFA 2BV3A 1PQUA 1TUBA 1XAHA 3L4JA 4PINA 2V31A 2AEFA 4K9KA 1WE2A 4ZJYA 2O2DA 2IDZA 3T7DA 1KY5A 1XEWY 3LZDA 2B25A 3LRPA 4ZVKA 1Y81A 1GA1A 4EATA 1RAIA 4M38A 5SY4A 1E2JA 1XDBA 2VPQA 4WBNF 1TCVA 2J07A 3TPZA 3K0FB 2ZIWB 5JZOA 1PIWA 2WTXA 721PA 2IXFA 4PZEA 1RD4A 1NR7A 2I1QA 2ZS8A 5B1SA 3NFRA 4IPTA 2IEZA 4ETWA 2K5UA 2AJLI 2QBYA 2V7EA 4MV5A 2HA2A 4EYQA 4IFTA 1S96A 2WF9A 2E85A 4CM6A 2F1MA 1AKEA 1FMTA 2K2QB 2UYGA 2O23A 2WWGA 1CS0A 2A0YA 2DFTA 3A1TA 4KQ6A 4KWIA 4LHXA 4F7WA 2LV8A 5ALOA 1UD3A 1TJYA 2J3LA 2ZI9A 5JCOC 3QRWA 1GTRA 4BVJA 1C4KA 3RS0A 2C9MA 4L8LA 4OSOA 5IAJA 3MCAA 3VPCA 3Q7QA 1IEVA 4S1NA 4B6SA 3BWYA 1XVLA 3PNQA 4FHCA 4JSTA 4P82A 2B94A 4JYBA 5F73A 1I4TD 2ZJ4A 3PF8A 2PUCA 3D0QA 4K0KB 4Z4FA 2QX7A 1AKNA 3DOOA 3IILA 1C7QA 4X92A 2PVCA 1OT3A 5DLDA 5K45A 5J2UB 2NP7A 4ROSA 4F8JA 5TEWA 4JBHA 2AWOA 3CBGA 2IXTA 3NPMA 4XM2A 1TZKA 3DC2A 3EPPA 2BZ1A 1IWBB 4P2GA 4HTFA 3MJDA 5TGDA 3T7CA 3HS3A 2ZTSA 2OHFA 4G1MB 2QY6A 4DLZA 1RM5A 4G5XA 4X06A 4CIYA 2FP4B 3F8WA 3O1IC 4IH9A 4P3XA 1T36A 3KOYA 4NFHA 3BEDA 3NJ4A 1J25A 1P1KA 4DNFA 4NFYA 3EG5A 1GA4A 3A70A 4A8JA 2IXDA 4RFVA 4WNAA 1CPYA 2Y6VA 1IZ8A 2X3YA 3FWNA 1CHNA 3A9UA 1YE5A 1PZEA 4NSNA 4UHDA 2FDCA 1C8VB 3GP5A 2OZLA 3SHVA 4RD1A 1XA0A 1OXTA 3KWMA 4QUJA 1HNNA 1ZGHA 3BF7A 3D9QX 3OI7A 1ZLXA 2ON6A 3BFXA 1JHRA 1NIJA 1LBTA 2PPLA 2YV3A 3QW2A 2G9NA 4DREA 3B48A 3GJXC 4MRRA 3LV8A 5IU6A 4MI9A 2A14A 3G9TA 4FDAA 3DKPA 5BNWA 1E2FA 4LFAB 2X1LA 4G4IA 1TM1E 5IYWA 3FMFA 2F1RA 4NYIR 3H3FA 4LMBA 4N8SA 1DMRA 4TYPA 2J59A 1JDUA 2GTHA 1IOZA 1NQVA 2P1RA 2YY5A 3NWEA 3QWFA 4G56A 4TTTS 5HFNA 1Y34E 2OQ2A 2XJ9A 1RYFA 1MW9X 1DINA 3ILSA 2D7CA 4HDAA 3JVIA 2GYUA 1XEAA 1KXZA 3O1LA 3RC1A 2QR5A 1UJCA 4Q37A 2FUEA 4YRZA 1OI4A 3O84A 1CB7A 3UMBA 4E2XA 5EMJA 1W2GA 2EFGA 4CRWB 3RIHA 5IJ0B 4LXGA 3IAHA 3CX7A 4QYIA 5G0UA 1ML4A 3Q8WA 1IHXA 4OB8A 1G18A 3PFIA 3BIWA 3MMSA 1PGNA 1Y3HA 3VR6A 3HUFA 4S05A 4PG6A 3TQCA 1T91A 4IIGA 4LNUB 3U9SA 1NW7A 2JBHA 2J46A 2GM3A 4ESEA 4WN9B 1JYFA 3OVMA 1PI3A 4B35A 3C7TA 5IWAB 3TTXA 5FBKA 4QUAA 4NY1A 3AETA 3MWLA 3AVWA 4DEYA 3BK2A 2FWAA 3MTEA 4LXUA 3M4XA 4OG2A 4Z54A 3JRXA 3K9CA 3H2HA 1HETA 4MARA 2ZTVA 4OJKA 5GONA 4DV3B 1EUYA 2PUWA 3M5CA 1AS3A 1CUWA 1YB7A 1D04A 2OAGA 3E5HA 2WWWA 4NQRA 2BFDA 4M8SA 4QATA 1U2TA 2XKBA 5L95A 4JT2A 1PUJA 4QRIA 4OQNA 4UUNA 5E6UB 5IHPA 2I8LA 5AM4A 5ALQA 1CEXA 1CJMA 4NOJA 5AKKA 2Z04A 1PSZA 1HLDA 3AR2A 1J24A 2QVBA 2YDYA 4FOSA 5JS7A 4TYMA 3MSXA 4O4JB 5AK6A 3RG2A 1RPZA 4OPVA 2IYQA 4YT8A 4ZP1A 4JY7A 4TS1A 1RM4A 1QFXA 2QGFA 2ID9A 4HGYA 5D5PA 2CL0X 4TMTA 3V6MA 5J2UF 3RC8A 1Z16A 4FWBA 4QJ5A 2P4UA 1VL1A 3IB3A 4NFLA 4OGFA 4RANA 4TMKA 3BD9A 1K4YA 4BIIA 2UZAA 2G9QA 2OV3A 3D7SA 3DB2A 1XTPA 4KTTE 3F3YA 4JXXA 4LF5B 4FHZA 2G9RA 4RCVA 1VKHA 5EKSA 4IDPA 5FLYA 1L5HA 4OPSA 2PRJA 4BVBA 2OSVA 1CZRA 3RRZA 3EXHA 2TYSB 2ZIGA 5IKXA 2IX9A 4Y7DA 2DJIA 3D3WB 1ZJ5A 1O89A 1P2TA 4YRTA 4JI6B 1N8KA 4H4DA 4DNOA 4ENSA 1M0TA 5EGNA 2GN6A 3N75A 2DX7A 1UZAA 2PLRA 4IXMA 4WY2A 1F1JA 4MVJI 4BVAA 1J8DA 1JDVA 3PQCA 4MUHA 2QTWB 1IN4A 3R7BA 4RDLA 3ODGA 4LXIA 3IT2A 2OXEA 4JVOA 2Z4SA 5CT8A 4YCSA 3KQYA 2VA9A 4E7PA 4F97A 4ND7A 3HKDB 4WBNB 2VFAA 4RTQA 1R9JA 2C0CA 1C7FA 2D8MA 3HCRA 2Y92A 1BLIA 1MQ8B 2IYTA 2QF7A 3A7DA 3E9CA 3WSTA 1G0OA 5LD2C 4RVDA 3SR3A 1B0AA 2RGDA 4S12A 2YHSA 3SZUA 4EY5A 3QFCA 3TLJA 5KIAA 1RCTE 3TI9A 2OV4A 2R4QA 421PA 3IPAA 2C7PA 2KX7A 4MYUA 4JR0A 3IPXA 1U0JA 5FI5A 3F7NA 4NYIQ 1ODLA 4FIZA 1YZVA 3CLRD 1TGVA 4EFNA 2FLVA 1C30A 2HBZA 1CCWA 3GMDA 4NI5A 2QSJA 1FQWA 4P53A 4Q9DA 4BXOA 4LDAA 2E37A 3D5EA 1JH9A 1GUAA 1SUBA 3CXCB 1A96A 2AQ8A 5CDTA 2BOVA 3MYRA 4Z4IA 1C9MA 2EQAA 2HQSA 1QO9A 2OG2A 4OMDA 2QV0A 2ZUBA 4XOPA 3I4LA 2LNDA 3NS7A 1KH1A 1NVDA 2IP2A 4MVJE 1E63A 2OHGA 4N47A 4WT7A 4H6XA 5TPWA 3B3JA 2WINI 1L7OA 4J2TA 1SCUB 1ODFA 3QELA 2IGBA 1NI4A 3VDMA 4V1CI 1NB9A 1JSLA 4FGJA 2P78A 3WGTA 1A5BB 1GPUA 3H2JA 1TIBA 4JELA 4KQ1A 4ND2A 2VBFA 2NZWA 2TMKA 4NCBA 1QCYA 4KE7A 5JVDA 5KHOC 4BJ1A 1F7VA 3Q98A 1I7NA 1I3MA 2FXVA 2V6IA 2XSZD 4HNSA 4RS3A 4X8LA 2NO5A 2O8DA 8MHTA 2QRLA 4X90A 1C7JA 1DDIA 1NU6A 4HEHA 4PICA 2QUAA 2WZNA 4JT8A 3FCAA 1T0PA 3TKLA 2O2EA 3DDNA 4AJ9A 2G6BA 3H04A 2VYND 1L5LA 2J3KA 4MWGA 4LNUA 3I61A 3WWOA 2Q1XA 3A4IA 5JY1A 5FV7A 3AOEC 3DDSA 3W2IA 2AHOA 5EESA 5DFAA 5IVKA 1KVRA 4BC0A 3R74A 2Z08A 2HTFA 1XQWA 1NMQA 1SWVA 4PYIA 3T15A 5TS3A 4R4JA 1FTQA 2BKXA 2DFNA 3FFAA 4JX8A 4DCJA 1C7RA 1I1HA 3HCNA 4O29A 2CHEA 3CNOA 4PX2A 1VIAA 2WIDA 4W7HA 1SEPA 4C9BA 4R8VA 3SC4A 2DSTA 3ET5A 4EGCB 3DOUA 5EP1A 4NZOA 4BCDA 2IA5A 1Y8RB 4QD3A 2XA2A 3KZCA 3I5AA 1C4XA 1JMKC 1MH1A 1JI0A 1YZLA 1ZPDA 4DXHA 1LSSA 2EG5A 2WHQA 3AY6A 4MPTA 5C7OO 2B4AA 3V00A 3MERA 2HUPA 4AI6A 2OESA 3OU7A 4KAXA 1UBMS 2NVUA 2P6NA 4B4WA 4EVSA 3LE8A 2QDXA 1Z0JA 4RQAA 3FWZA 5D3MA 3GLGE 2P3SA 3RRJA 3A1CA 3NFYA 3ZI4A 3PQ2A 1SKBA 2C1ZA 2B83A 3EHDA 3FDIA 1KZ4A 1W29A 5EWMB 3TBKA 3ONUA 4DR6B 2FQWA 4MO9A 4KU4A 1RLMA 3WTCA 4CI9A 5CVUA 3U44B 4BP3A 5D3MB 2QA4B 4JT4A 4MKXA 3UT0A 3GG9A 3VU9A 3D7MA 2FUKA 2XCTB 3C85A 2D13A 3DEJA 3EWSA 3AM3A 3OA2A 1OBHA 5CIQA 3SS7X 3WO0A 2YZKA 4K9DA 2AUMA 1U1EA 2OCBA 1LSJA 1KSHA 1OB5A 2R8EA 2Z2ZA 3B6ZA 2FRVA 3INTA 4ITUA 4LHVA 1MRZA 3EBPA 4O4JA 1QVFB 5K0CA 2W6JD 1ZLYA 3E82A 4WECA 3AONB 5BXQC 4IHJA 1UDBA 3M4JA 3GLIA 1C1HA 1KRHA 5IBCA 4H7PA 1QV9A 5H68A 4Y1RA 1AZSC 3VBCA 5JJLA 4UVDA 3ZTYA 3ZLVA 2ARKA 2RJOA 1O08A 3PXGA 3DZCA 1ZHFA 3UJ7A 5KW9A 2WAXA 2WUDA 2ABWA 2AB0A 1IBMB 4Q34A 3VYVA 1Z37A 3NYRA 2LGJA 5AOVA 5GOTA 3OQHA 2JFBA 3PUKA 5KYUB 1KI3A 4UU8A 2JCBA 1CVIA 3BBPA 2PLFA 1RLJA 2PXHA 3DTYA 3FH0A 1S89A 4FEYA 4KFCA 3H05A 5U1PA 2PUHA 1EWTA 3CRNA 4UCQA 3WDMA 3W5DA 3B52X 4WN3A 4CR7A 2ZJYA 4WE3A 1RQ2A 4L8YA 2XRMA 4Z9XA 4LF4B 2EZUA 4XM3A 2H3EA 3FPHA 3K9GA 2DHEA 2HCJB 1NI4B 3QSYA 1KJYA 1P2BA 4NCXA 3Q3HA 4ER0A 3FCSB 1QV7A 1VRCA 2WEKA 3SDZA 4NBUA 1J8VA 1G5HA 3IQWA 2XMZA 3P2IA 1R5OA 1EVLA 4RZQA 1UJ5A 3DL0A 1XKQA 1BE0A 1UXOA 4RYDA 5KNBH 1HTTA 4XDGA 4YCNA 3FPAA 2WFLB 1QIDA 2R11A 3FHLA 4GP7A 4D4JA 3ZY4A 2LD4A 1P77A 5AQEA 3SZ3A 3K16A 2AVNA 1PJTA 2DKFA 3NHJA 1KD1D 1NX9A 5BR7A 4BFSA 3RV3A 4CDNA 4HZIA 3OCJA 4CUKA 5IYQA 3FOEC 2KB0A 3MD0A 3I6BA 4K26A 2X6WA 2WYVA 3OE1A 4NJMA 4CTKA 3FZQA 3IDZA 3PSAA 4FYKA 4K87A 4QGFA 2OZLB 4E33A 5AD1A 5HZGA 5LXTA 4M60A 4C0JA 4KYIB 3L8HA 4IY1A 1GYPA 1GN9A 1ADFA 3K32A 4DCVA 4LY3A 4A3SA 3CESA 4RF2A 4FGKA 4UTVA 1YL6A 1E9AA 1IVNA 3Q10A 1QK4A 4JLBA 4NBVA 5DYYA 4JI1B 3RC3A 3V4OA 3FSGA 2P3MA 5FL7A 1ZIOA 4R2WA 1KYXA 3LCJA 2AH5A 5LWHA 3E81A 5CA0A 5K5EA 1KAGA 3JALB 2RARA 2X5XA 2XXAB 3Q41A 4C4AA 1ZD5A 2OMEA 3DS8A 5HZBA 3MT7A 1TU4A 3FRJA 3LOUA 2CXTA 1Y8AA 1C7ZA 4PLWA 3VPGA 1LPBB 1WZEA 2PGJA 3PIIA 4HK4A 4HQLA 4Q3NA 5JQWA 2JIMA 4TX1A 2VDMB 3E9NA 1QHHA 4MEJA 1S8AA 3R7AA 3KKLA 4MRMA 4QHTA 3HABA 3U56A 3IQXA 2C9BA 1T4CA 2HEGA 2J3DA 4HD8A 5EGSA 1BHJA 4HE5A 3NHKA 3PNMA 4PTLA 5G53C 3W7AA 5FR1A 4ZTUB 2D0IA 2FMUA 3KV3O 4Q03A 1UMKA 3T9EA 4DWVA 4XEHA 2KI5A 3AI1A 1P0QA 2QTCA 1O57A 3PI7A 4PRZA 3EQZA 4LGMA 4CV3A 3CH4B 1GO2A 1H5QA 1UOQA 1XAGA 2P4HX 1W8DA 3RTCA 3RIEA 3VNAA 5ALUA 4GHWA 2V4DA 4N4AA 3HNRA 3H1GA 4HH0A 4KJXA 1ZA2A 4DLXA 3HU5A 3S8MA 3SBOA 3V80A 4BNNA 4UZUA 5CA1F 4IDHA 3S6JA 1L1QA 3ORQA 1LRJA 2J1LA 3N0VA 1TK9A 2A9RA 3Q3CA 3V4RA 1RZRA 2FW9A 1K98A 2BGKA 3KHKA 3STXA 1QP0A 3RYCB 3I9FA 4NPAA 1SBZA 4TUYF 1J0CA 1T5DX 1MOZA 4HTAA 4N01A 5AICA 3IQZA 5FULA 2ZBDA 3TMYA 3VZQA 3KYIB 2UXBB 4O4HB 3CRRA 2CNLA 3GBPA 4L2IA 4NP6A 1ZOPA 2ZU0C 4PBRA 2P69A 3RU9A 3AVXA 3UEOA 5JADA 5DM1A 5IT9A 5C53B 1N9GA 1T3ZA 1T8TA 2HPVA 1RBMA 4FLEA 1KI2A 3PL5A 1OX6A 3T0GA 4A2QA 4BBZA 2OO5A 2Q3DA 2Q07A 2XDWA 3AVPA 4L85A 5ITSA 1FJGB 4YDRA 2D5CA 1QFSA 1CQXA 4UU1A 4QLBA 8ABPA 5LM3A 1DJLA 3L1UA 4DVJA 4GLOA 2IOQA 4HGZA 4JLJA 1HT2E 4ND8B 1TYAE 1ZOIA 1QIIA 3AFOA 4WY5A 3SE0A 3KR2A 4BN0A 5BVHA 2O8EA 4GXQA 1J39A 2VJYA 2XA9A 3NGMA 1CQWA 4ZCSA 2HV9A 5BRNA 4J9VA 4BFZA 1JG2A 2J8ZA 2PD4A 2E4XA 4AUEA 4L0CA 1EH5A 3MT0A 1FQOA 1B1AA 5HIJA 3U7EB 4KDCA 5MN4A 1BH2A 1E5VA 4NHOA 3ORSA 1N7IA 2HYIC 1Y98A 5DM70 4ZGNB 3EVFA 3GZJA 4GC5A 5LYYA 5E0OA 1TTTA 3L93A 4XGKA 2GBIA 4IWNA 1VHOA 2IJGX 2PFSA 4C5CA 1N06A 4I4NA 3L84A 1VQNB 3VVMA 5HQ3A 3D8RA 2EG9A 3RT9A 5HQJA 2J0SA 5GM1A 4NTZA 2AQKA 5C8YA 4C04A 4NBLA 1D6MA 1I0LA 3ONDA 4U7GA 4ZHQB 2QD1A 2O59A 3NVMB 4GX0A 4HXYA 1F0PA 3T9AA 4EOGA 3G6EB 3DHNA 4DLYA 3PVCA 5GJWC 3T9FA 2QJTA 3SSNA 1A98A 1TJ3A 1I6LA 3LUCA 1WUIS 3I9JA 5GVRA 2G80A 1OHHD 4YV2A 1O94A 4F8YA 1HMPA 3TO5A 4FVTA 1Y63A 4ER3A 1X1DA 2BR5A 2D4AA 1BRMA 2O06A 2OAQ1 2VSYA 2QRQA 3FYSA 5E7QA 2NTNA 3JQBA 3K2EA 4WZTA 3HJAA 4U6QA 1Z4IA 1RRGA 2ZRIA 1AZWA 2P6PA 1M9NA 2VHJA 1BEEA 1GFSA 3FVQA 2GJRA 1CIJA 1A50B 2IXGA 4FDMA 3RIYA 3SZGA 9ATCA 4QHYA 1JQAA 1MF7A 3QH4A 2Q6LA 2PX4A 3FOBA 3FRIA 1Y9DA 5T64A 5DTEA 2CKDA 1VFPA 1MT3A 3GUHA 1TAUA 3OT1B 1A5TA 1QHNA 2YN2A 3IP5A 4NG5A 4NMWA 4KO2S 3ZTWA 3CHYA 5ADVA 4X6XA 3EDQA 1CZOA 4OFXA 1K68A 1BS9A 1FUYB 2FWIA 4HZUB 4E32A 1WUYA 1Y3FE 1PFGA 4RK0A 3TW0A 5LU9A 1E0JA 3I2IA 3VUEA 4WXHA 2R60A 4OHPA 1T4CB 3AEXA 4PPYA 3B3QA 3AHDA 1JLKA 2DBZA 3F0TA 4YGXB 3U60B 4G37A 1TM4E 2V59A 2V5AA 1YZUA 1W0JA 4XWAA 5DK6A 2J7PA 2JGDA 2IQ5A 2IS6A 4K9PA 2UYCA 4CXMA 4Q3LA 4NK5A 5CU7A 1N1GA 1NW9B 1WKVA 1AB6A 2AS0A 4QTYA 3R9KA 1SC1A 4DHEA 4QQKA 5TMBA 3O91A 4G2NA 3B1WA 3BMQB 1DX6A 1P2DA 1Z18A 2PM8A 1I3CA 4O2BA 1KJQA 2WKRA 7REQA 2YYSA 3PE6A 4XVUA 3GEHA 1ESNA 1KL7A 2R5NA 3L6OO 3QVOA 4UCWA 3BIFA 5DU2A 5SY6A 4QM7A 1XCBA 4PC2A 3QQ5A 4GECA 1H2WA 4KKTA 3KALA 4XYEA 1SUWA 1O8BA 3U1TA 3F49S 4FBGA 2P9YA 2L18A 1EVKA 4DM3A 4JZKA 4O5OA 2V7PA 4F2HA 3P2JA 2CB9A 4LF8B 4HAIA 1LPPA 4EIWA 4MQFA 4QXQA 1UT5A 3LM8A 4MUBA 1RHQA 2GWRA 2RGXA 2ZUFA 4B0PA 4UVIA 4YCMA 3Q3AA 1SURA 4NNJA 3TLXA 3N0XA 3FYUA 4EQZA 1XKTA 3KT0A 3L7OA 4K2AA 1KJZA 1HI9A 3UENA 3L0IB 4HO1X 2DR2A 3REGA 2QE7A 4TMYA 5CJPA 4MTLA 3VYTB 3PTZA 3VZRA 1FPQA 4MR8B 1X3LA 4UTXA 4TYNA 4M22A 2IITA 2JLUA 1ECJA 3KDPA 3DOFA 2WIBA 4EMSA 3HYLA 1J07A 1O6GA 2JCVA 3B3FA 1BNCA 3RU2A 2I5PO 3BMQA 4ILKA 4GEKA 3S7TA 4ZT2A 4L3VA 2ZCJA 4OX9Y 2OGSA 4GMFA 1K8XB 3I1FA 4HYYA 4OOFA 4PSKA 4R83A 5GJCA 3GJ8A 3TZHA 4F86A 2VHQA 4CLRB 4FZ5A 4YJHB 4BJ6A 1JQBA 3SJCA 2YZMA 3EFOB 5AXCA 4HVLA 5B6IA 4MICA 2F3TA 3SJPA 4B2IA 4NS1A 4WLOA 5JXGA 1SY7A 2A5JA 2WJWA 2OC9A 4DLWA 3SJZA 4TYQA 4H1TA 1ZINA 1I8TA 4L2IB 4TM7A 5FJJA 4BBJA 4WACA 1TM5E 2FZWA 4ABTA 3UK2A 3LPMA 3WYEA 4YUXA 1NHGA 5KVSA 4ATNA 1NSYA 3N5KA 3SFVA 3TLGB 5F2OA 3IIIA 1O0BA 1EE9A 3I9MA 2Y4OA 4ROXA 1Z0ZA 2YXDA 3RTAA 4ZI2A 1NJID 2BISA 2I6QA 4QXRA 1NRJB 3E7PA 1U5CA 5HTOA 1EE1A 1QIGA 3GJZA 4PQGA 3GO4A 4KXQA 3KJNA 1EZ1A 3GIWA 1URPA 3PQ4A 5EEGA 4C78A 2VP5A 1HZZA 4E5UA 5JANA 4MZXA 1RE0A 3AUUA 4MI3A 1V5GA 1P1RA 3CPJB 5CVJA 3L9XA 1Y4UA 3VAZA 2Y71A 3HSKA 3ORRA 4KQKA 4U6NA 3VHRA 3ZEIA 4BLVA 4EKDA 2Z8YA 2GPSA 4CMCA 2CE2X 5EJMA 4JMQA 1KMHB 2BP7A 4D0LB 4DTCA 2A9KA 3WG9A 3WL7A 2ZUWA 2LWIA 1QXSA 2NW6A 4NOMA 1P0MA 1UJBA 1QE5A 1L5RA 3EPRA 2HBYA 3GXOA 3HB5X 4AJEA 4LDJA 4G2TA 2CLIB 4PGAA 3HRIA 4HYEA 3H42B 3DFZA 1TKRA 3ZYZA 2HNBA 1M8FA 1XJ0A 3AXSA 3EXAA 3JAWB 1C2YA 2QJOA 1EFTA 4HMQA 1XZMA 3OOCA 5AM0A 4BHTA 4B3IA 4C89A 3GEDA 1RAEA 2ZSFA 4OAQA 5J43A 1SFRA 1I0IA 1BYIA 1MAWA 4G8CA 3DE7X 1AMOA 2IYRA 5G4LA 1PJ7A 3KX2A 2X53S 4B34A 3LT5A 1YR3A 1QU2A 4DADA 1FP4B 2F3UA 2GCPA 4N39A 3IXLA 3HDYA 4M0FA 5F3DA 4D99A 3IOBA 4I1IA 3RI3A 5C1OA 1H6CA 1ESMA 4H08A 4IJ5A 3G0DA 4JLDA 5AW4A 3QEJA 4QU0A 4CG2A 1XR3A 3ZQ4A 2G5GX 1GA6A 1A7UA 3BMOA 4Q02A 5DHRA 5KWEA 5EIOA 3QENA 1IIRA 1Z6QA 2B1JA 4J1TA 2E4ZA 3DPSA 4II3A 1J8FA 1I1OA 2WW8A 3ZU2A 3LQ1A 1UOOA 2V65A 4MYRA 3VGJA 1EFAA 1Z34A 2QRMA 5AW7A 4R3UC 1YUNA 3FIUA 5H1YA 3I2YX 4L57A 4N49A 5CXSA 4JBGA 3K09C 4I66A 2R4TA 5A71A 1JG3A 1OI2A 1UZNA 3H5IA 4H7KA 3K0CA 5U4QA 5LQAA 3FZNA 4E4TA 2Q3LA 1KQSB 1TQ8A 5EQFA 5CB0A 4Q15A 5I8WA 2P5UA 1B1CA 4LZOA 5SV2A 4Y2RA 3VGPA 2W2MA 1I32A 4BX3A 1M8PA 4D41A 1D03A 1E9FA 3VSCA 1AIPA 1HG0A 5DEIA 4FS3A 3TZEA 2XD4A 3PNBA 1W8IA 2HIGA 4BMCA 5T5QA 4V24A 4LC9A 1C4WA 4YI3A 3J7TA 3RF7A 4QL3A 2JFOA 4XQGA 1S6YA 4TSKA 3WIOA 4MH0R 1NOJA 3HGQA 1VIDA 3IUBA 3GI1A 4MMZB 4E0FA 3OTGA 2V7BA 3SBEA 2JGAA 3DEKA 3QWIA 1U7XA 3EG9B 3PS9A 3SDSA 1ATIA 2DP4E 2G8NA 4PSCA 3FOAA 3VAYA 3WNZA 2OXFA 3CKMA 4RPHA 3K53A 1XUOA 5LDGA 1EJ6A 2OOKA 1SIBE 4Z7NB 2VG8A 2QJRA 1P2FA 4RVNA 2YHAA 5C4MA 3I9LA 3SJBA 1PNTA 4TWIA 1ULBA 2BFPA 4QSMA 3ND8A 4CMGA 1U2GA 3GUUA 2EDCA 1TLFA 3M1YA 4OKIA 3DE0X 4GZMA 1NXQA 4BX0A 5CFMA 2DYIA 1V35A 3ED5A 1IY8A 4MNTA 3SIWA 1Q17A 3EC1A 1GG5A 1GT6A 1QHXA 4EHIA 1E9CA 1NM5C 2UVPA 3UHJA 1N08A 4AY2A 1SO8A 2O2ZA 3ZH2A 2EJVA 2VHWA 1RADA 3LQQA 1UKCA 1TZJA 2DFPA 2FPWA 3KKKA 4UNQA 2OG1A 1B2RA 1VGVA 5ENDA 1E3JA 5HS4A 4MKFA 1R4ZA 2HIMA 1AK2A 1GQRA 4I55B 4U7PB 5AHKA 5NLLA 5I7FA 4EMUA 4DSNA 1N6RA 4BNHA 2XOKA 4OMUA 2AOWA 3AGPA 3CONA 1JSZA 4FSXA 4M8IA 2Q2NA 1XCGB 1E79A 4XGNA 1IJKA 1ISSA 1XSEA 2A6PA 1G9XA 3FOWA 1F2UB 4QGAA 2V6GA 3TL3A 1LBIA 1RYDA 5JYEA 2PL1A 4PYQA 1FDWA 1RRPA 4HGPA 1U8TA 4KXWA 4E1VA 1LS6A 4JP1A 4EP1A 3MA0A 3ENNA 1ZH8A 3C3DA 2Y0BA 1BXRB 1D09A 1N5RA 5K0JA 2BJHA 5JEDA 1COZA 2BW0A 3NBUA 2VWQA 3QNMA 2Z30A 4L4XA 3P71T 2E3JA 4IJ6A 2PKRA 3DMGA 4ENWA 1Y5MA 1B6SA 4MUJA 4BVLA 2VTEA 2ZUTA 1X7YB 1H4SA 1UMDB 5EIBD 4GMHA 5A06A 1Z5OA 5EC8A 5LXTB 1E4YA 3CT4A 3BDAA 2NIPA 4GOKA 1QUEA 2EBUA 2YWDA 2X40A 4DYVA 3GFFA 4ENUA 4BNMA 5C8YB 1N2ZA 3VSAA 3C14C 3DOIA 1JAYA 3JR3A 4J94A 1ENZA 3I2FA 1WWKA 1Z0FA 5CUQA 4CIVA 4KHZA 2CNNA 3KEGA 5BYJA 3Q39A 4OQDA 4C21A 5BUSA 3V8EA 3NBZC 1YA8A 4GM0A 5EJ6A 1R27A 2GEKA 1UT6A 5CYFA 3WIVA 4YRGA 4PG5A 2JS7A 3P9IA 1P29A 3DMTC 1IWOA 3VJLA 4M53A 1BW9A 1RE1A 1KTIA 1EVYA 3NIWA 2ZE5A 4YQEA 2JIDA 1Y7LA 3LCVB 1T5IA 2NXWA 4RXTA 4F7DA 2BVNA 4D9JA 4OQZA 4P25A 4ENQA 1F60A 3GOHA 4XW2A 5GJVC 2I62A 2YUIA 5F3WB 2G08A 2XECA 2QYTA 3GX1A 3N8KA 2B82A 1Q7RA 1U3WA 1YR9A 1FPMA 2QM7A 1DAHA 2YOGA 4GOND 5EFOA 1HPLA 1R8JA 5DULA 1JEYB 2O2GA 3HWSA 1XMIA 1WOPA 2PSFA 1O95D 1E0AA 1NYLA 4RLHA 5KYYA 1YKGA 4FCVA 4L0QA 1ZH0A 1WMEA 2ZR7A 1S72B 3ASZA 1HKUA 2HLPA 2AXQA 3JZMA 5IM4A 1AF7A 2IZ7A 4X6UA 2QG4A 2JZNA 3IP9A 5EZYA 4ZT6A 1XAIA 4M9ZA 4F5DA 2BR3A 5HXAA 2XZLA 1MX5A 2J9XB 3KOMA 3RE1A 3FGOA 3NORA 4BO8A 4QQRA 4CF7A 3TQTA 1ITZA 1USUA 2C58A 3NV9A 3SXJA 4AKSA 2H4HA 4ECAA 4MW4A 1U0LA 4WCFC 4LYEA 3JD4A 4QOEA 2CCGA 4WDQA 3SLNA 1XJ5A 1VB5A 2XB9A 1FVHA 1Z12A 1S5PA 2ERCA 3PRYA 4OYRA 2FOLA 5I9TA 4MGHA 1M1KD 5TARA 2IW3A 3MPOA 1A4UA 1Z4OA 4V0MA 1RRFA 2V9CA 1A2QA 4X84A 5JSQA 1XJCA 5JO9A 2XGOA 3O94A 4EZIA 2IS1A 4DR2B 4QBGB 4IIBA 5AYVA 5B3LA 5JCJA 1H0RA 2ZR9A 4OP3A 2PLNA 2WWXA 4A0SA 4FE4A 1ZW1A 3KPUA 4I3FA 1AZTA 3TRDA 4IDQA 4B2YA 3GJRA 4MINA 4P4TA 4Z1OA 4LWPA 2EP5A 3KHUA 4MITA 4LBVA 1LTKA 1ZMRA 2H65A 1U0BB 5C8XA 1RTTA 1YB2A 3RAFC 3A28A 3ILXA 3NKVA 1DTEA 2N0SA 3GRPA 3T3DA 4LBYA 4DLSA 2RK6A 1NV9A 3VPHA 3G5UA 4K0RA 4BWYA 5J59A 1W47A 4FU0A 3L1KA 3AJ8A 3I9OA 1VHLA 3BHNA 4H15A 2GD2A 5A7HA 5F7JA 1V71A 4YRKA 1K7EB 4C4YA 5GY7A 1XLTA 1BDIA 5ED4A 2WP8J 5F5XA 2WMDA 2CMDA 4JX9A 2W22A 1V9LA 4LWQA 3UWKA 1II0A 1SOVA 3R7DA 1WIWA 4RSMA 1V8BA 2FGJA 9GPBA 1BC5A 2I3AA 3ZDZB 4IW3B 1NWHA 2OQRA 2RSLA 2X22A 5G0WA 3T4PA 4DPLA 5E1MA 4V0NA 1OC2A 3CEPB 3T9DA 2JD0A 2F9MA 2XMDA 2GAFA 2C3UA 2BKVA 3WLIA 2C61A 3DTTA 3EXG2 3IX7A 4RIHA 5HRUA 2BTEA 3OU2A 2OQIA 1CF4A 4G24A 1GL3A 4CG0A 5KVVA 4FN4A 1G98A 1KZYC 3M3PA 4GNRA 3U7JA 4OUDB 1KC8D 5BOSA 3AI3A 3FHCB 1H94A 1G8FA 1NTRA 3M82A 1H2ZA 2P35A 4G1FA 4LJ7A 5D1HA 5B64A 1G38A 1KJJA 1VA5A 2B2NA 3MWGA 5H0IA 2DWUA 1BMTA 4ND4A 3U3MA 4JJZA 4O4HA 3WIEA 4CGYA 3OJ0A 3AM4A 1XD2A 1SCUA 3KL2A 4MGYR 3TI7A 2QOEA 1GPMA 5C1BA 1XN4A 4KJZA 2Q4OA 1CRPA 4WSOA 1MG0A 1QH9A 5SZIA 1B43A 1N3LA 1ZG3A 2ODWA 3R23A 1NRXA 1CW2B 1KGSA 4FYPA 3BMNB 3UATA 1AGYA 2IIVA 2ODBA 3ZGLA 1UP4A 3TDNA 2FGKA 1OYVA 5EWLB 4KX3A 2DB3A 5K8TA 4XUDA 3VR4D 1M6NA 5BNZA 2PANA 4XQEA 3T7EA 3C97A 1YO6A 2E4VA 1E99A 1HR0B 5BR8B 3A1NA 4QYIB 1O0SA 3PPYA 3Q5DA 1BN6A 1UDRA 2Q2VA 1C9KA 1S7CA 1WM1A 5BSYA 2D1FA 2Q9CA 1N2OA 3MGBA 3CVOA 4R1SA 4IXWA 1ZFNA 2YQZA 3SR4A 3VR2D 5ELXA 3GGOA 3I04M 2FETA 3GLHA 3V8VA 2G4CA 2V1XA 4UHFA 3TQQA 4D97A 1NFRA 4WZLA 3AUXA 1XTQA 1P18A 5BV8A 4EAQA 5EHQA 1FQKA 1H1TA 2AFRA 2D1YA 3C8DA 3QVVA 2DECA 2RONA 5K0LA 2WIFA 5AUPB 1NG9A 4DK0A 1Z6ZA 1YD7A 2QN2A 3ZHUA 3PHHA 4ACBA 1MPXA 5HUJA 5LMCA 3KJIA 3X43A 3JRNA 4QEDA 5AOCA 4JK3A 3A4TA 5JJBA 4H2DA 2AR9A 3EF3A 3OEHD 5REQA 4QYXA 2PR2A 3SHTA 1C9YA 1SG6A 2WIJA 2OHVA 1G6OA 1UODA 4TKUB 3VBEA 3IEUA 4BATA 2G7MC 3SBDA 2YFHA 1JWAB 2UZ0A 1VYHA 1Q15A 4GF5A 4FNGA 3EYAA 3EXEB 3R5KA 1JIVA 3WR5A 3RVNA 1A9XA 2NPOA 1LQTA 3OFVA 4AECA 4HUJA 3CCCA 1Q82D 4PQYA 1MENA 3SHWA 1AKVA 1E7QA 3UK6A 4MGIR 3CB2A 3MOSA 2V6BA 4TRRA 3I53A 1E8NA 3Q15C 4RFSA 1XQBA 5CNIA 2E1RA 2ONKA 4BNDA 4OGWA 1EXNA 2O3QA 3RBZA 4EEZA 3INRA 1SXGA 2GXQA 4HVTA 3V4VB 1DU4A 2WWFA 4UAGA 1SA0A 3R6DA 4PWZA 3IV6A 1BO6A 4KGZA 5FUXA 2WUEA 2DPXA 1UK8A 2O0LA 2QM8A 1AKQA 3C4VA 5CNJA 5ALDA 3MB5A 3TNJA 3ZW7A 3P5BA 1X2BA 2YIVX 3E3AA 4QXMA 3R76A 2DUWA 1A27A 5HGXA 5A4DA 3HKCA 1P39A 3TDMA 3DXZA 3CPXA 2IWHA 1YQGA 1DQRA 4ZEVA 1JJVA 4MR7A 1FNCA 3BB1A 3Q9UA 4TQUS 5B3AA 4BGVA 1DSSG 3WWYA 1I10A 3HJUA 1T6BY 5LFAA 3W5VA 1CD5A 1FRZA 4WL0A 4QU5A 1JAZA 1U0FA 3GGPA 3V8RA 2X5OA 4R2MA 5FTKA 5AI8A 4HWSA 4N5IX 3RRMA 3K3PA 2ZK7A 3UAXA 1XX6A 1IY0A 4F1WA 1WLYA 3KFVA 1PKVA 4LDPA 3HL4A 4A03A 3MTJA 4BO3A 1V4BA 1ZSYA 4QHSA 3RO7A 3SG0A 5DN6D 1V3UA 4F93B 4L78A 4TTAA 5A5GA 1GAJA 1OLOA 3OF2A 5I7HA 5EHZA 5EE0A 1UC9A 3OKAA 4G0VA 1UPXA 1NW4A 4FWTA 1H1LB 3A9VA 1PEAA 1M6WA 3PHCA 4AP9A 3S3TA 1F3LA 3TCKA 1YK0A 4O25A 1XYGA 2JHAA 4D9NA 1YMVA 3FJ1A 4D0NA 1Z8FA 1RI4A 2N1BA 1SC3A 5JZ9A 5LQRA 2I1WA 5BN4B 2X5KO 2DUJA 4X1KB 2W4MA 1E3WA 1NZFA 2UVQA 2PWYA 5LL6P 4DQDA 2PKQO 2GBLA 2J09A 1YCGA 3PYLA 4DV4B 4AS1A 1LDGA 3U4QA 4DA6A 4MSUA 5ALZA 4L0DA 3CZ9A 3VKGA 2H2AA 2VWHA 5HE8A 4RJIA 2R87A 1TRHA 3PLRA 5K9ZA 5BN4A 5I01A 4M9RA 2R1ZA 1OMOA 4L4SA 1KMIY 2ZJ2A 3VFDA 1KAMA 1Z4MA 4Q1BA 4YHBA 1OLXA 4PHGA 3V1YA 5F4JA 2X1HA 3PT5A 4BE7B 2C31A 4LY0A 4DKJA 2VA8A 3E22A 3B1JA 5LP6F 1ZEMA 1EX1A 3I0MA 4JIGA 4EG7A 2QD4A 4PX5A 4ZIRA 1IPFA 1PFQA 1CR0A 2UZ4A 2X2FA 5TVKA 5TY0A 1YRQA 3G59A 1FYDA 2PRZA 3O83A 1W94A 3ER6A 3OUTA 3U40A 4CMEC 3ERCA 3PJDA 3QWHA 1P4HA 3WKCA 2EARA 1Y7TA 3IBTA 5CA0F 1AE1A 1GNRA 4WAUA 5JYDA 3KZVA 4CPDA 3ZG6A 2C7OA 1XELA 3BGSA 4ZXPA 5CR9A 1XF1A 2GVNA 3PFNA 4RVGA 3D8HA 1KFEB 3U19A 1GU0A 3UOAB 4P22A 2GASA 4U2GA 2P65A 3JQFC 3FUXA 3OLCX 4L3OA 1E1QD 5H5JA 4RDIA 4YFVA 3U7IA 4Y0VA 4DNTB 1BVUA 4EG0A 4QQFA 2R9VA 5JAIA 3MCZA 1QKKA 4YA6A 1R3UA 4H1HA 2DPMA 2KVOA 2GPBA 4LTDA 4PYMA 4O02B 4OQYA 1ZW6A 3BJZA 3L7AA 4TVBA 4BMXA 2QZSA 3ENQA 2BELA 4ZV4A 3A35A 3BCUA 3OEED 4QLAA 2HMWA 3CN9A 5ED0A 4YCLA 2Y8EA 1P17A 4E5SA 1ENPA 1SKQA 5BSUA 4YEJA 1KKUA 3OQJA 2NO9A 5K2MA 1MOPA 3DE4X 3W06A 4B2LA 3FBGA 1NVAA 2YNMC 5JJCA 1I6WA 1IBLB 1FNDA 3JARA 2WD7B 4J3NA 5AKEA 3VVCA 5FWNA 2Y2UA 3C3YA 4HGRA 1E1MA 3QYJA 4BNDB 1FJXA 1XTJA 4QXAA 2UZ3A 3TK1A 1J9ZA 2NV2B 1RXVA 4J0QA 3MXTA 1TJ4A 3DXXA 2YUTA 3P5SA 2X5NA 2Q3MA 3FB4A 4HMPA 4ALNA 2WHXA 2NU6A 5T4EA 2A84A 5KYYB 4BMPB 3RM3A 3GJ7A 5CLJA 1N8SA 4GMKA 4CM9D 1AJEA 4DXDA 1AQNA 4J1QA 1AT1A 3KOOA 5TR9A 4LXQA 4RV9A 1KAHA 2MJLA 3TCXB 3BWDD 3H5OA 4EYOA 3KFXA 3LGXA 4YK7A 4YRIA 1YX2A 1H2RS 1N6KA 2ZRKA 3AKCA 4J2OA 2O8NA 1KVSA 1DEAA 2CDAA 3BHJA 4JEIA 5BPHA 5K01A 3D1LA 2BMFA 1JFFA 3RBVA 5ICFA 3KPVA 1QORA 4TXLA 2GRJA 1DOZA 1PAUA 4RH3A 4CQNA 1S2IA 3BB3A 1JTFA 1T5EA 1E59A 1YH3A 2J48A 4WI1A 4RM2A 4ZC8A 4B75A 3H19A 5FPKA 1D2HA 4DSUA 2CW5A 3RSSA 4A27A 1DRUA 4V2IA 4Z8YA 4X63A 1XTRA 2V7WA 1NV8A 2YS6A 4WGGA 1THGA 2IXBA 4CBVA 1C3XA 4RTJA 5AHOA 4EM6A 3KB6A 4RJ2A 1QUFA 1XK6A 3PXXA 5ALWA 3QFRA 3IUSA 2RI0A 3RYHB 5L4NA 3L0CA 2GJ4A 5K3CA 3AK4A 4UQOA 3R7NA 3TPCA 4F45A 3AY0A 4U5QA 1KERA 2JIPA 5KDDA 4AVZA 4BE9A 1Q0RA 1C1DA 3B51X 3BRCA 3OLZA 3TPFA 1MJGM 4B46A 1XEXA 4ZN6A 2AHRA 1XTVA 3EW7A 1S1CA 1VBKA 1XD8A 1EUZA 4CQMD 4GYWA 5I4BA 1U1CA 3EZYA 1LBQA 2R8OA 1WULS 1SRQA 2GM5A 4CL0A 2UXDB 4UPVA 2ZB4A 2W83A 1D1NA 2IFTA 3H11A 4D9MA 4G5FA 3SXUB 5JISA 5JQGB 3AG5A 1RABA 1XYYA 3W6ZA 2NP6A 3B6JA 1VJ1A 3AQ4A 3I2KA 3HHEA 1G7TA 3MUFA 4KN6A 2J5KA 4X7EA 3M34A 3N74A 4UATA 3A4YA 5K0NA 3RYCA 3E1YE 5I7EA 5JE8A 4LHSA 4C4RA 1GPNA 3MIIA 3KPJA 5GZ3A 3R4CA 5EVJA 2B92A 2A86A 4AZVA 3ZWXA 1DXOA 4YI5A 3RRYA 3DBOB 3MAAC 5DM4A 3SD7A 4U3JA 2CFIA 4TV8F 5KTTA 4V0SA 4JS0A 2LZ0A 3QKWA 3TUJC 4MJLA 4X24A 4YRQA 3TE6A 5BQXA 4R3WA 2A9JA 3UVEA 4ZO9A 1T34A 1Z5VA 3G17A 1GFZA 4AG6A 1GD1O 4CCAA 3A9RA 1JHDA 2PKEA 3OC6A 1BHO1 4YWJA 4DLAA 4ZT3A 1ZGZA 4OSEA 1QHGA 3KLPX 5FUQA 2V6FA 4NJEB 2F00A 4RCZA 1AM4D 1Z4QA 3PZRA 3SLKA 1HYBA 3FDZB 8OHMA 1A7KA 2FPSA 3U48A 1FSGA 2VZ8A 1D2AA 1ZZEA 1ZNQO 2X0NA 2PCLA 1CHDA 1DQYA 1LSUA 3EA4A 3L49A 3EEFA 3PJGA 5F7ZA 3VTKA 1DELA 1N4AA 3ROQA 2ZB8A 2C2HA 3C6MA 5E8RA 3A6LA 4E13A 2OBSA 1N0VC 2BTQA 4IWYA 2AC4A 4LOJA 1MEJA 2A9PA 2DVMA 2EIXA 3QF4A 3DFKA 2JI7A 1RJDA 2LTAA 4RGVA 1NPYA 4U00A 2Z6QA 1OFUX 4TLAA 1FOEB 1DWOA 2CL6X 2P0AA 4BMZA 1EU1A 4YEDA 2ZB2A 4E5KA 4DDUA 1TF7A 3C7CB 3KRTA 4PGMA 1EDDA 4Z3DA 2FW7A 4QU9A 1KK3A 3OZWA 1AGXA 1G42A 1QO0A 2D00A 3DVQX 3K0CC 3PQ6A 4I8XA 4RENA 4BASA 3UZUA 1K6IA 4EGJA 3QSGA 3VR3D 1OH6A 2Y0EA 1NC1A 1QLJA 3ZJYA 4KXUA 3AFMA 2C5EA 3SR0A 3KQUA 1WG8A 1XIVA 2JFUA 3CLUD 1ECCA 4IGEA 4XKJA 3D4IA 4KR2A 4M0KA 3ZE0B 3UC9A 3K5IA 4MKRA 3K70B 1Q1GA 1Q1BA 3D2BA 3SKBA 3FTFA 1V9CA 2IYWA 3BJMA 1IOWA 3KKNA 3HDQA 3FBWA 3GRFA 1WDLA 3M0EA 5F35A 1N7HA 2B36A 2XA1A 5AI6A 2CLFB 4RNDB 3ZY5A 2ZT6A 2C9CA 3KLMX 3D3KA 1CR1A 1A5AB 1EBBA 1FYFA 1RRKA 1NVVR 4EENA 1VJSA 2I03A 1YT5A 2WA1A 1M5RA 2HMTA 2JFGA 4R51A 3JX9A 4TS9A 2NN3C 3DKKA 1X1EA 4KR7A 2WG1A 5IW8A 2WWYA 4EHBA 1HE8B 2NV0A 4YTEA 2JGLA 3KSRA 5CM2Z 3WFZA 1XTZA 3DXYA 2WWVD 1YOBA 3WAGA 2QD3A 1JWLA 1W85A 5FUYA 4MGZR 4UDNA 3SYRA 1RSZA 4X7DA 3V7AA 1TVKB 1FW6A 4ZOEA 1BQEA 3T3EA 3BXOA 2BLLA 3TEMA 1T9KA 1Y1QA 1EQUA 2JJ2D 2OZKA 3BKWA 4K6KA 1E2BA 1XQVA 5DI3A 4CMBA 3CY6A 1EWKA 1FXWA 1ZIXA 3NOQA 4EO9A 1SUIA 3VO1A 3HYSA 1X87A 5LWQA 1M73E 4Y18A 1D5CA 5LBUA 1CZHA 1T5HX 3FN4A 3LAWA 4DLRA 1Z88A 4HS9A 4R1TA 4QKQA 5AQ1A 1XALA 2OO3A 3AM1A 5JMTA 5KTKA 4DIBA 5DISB 2MOKA 1EP1B 4D74A 4LVCA 4C87A 3OP4A 1IULA 2CUTA 3GPCA 1YHNA 2PMBA 4BMYA 5DBEX 1S2GA 4RYLA 3L4KA 4FGSA 4IIUA 1EFRA 4RPBA 2GZ1A 2B8TA 3GWGA 4J0JA 5DV9A 4MS4A 3PT9A 5KTOA 3B38A 1ABBA 1DUIA 1EWVA 2YWRA 1DIBA 4I14A 5LUBA 1UWKA 1V16A 4TYYA 5IYPA 3G2QA 1T4DA 1WMDA 1C14A 1K8AD 1ES9A 2H18A 3D6MA 2I4RA 1JZQA 4PEVA 3WWPA 5J4KA 1YFJA 3PKZA 3VPAA 5LKRA 1GZSA 2H5LA 4RTMA 3K0KA 2VUIB 1HBJA 3BGVA 2J6HA 5EMKA 1UBEA 1UMDA 5TF0A 5KYVA 4D44A 3HXMA 5JYBA 3LVBA 1ZD2P 4Q18A 3DAHA 3P9NA 4CVNA 2ZE6A 1U7PA 2J41A 2H2WA 3ADOA 3O73A 4PY2A 4TXJA 1H0HA 1UANA 2R6JA 4U2CA 4UHEA 2GJAA 2BZSA 1OY1A 3B85A 3VU0A 3FVTA 1UJMA 1QFZA 3R3VA 3W7VA 5IJ9A 4YRNA 1IZ7A 4TKMA 4EEKA 2IXAA 3R41A 3O92A 3ZCSA 2CBXA 1U6KA 3USES 5AH0A 2DIEA 4KNYA 2R8XA 2Q3FA 3V2GA 2ZVPX 1T9ZA 2VSNA 2IHBA 3I34X 2QE6A 5IDWA 3RAEC 2CGEA 4MDFA 4ZHQA 1DE0A 4L08A 2PPVA 5CHEA 5IEBA 3RKSA 1M66A 3EQ6A 4FOTA 2FRDA 3OD5A 2AG5A 4Q3OA 4ZVNA 2AI3A 4KYTA 5JCOA 1MJNA 4G89A 1NI5A 3WL4A 1RQRA 1QWSA 3DV0A 3HN6A 4L73A 3VYSB 4IJVA 4KGVA 3WHPA 2HRZA 1JFLA 3IBYA 4X66B 3RRFA 2RC6A 1JMYA 4DRYA 1Z5UA 3MRTA 3CZ4A 5DBGA 3KSMA 3ZDYB 3EUWA 5AVKA 1WDWB 1QQ6A 2VHYA 4D9EA 5JDCA 2O50A 4XQ0A 2VBTA 5HPYB 4Q3AA 5K8LA 5I47A 4EAAA 2FG5A 4BRWA 2QK4A 4YLYA 4AC9A 1ZUNB 2QRKA 4GQAA 2V3WA 4QUZA 5IYRA 1OZHA 2EZ8A 4NYJR 2ZWOA 1WDTA 1M6VA 1BXGB 4HKTA 2HRBA 4QPCA 1AD2A 4FSDA 2QIPA 2O8BA 2H4ZA 4NZMA 4ZQHA 2GZDA 1P1FA 4KXMA 4NECA 4N1AA 1RZRD 4KZKA 3N0RA 1XDUA 3GLFE 5SYAA 3AX6A 1XTSA 3NYQA 4L72A 3V2IA 5BN5A 1E4OA 3LQRA 2WLSA 1ZJWA 1R2QA 5TSDA 3OFJA 2W2OA 4DR4B 3CRMA 2IC5A 5TF4A 4F1JA 2JCXA 1QHYA 3K71B 1X8JA 3UOGA 2ZL5A 1ZVVA 3UT5B 4UU7A 1SHJA 3G5LA 1H85A 3T41A 2X2EA 4IILA 3QELB 1IY9A 2H4YA 2BDEA 2PUGA 4FJ2A 2QMHA 4RAOA 1AQ6A 4FHFA 4IIEA 2BTOA 4QBFA 1R0KA 3U0VA 3V8BA 2WZPP 3AUSA 4HDRB 1E6LA 2AC2A 3SQDA 5C37A 3H5VA 4FGWA 3S2EA 3AINA 3RSFA 3W8DA 1C50A 1IK4A 2ROQA 3PUXA 5COBA 1FRQA 1G9SA 5FFNA 1OWLA 2VC2B 3LWBA 2VBCA 3WWCA 4AY3A 1CIPA 3PPIA 4DAOA 1JRLA 3HY3A 2REBA 1R9MA 4PC3A 1A69A 3G1WA 3G9XA 1RJFA 4RSGA 2VUHB 4L6IA 2Y6UA 3JQAB 2FH5B 2DWPA 1SOUA 3D4BA 4E5MA 2EZ9A 1J1IA 2CJPA 2JBAB 1Z25A 3PF9A 4URFA 2OYSA 3LKBA 3TZQA 4C6TB 3ISJA 1R5BA 4CM7A 5G0TA 4XQ9A 5CX1A 3FKSA 5E2AA 2FZ4A 1I4LD 1VCNA 3IBCA 3IO3A 4IIJF 4YAJA 2BMJA 2ZL6A 4D8VA 4E30A 4JJ4A 1D6JA 1XYVA 2J4DA 5AXBA 5I9SA 1D5WA 2JLCA 2X77A 4CMIB 4LXYA 2FK7A 5CRIA 4CKCB 2VJQA 1HTBA 1FP6A 3AGQA 5KOJA 1UF9A 2VCHA 1NL3A 1U3UA 2CUKA 4JBLA 3IIMA 2R7KA 4BPRA 4H7HA 4OV6B 2F8MA 3RT7A