2I1PA

Solution structure of the twelfth cysteine-rich ligand-binding repeat in rat megalin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
48
structure length
48
Chain Sequence
GAMVLNCTSAQFKCADGSSCINSRYRCDGVYDCRDNSDEAGCPTRPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the twelfth cysteine-rich ligand-binding repeat in rat megalin.
pubmed doi rcsb
molecule keywords Low-density lipoprotein receptor-related protein 2
molecule tags Ligand binding protein
source organism Rattus norvegicus
total genus 11
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2006-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2i1pA00
2M96A 1K7BA 2FCWB 2KNYA 2M7PA 1F5YA 1D2LA 1LDLA 2M0PA 1CR8A 1D2JA 1JRFA 1N7DA 1XFEA 2I1PA 2JM4A 2KNXA 2FYJA 2FYLB 1J8EA 1LDRA 2LGPA
chains in the Genus database with same CATH superfamily
2M96A 1K7BA 2FCWB 2KNYA 2M7PA 1F5YA 1D2LA 1LDLA 2M0PA 1CR8A 1D2JA 1JRFA 1N7DA 1XFEA 2I1PA 2JM4A 2KNXA 2FYJA 2FYLB 1J8EA 1LDRA 2LGPA
chains in the Genus database with same CATH topology
2M96A 1K7BA 2FCWB 2KNYA 2M7PA 1F5YA 1D2LA 1LDLA 2M0PA 1CR8A 1D2JA 1JRFA 1N7DA 1XFEA 2I1PA 2JM4A 2KNXA 2FYJA 2FYLB 1J8EA 1LDRA 2LGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M96 A;  1K7B A;  2FCW B;  2KNY A;  2M7P A;  1F5Y A;  1D2L A;  1LDL A;  2M0P A;  1CR8 A;  1D2J A;  1JRF A;  1N7D A;  1XFE A;  2I1P A;  2JM4 A;  2KNX A;  2FYJ A;  2FYL B;  1J8E A;  1LDR A;  2LGP A; 
#chains in the Genus database with same CATH topology
 2M96 A;  1K7B A;  2FCW B;  2KNY A;  2M7P A;  1F5Y A;  1D2L A;  1LDL A;  2M0P A;  1CR8 A;  1D2J A;  1JRF A;  1N7D A;  1XFE A;  2I1P A;  2JM4 A;  2KNX A;  2FYJ A;  2FYL B;  1J8E A;  1LDR A;  2LGP A; 
#chains in the Genus database with same CATH homology
 2M96 A;  1K7B A;  2FCW B;  2KNY A;  2M7P A;  1F5Y A;  1D2L A;  1LDL A;  2M0P A;  1CR8 A;  1D2J A;  1JRF A;  1N7D A;  1XFE A;  2I1P A;  2JM4 A;  2KNX A;  2FYJ A;  2FYL B;  1J8E A;  1LDR A;  2LGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...