2I26N

Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain in complex with lysozyme
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
RVDQTPQTITKETGESLTINCVLRDSNCALSSTYWYRKKSGSTNEESISKGGRYVETVNSGSKSFSLRINDLTVEDSGTYRCKPESRYGSYDAECAALNDQYGGGTVVTVNAAAHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Maturation of Shark Single-domain (IgNAR) Antibodies: Evidence for Induced-fit Binding.
pubmed doi rcsb
source organism Ginglymostoma cirratum
molecule tags Immune system
molecule keywords New Antigen Receptor Ancestral
total genus 30
structure length 118
sequence length 118
chains with identical sequence O, P
ec nomenclature
pdb deposition date 2006-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i26N00
1PX3A 4IRSB 4UILH 1BFTA 1Z5LB 3FO9B 3EYVA 1IGTB 1S7RB 5CHNB 3U4EB 3BX7C 1B4JL 3QO1A 4I18C 5ITFB 2YHGA 3CZJA 2OZ4H 1VACA 3V5DA 4JFDE 2Q8AH 2EH8L 2DM2A 3IKCA 1U9KA 3QT2A 3RU8L 4LPYA 2IAND 1IGIH 5IMLB 3MCKA 2B5IB 2CIKB 3QAZC 3QNZA 1F6AA 1T1XA 5D7IF 1FZKA 3P9MB 4NZTH 1JPGA 1V5JA 4ZUSA 4KTDH 5JHLL 2K3TA 3UC0L 5C9JA 5ICYB 3SBWA 3CLFL 2FDBP 5C7XH 1SEBA 4N1HB 1KCRH 2C1PB 2NY7L 1IKNA 3IAGC 4BELD 5I1JH 3MFGB 3S3JA 1BQHA 5F7KC 4KKAC 3LZFL 2R0LH 2CUMA 2OTWA 5TGBA 3QH3B 1D9KB 2BNRB 4IDJL 4HS3A 2QQLL 4KQ4L 1FYTE 3O6FA 4O2FA 4TUKL 3WE6B 5BO1H 2HRPH 5IM7B 4L8CB 2YPKA 5IGXH 2I9TB 4MGXA 5I1EL 3MXVL 1K6QL 4Z8FH 5GS3A 5CJXC 5HYEA 1NC4B 2FGWL 3P0VH 3CH1A 4K2UL 3B9KA 3N85H 1MFDL 3WN5A 4PGEA 3O6FD 3PWVB 4XP1L 3RX8A 3G04A 1YY9D 3D85D 4PJAA 4YFLI 2O5YH 2YC1A 1YEJH 1I8KA 1MCDA 1LK3L 4GMTH 1P4BH 5KSBF 2DKUA 3WFDL 4X7DC 3UYPA 3SJVA 4QHKJ 1QACA 2AABL 5TGBB 1NFDB 1O0VA 5F9OH 4HC1A 3FB6B 4JFPB 1E27A 5TF1L 2FLRT 4YDKL 1I7UB 4PJ9A 1RZIB 2OTPA 2XKNB 4JDVA 3MZTA 1A21A 1KJ2B 4CL7A 3DVFA 5F21B 3ARXA 4LGPB 1TCRA 3TN0B 1KPRB 5BVPH 4YHZL 3V7MA 4E5XB 3HMXA 2R4RL 5C6WH 3HNVH 2Q7YA 3WFHB 4H25B 4NN7C 4X5WB 3W11C 1PZUB 1P7QD 2D0HA 2RHEA 5CZVH 1ERNA 3LRSA 3VFUB 1NUNB 4FQ1H 5CSZB 1I1RA 2VDNL 1OT1A 4FQQA 2MPAL 3RZWA 4IHOA 5IW6B 3QNXA 2WUBL 4XNZC 4I13B 3OKYA 4F7PB 5TDPB 3QISA 2AXGB 4V1DE 5CILH 1KEGL 3K4ZA 2HFEA 4HMDA 4QT5A 1Y6NR 1ROWA 2WBJC 1KTDA 5HYJE 4LCYB 4PY8I 4NNPL 3EO1A 3GSXB 1FBIH 3O6KH 3Q1SH 4OF0A 1M7DB 2DBLL 5CJXA 4DW2L 3MR9A 3BDXA 3MRNA 4P23D 4TSAH 4EXKA 4XVSH 5I8CA 2J8UF 4LLMA 2B1AH 3BAEH 5CZXC 3EDKA 4Q9CA 1JPGB 3QUMH 1KYOK 4HX1B 1WUNT 5DQ9A 1RJZA 4Y4FC 2O5XL 5CSZA 4LCWB 1NFIB 2IH3B 3MCKB 4KROB 4LSUL 5E6YA 1H3PL 4GAJL 3UTZA 3DX7B 4BUHA 3DJ9A 4HT1H 1ADQA 4OLWH 2B39A 5DJXB 1JMZA 4X6BB 3CC5A 1G6VK 4OCYH 3MLZL 3DX8A 5DUBA 1H8OA 3MRKB 1KGCD 5L2JB 1IZJA 4HWZB 4L1HA 1TJHH 1Q94B 4EVNB 3IU3B 4NSKB 5EIIA 5JA9A 1EVTC 1J11A 3QXUA 3ULUD 4RNRA 3L5WB 3R06B 4RAUB 3CFCL 3E8UH 1OT2A 4XT1C 5MERB 1S9WA 3ZSSA 4Y1AA 3SDDB 3I85A 3EIFA 3VXSE 1AQDA 3OAYK 1ZLUH 5CD5C 1U91B 4N1EA 3PWJA 1HXMA 2UZIL 4UINL 4Y5XA 1FNEB 2BCKB 2UYLA 1MAMH 5D7JB 4KZEH 1SY6L 1NH6A 4G7YH 3T3PE 1QQDB 4J1UB 1T3FA 1OAKL 1S5HB 5C86A 5I1CH 4ZS7L 1XCTB 3OB0H 1HINH 2DYPD 5J1AA 3V6ZB 5C0BD 1KJ2H 4DUWA 3VFWB 2RIKA 3MLWL 4HK3N 3VD4A 1EXUB 1QSEA 1CZ8H 4Y4FD 4MNHB 3NCJH 3ARFB 5DEGB 3TO4B 2E6QA 4QXTB 4P2QE 1S7RA 5HD8C 3SE3A 3RY6A 2C4FT 3HTLX 2XFXA 3BPOB 3F6IA 4B7IA 4GH7B 3GIVA 2WP3T 3VXRD 5JMRA 1HE7A 2XZQL 5IFJA 3FZUD 3HLAB 3OKOB 3RJQB 2DLHA 3BZEB 4FMKA 4M9PA 3EJYD 1KCVH 3WJLC 3CXHJ 3UJJL 1GOHA 1KIUA 1I9JL 4NJAH 5T33L 5I15L 4TULL 2EKSA 3UTSB 4ELMF 1T04B 3P9LA 5D70L 3C5ZB 1NAMB 2P5WA 4B0MM 1QSFB 4RMWA 4ZS6C 2JTDA 1E28A 3Q6FA 3LV3B 4YFDB 3ZE2E 4KDVA 2BHZA 1BIIB 4XXDB 3IJSA 1M6OB 3C6SA 4AYFA 1TXKA 2HFGL 1DSFH 5F7MC 3MNVA 5HYJA 2QLVB 3WS3A 5E94B 1HQRA 5HHMB 1L0XA 1OB1A 3IS1X 4FG6C 3MA7B 4YC2B 3OJMB 1E4XH 3GEWB 5DRWB 2HVKA 3BPNC 3V6FA 1MCSA 1CFQB 4XMKL 2RR3A 2XICA 2VQTA 2YXFA 4LP5A 2P5EE 3BQUB 1X5ZA 3QQ4B 4OUUB 4WFED 5INCB 4MQ7B 4PBXA 1Q9OA 1A3LL 4Y5YC 3WNMA 1EHNA 5MEQB 2XWTA 3TZVB 1MJ8H 2VZSA 4W6YB 1MJJB 2AEWA 3PUCA 2WWMD 1ZGLP 1RZ7L 1UKTA 1HHHA 2GJ6A 3LKSA 4FA8A 5H35B 2A74A 1A0QL 3UMTA 3L3GA 5C0AD 5D2NE 4EJ1C 1CICB 1KEMH 3QFJA 4PRDB 2OJEA 3HNSH 1M71B 4EN3C 1INDH 5KVGL 3EYFA 3S96B 5EC2B 3IVKB 4XXCC 4Q0XL 1CG9A 3P11H 2Y06H 4JGUA 3L3HB 5IFJB 3ARWA 4ALAH 3BMWA 4GG8B 4UQ3A 3TZVD 2BC4A 4BUGA 5EC1B 4RX4D 3W39A 5C8JA 3I6KB 4PRAA 3WIHA 2P46B 5GGSA 1X4XA 1S9YA 1EGJH 1PZ5B 1PG7H 1EPFA 3CMOL 3UDWA 4N0CD 1AKJD 4IBLT 2Z8RA 1HXYA 1FGNL 3S3SA 3PHQA 4X6CF 2J5LB 5DMIL 5FF6B 3WLBA 3UTSE 4LIQE 1D5BA 4H5SB 5J8OA 4I48B 3FB7B 3U0WL 1O7SA 5IG7B 4OSUL 4ZAKD 3VA2C 4IRJC 4ODXA 4XBEH 2CXKA 1KN2H 1P9MC 3OPZL 2VLMD 3MV9D 4R9HA 4XGZA 1E4WL 4PTUB 3MREA 4RSVA 2NPLX 5FUCE 2VAJA 4HIJB 1NCUA 4OZ4A 1V3JA 4HKJA 5GS2D 3WEXB 2BSSA 5DJYB 1G7MB 2XN9D 4MDIA 4KVCL 2W9DL 1CGXA 2FJHB 2X89D 4NFDA 4ZXBC 3VH8B 4CVUA 1DQML 2DQTH 4TSCL 4HWBH 2WLZA 1T22B 1CIUA 1PEWA 4K7FB 3KXFD 3IXAB 5ID1A 5IVXA 1OY3B 1OTSD 1I4FA 4WUKL 1ZSDA 4ZOAA 3F7QA 4IEFB 3QJHA 5E7BA 1T2JA 3T1WA 4YC2C 3PABA 3B6SA 3VGDA 5EFIA 3PJSA 5EUOA 2OK0L 3FQTA 5T1KD 4XPBH 4NM8H 3ARTA 3FQNB 1X5HA 2V7HA 2WWKT 1QSFA 1GIGH 1OGAD 5FB8A 5FA3A 1XH3B 2Z0BA 1A8JH 2IPUG 4PJ7B 5KN5A 4R4BA 4P2CG 1ZT4B 3QWQB 3ULUL 2V5SA 5E4EB 3JXAA 3GBMH 4ELME 5DFVD 4DVRL 4AT6A 3V6FB 1NUDA 4JFHD 4OZIA 2A83A 1ZHKA 4XWGL 2G5BA 2VZTA 4LU5H 2AQ2A 5TE4L 3GSXA 5KVEL 3ARBC 1J7VR 4K9EL 1SM3L 5SWZB 1OW0A 3X14A 3NPZB 3FQUB 4FXKB 4RFEB 5HGAB 4ETQB 4JFEA 2W59A 2XA3A 2F53D 1FZMB 2NZ9C 1LO2L 4WENB 5BQ7B 5DEGA 3OR6A 1U8LA 2F58H 3X11B 4OF7A 3UTZB 3M07A 3GI9L 3BD4A 4MA7L 3IF1A 4FZEH 4WDIB 4D9QD 5J4MA 2P1YA 4PJHF 4HUXB 5DQ9B 4WVRA 2JJTA 2E9IA 3GSUB 5E2JA 3VI4F 1EFQA 2CO7B 3KYKH 4N0FA 5FKPA 2D7NA 4U05A 5E4EC 1K2DA 1MVUB 1ZANH 4JRYB 2X4OA 4NC1C 1NGXB 1KLUB 2MKWA 4P4RB 3VG0H 1GZQA 1WC7B 1U8MB 1E0OB 3ZYIA 1MUJA 1H0DA 1TTGA 4L8SB 1AP2A 3QDGB 2RAMA 3MNWA 2BXZA 1JF5A 5FIEA 1IGFL 1QFUH 4XPGL 4NSKA 5EIIB 4XVJH 2VLLB 4NP4L 2UZYB 2E7LC 2C9AA 2WBKA 5SX4H 1YPZE 3H9SD 4PJCF 3ULSB 1WISA 2VLJA 5L9DH 5FA4B 4ZMAT 4S0SD 15C8L 4I5BB 1YMHA 2FX8H 3OR7B 2CLRA 2VISA 4G7VL 2VDKL 4NOFA 3BH8A 3UTOA 5ESVA 1Q9WA 1UH3A 1EO8H 4Y5XC 3G5ZA 1A7RH 5DVKA 2FEDC 1NEZB 3KLAA 4LVHC 1DEEB 3Q6GL 4LVNC 2NXZC 3JV6A 2XPGB 1WSST 1Q9KA 1DCLA 5IMKA 4AJ0A 5ERWB 3MNWB 5C0ND 4CJ1A 5E5RB 2P8LB 1NFKA 5GIRA 4KROC 1II4E 4QGYA 3T65A 3O2WL 1IGMH 4Y19E 2I5YL 5C0CA 1NBZB 4NO2A 2W0FA 1WZMA 1GJIA 2H1PL 2VDLL 5EPMB 4OGXL 1T3FB 3KDMA 2MHAB 4NZRH 5I1AA 4YUEH 1K5NA 4X6CB 4KI5D 3WLWD 3QI9A 4RMUA 3A6BL 4L4VE 2CRMA 3LRSB 4GBXA 4D0BA 2NZIA 4D3CH 1RUPL 1U8NB 3F7YB 3S35X 2PYFA 5IB1A 3P9WB 3N1PC 1BLNB 3F7VA 5GJTH 2XN9B 1YQVL 1U8KA 4AM0A 3NA9L 5D72H 5EBMA 5J11B 2B20A 1NCWL 5IESL 4YWGH 4PS4L 4HZLB 2QADC 4LOUC 2HT3D 2IPTL 4U6XB 3V52L 1B9ZA 3PL6A 4RZCA 1WC7A 3BPCB 4PUBH 3BP6A 4KI5F 4EDXB 2P5ED 2BY1A 2LTQC 1UJ3A 5EZIH 4LHUB 1PQZA 3TV3H 4GW4B 4WU7B 4FQCL 3VFRB 2RCSH 3QEUB 3JWOH 4LSRH 1HQ4B 3H9SE 3AC0A 1JGVL 2GK0A 5IW3A 4L29B 4KY1L 4P9MH 1REIA 2Z92B 3H3PH 1KLGA 3X12B 4DAGH 1PKQE 3QQNA 5IVNA 4AK1A 2PTVA 5E2WH 4HUUB 2Y7QA 3KS0J 4S1DD 4M7ZC 1BEYL 3I2CL 4G6FB 5C0RH 2AJUH 4UTAL 3GSOB 2F9BT 4X5XA 1F4YL 4MXVF 4MVBC 1K2DB 5CGTA 5E8OB 4TNWF 4AG4L 1BFOB 2W60A 1JV5A 2Z31A 3C5ZC 2OTUA 4HFUH 3TIEA 35C8H 1MAJA 1QEWB 3LS5L 4EQ2A 3OZ9H 2DDQL 3HUJF 2VLJE 4ODHH 3T2PA 4BSJA 3TCLA 1T21B 3F12B 4UIMB 1BGXL 2M1KA 4Z7VB 1AGBB 3CFIC 4AQ1B 4I48A 3T08A 5JXEC 5I8OH 2OL3A 3WDIA 1Q0XL 1U8HB 5HPMB 2CLZA 3CCHA 4L8CA 4PGBA 3AB0C 3VWKB 4JJHA 4XNXH 4MCZB 3S36L 4DGIL 4MZ2A 1RZJL 3KLHC 1IM3A 1WTGT 2GFBA 1KACB 3OAYH 1OAYH 1A9BA 1G7QA 1YUHB 1EDQA 2CMRL 3QDGD 3ARFC 3GGWA 5D2NA 3V0VB 3WFZA 1NL0L 2R23A 1NFDA 3G9VA 4OLZH 4I0PD 4OKVA 4OJFL 2V9QA 2K7PA 2P45B 43CAA 4Y89A 2VDOH 3O41B 2DLTA 2F5AH 4I18B 4JDTH 5GGRY 1T5XB 5C3TA 4S1QL 3VRLF 1YNKL 5FA3B 4M1DL 5ALCH 1R3JB 1CFTA 2KUTA 5C9JB 3ROLA 3UBXB 4HUVB 1AKJA 1JUFA 4G80B 2ICCA 1FVDB 2E7CA 1WWBX 3O3DB 3CVHL 5HVHC 5CINH 4L3EA 4RFOH 3VXPB 2R56L 1UM4L 4JFEE 5HDLA 4X7TA 3BXNB 2OXHA 3P4NB 4MMXC 3IKCB 1KFAH 4JG0H 3SOBH 3GMRB 3H9HA 4ODSH 3WHXB 1MRFH 2C3VB 3S37L 1VFBA 5H37G 1GGIL 2MWCA 2J7LA 4PJEA 1W72L 2JJUA 3IFNL 3NN8A 3LAFA 3E0GA 3QQ4A 4TTDD 1BM3H 1J9CT 4AENB 3DVIA 2OS7A 5B4MD 4KKNA 3HFML 4J4PA 1FIGH 3QPXH 2YZ1A 1B2WH 3GBNH 3LQAH 3HPLA 1TVBA 1I8MA 4OFVA 2Z8VC 3MRBA 3SGJC 5LQBL 5JMOC 3RL1B 1NBQA 3K74B 1TETH 2BVPA 1KUMA 2ZG3A 3RP1A 5AD0B 1JNNH 4LGSB 4ZPVB 3KPRB 4G9FB 1UEMA 4C54A 4EDWL 4H88L 1L7IH 5I73B 4LCWD 4Q2ZA 3C9NB 3SDCC 4FXGB 5HI3C 3GRWA 3QO1B 4JY6B 2CRYA 4JZNB 5EC1A 3W39B 1ZHBA 3V79C 2P5EB 3ARDC 4MD4B 3HE6B 5FCSH 3RDTB 1G0DA 2XQBL 1RZ8A 1M7XA 3N9GL 4OZHA 2AV7A 1CDJA 2X4PA 3I75B 4PGJA 4Y16D 5E56A 3LKQB 5E24E 1UACL 4X6DF 4G3YH 1PFCA 4P57B 3RA7L 3SY0B 3VWJA 3VXSB 5E0QA 2R0ZL 5AUMB 5HHOE 5BV7L 1G7PB 5DC0A 5GS2H 5L8JB 3TFKC 1MREH 4XAWL 4FHBD 1MCNA 4ZFFA 3P40A 1XZ0B 1DQLL 1AR1C 4N8CH 1A7NH 4D0CA 4P48A 1BBDL 3VXMD 1U8OA 4R4ND 2CDGA 4HJGA 5B38B 3GSNL 2ZCHH 4Z7UE 3GNML 4GOSA 4OD3L 3ZL4H 2X1OA 4LSPL 2EIDA 4I77L 1RURL 1BZ7A 1T7XA 3FRPA 3CX5J 4XTRC 4G8GE 4QXUH 1MY5A 3QUYD 1QFOA 2GIYA 1DANU 3RIAF 3ULVF 4M6MH 1VADB 2X40A 4WI4A 5D1XB 3L3KB 4DN4L 2GT9A 1YEDB 4WUUD 1JHKL 3EO0A 3PWJB 1X7QB 5TQ0H 5TQ2L 4FFZL 1KJMA 2IAMC 1A1MA 1KTLB 5JIIA 1RVFH 4UT7L 5EBLA 4OD2A 2DBJA 1C08A 1WVZA 5IJKA 3BUYA 3X13A 4AIZA 2D9CA 2GJZB 3ARZA 4C83B 2EXWD 4MWFB 1AGEB 3LY6A 1A9BB 2R0WL 1X5FA 1CFVL 1S3KH 1YJDL 3VFMB 5E2TH 3VDAA 3ECBA 4LIQH 2FYYB 3BIBX 4W4OC 1T5WA 1JGLL 1NJ9A 1RZJC 3HR5A 3MLSH 3TZVA 4B7LA 1ZT1A 4HBCL 2HWZH 2EDEA 2EH8H 3L7EA 4LP4A 1XR9A 4R96B 3MYZA 4P3CH 5E5MA 4X6BA 5C0FA 3GRWH 5D7IB 4IMKA 3THMH 2Y25A 2FD6L 3G6AA 4QXWA 1H8SA 4HJ0D 3O11B 3FQXB 3EOTH 5LAXB 3K4AA 1MCRA 1NCTA 5DHYB 3ZKSD 5FECB 4XC1L 2M2DA 3VWJB 3WCYA 3HC4H 5KAQG 1U8PA 4U2ZA 2I25N 3NACH 4NYLA 2WIIB 4LVOB 4NZDA 1BD2A 3FFCA 3QDHA 3UPCA 4KZDH 1NSNL 3WFEH 4DGVL 2D7TL 4MD4A 3SO3C 2EDXA 2F54B 3MACH 3SDXE 2X9XA 3H9SB 1CIDA 3O81A 5DO2D 3U1SL 4HG4K 4DZBB 1NKRA 3DX8B 3O4OC 5FO7B 3B4NA 1XGYH 2W9LA 1F42A 1WWAX 3OKLB 4DQOL 1HDMA 3KYMA 4LK4A 2HRPL 3GB7B 4ONFH 5HGGS 5DJXA 4PRBB 4TUJA 4EQ3A 1KLGB 3X12A 4YHML 2BVYA 1AHWC 4OI7A 4OZGE 2EDJA 1P2CB 2IH3A 2DIAA 3PP4H 4TSBL 4X4XA 1FNGB 1KT2B 4XP5H 4HC1H 3RAJL 3SY0A 3QG6B 1TVBB 1FLTX 4KMQA 2HT4C 4G9DA 5GSVA 4U3HA 3SQOH 3D3VE 3MV9B 4QOKE 5E00B 3WXWH 3LKQA 2JCCE 2EYRA 2NY3B 2A77L 2BNRE 4XPHL 2A1WH 2VLJD 4NN5B 5AWNH 1NGQL 4MDJA 2F19H 1I9IL 4O4YL 2FO4A 4IOIA 3RFZC 1BZQK 1FL5B 3SDDC 4L4VA 4KHXH 4YX2L 4WY7L 5JW5A 4BFBD 1U2CA 5FOBB 3JZ7A 2CQVA 1D5XB 1UM5L 1EHLL 3SQBA 4E41D 3BRGC 3RWCA 5DDHA 3ZE0E 3RVUC 5I1DB 1A7OH 2A73A 2C4FU 2UY7A 1MJ7H 5I9QC 2R29H 1T04A 1EERB 4OZHE 1BD2D 2Y07L 1ZT7A 3G04B 3RWJA 4JFDB 1G0XA 3C08H 3F5WA 5K9OB 5JHDA 1CE1H 4NJ9H 4R90H 4LEXH 2OQJA 3RKDC 4PLNC 1IKFL 3GO1H 5T1MA 1QG3A 3HLAA 2JIXA 4O2FB 1K8IB 1INEH 3WNKA 3DGGA 4TVPD 3GZKA 2HG5A 2XFXB 1XF5A 3ABZA 3X3GH 1E27B 5HPOA 4BZYA 2FBJL 2VAAA 4ORZC 4EIZC 1RUKL 4LHUD 4N8VB 2PW2B 2X4TA 4ISVB 4JFED 4MA1C 2YWZA 3F7YA 1G9MC 2AJVL 1GAFH 3JV5A 5EORL 1RK0B 3GSQA 3QDJE 5LBSL 3MRLA 4PJGE 1TJIH 3DXAA 3VMOA 2OI9C 4D0DA 5CD3B 2J4WL 3DX9A 1D6EA 5ISZB 3C2AL 3KDMB 4F2MB 1FYTB 1INQB 4WUUB 2R2HB 4LSUH 3O3BB 4X9HA 5J1TC 4GAJH 1ZLWH 2Z35A 3E6FA 1P7KA 3OSKA 2W65A 4P5KB 3C5ZD 4XPFH 4JM2D 3BP4A 2ZSWA 5IT2L 1WV7T 3FB5B 3FO1A 4JN2B 4M03A 1ZMYA 1LO3H 2VLRB 3KPQB 4LHUA 3QDAA 1H0DB 3BZ4A 5CP7B 3PQYE 1JWUB 1M7DA 1C5BL 1XIWB 3UROR 1A6UL 5EU3A 4TRPL 3MRKA 1HNGA 3CFCH 4JKPL 1SEBB 4CVWA 4EKXA 1SVCP 1N2RA 3SKNA 1ZHLA 1JPFB 5FO8A 3O3BA 3QI9D 5T3XL 4F7TB 2CK2A 1BQSA 2VKXA 4YFLF 3O9WD 4JFQB 4ZTPH 5KANG 1URLA 1FNHA 1WT5C 3S34L 3O8XC 3REVB 3VW3L 3LDBC 4HUNB 2DRUA 5D1QC 1JE6A 4PFEA 2P47B 3VJ6A 4WEBH 4K7PX 4OLUH 4WTZG 1NUFA 4JFOB 2BVOA 3BO8B 4QO1A 5GRJL 4GKOA 1MUJB 4LCCC 3X14B 1CR9L 3CVIH 4OFDA 4F80A 5I30H 4I0PB 4NRZB 2L4OA 4MDJB 4JQXC 1UM6L 4RMRA 2W91A 3RGVA 3B9KC 3MLVL 3GJFA 4JPVH 8CGTA 2ZZUT 1PBYA 2GTWA 2Y5EA 1JNHA 4X83A 4YK4B 3KS0H 3AGVA 1A3RL 1U93B 4RMTA 1UB6A 4WWKA 3OJ2C 5DJDA 4WEUD 4JM2A 2XZCL 1RUMH 3VGHA 4LLVB 3CX2A 3O2VL 1BREA 2FH6A 2KDGA 1P2CA 2X4QB 5J3HD 4Y2DA 3QCVL 5D2LF 5IQ7H 4V2CB 1N7ML 3TT3H 2FR4B 2AKRA 4N0UA 2R1WA 2R2HA 4WW2B 3K46A 1R0AH 5GSRB 1X5AA 4ODWB 3ULVD 4OM0H 3PABB 1G9MH 3QUXD 4M48H 1Z5LA 4WHTB 4JCMA 5ENWB 4ZOCA 2W0FB 1NGPL 3QNYB 1IFHL 2VLJB 5EWIH 4K7FA 1UWEL 2CR3A 2YD7A 4UT6L 3MA9H 3V6BR 3BD5A 3PWLB 3MFFB 4WFHE 5K9JH 2ZG2A 3RWHA 4R0LA 4AL8H 1MFCL 5CUSL 4LSTL 5ICXA 2DI9A 2V2TB 1JHLL 1HHKB 1X5IA 3R1GH 1AXTH 3LRHA 3Q5OA 3RKDD 4HD9A 5C0AA 3OQ3B 3NZ8A 3QDJA 1WCBB 5T1MB 1D5ZA 3WFBL 4U6HA 5HGDB 4YDJA 4XWOD 3FQNA 4IOSD 2EDNA 4YQXL 5JO5A 4KKBC 4R96A 5EDXA 4N5UA 1IC7L 4PJXB 5F1NB 4AMKH 5CD3A 5E8EB 4ZOEA 4PP2B 2X4RB 4XNQA 1RIVH 3D39B 3KPPA 5ILTL 5IMMB 4PJAE 3VGBA 4XCCL 1S7WA 2BERA 4CAGA 3MRQB 2EYSA 1RK1B 2ZKHL 4NC2B 3GSNA 2QQKL 1YDPB 3EO9H 1TNMA 1IEAA 4MCYB 2FX7H 1A0QH 1QPXA 5ECJE 3WJLA 4XCEB 3BUTA 3ULVL 5DHYA 1BQLH 5AZ2H 4NNYA 2ZOLB 2ATPA 1WFTA 1NMBL 3HAEB 1B3JA 3OF6A 1F3RB 1QHPA 1X6NA 1N59B 4H0GA 5ICZB 1F11B 2OP4L 5EOTA 5B39G 3RVTC 1K3ZA 2NY2B 4G6JH 5D7SH 2NY6D 4X4XB 1FJ1B 5KSBB 2H8PB 5GGTL 4K3JH 1XEDA 5GGQH 1NLDH 1I7TA 5EU6D 1KYOJ 3AVEA 2Q86A 1ZLWK 2DTSA 3PXJA 3ZTNL 3DI2B 3FT3A 1E6JH 1OF2B 1KCKA 1MWAL 4G6KH 3SKMB 3VCLB 1YC8A 2FEEI 4WI8A 1TZHB 4YBLC 1DN0A 4NQED 4LEOA 5CKAA 4KK6D 4R6UA 1HOCB 2VDMH 4FN0A 4F57L 3G6DL 3VWKD 5SWZE 5B22A 5L2KE 1SYVA 1S7SA 3U82B 4BFIA 3RHWK 5ETUA 4CN4A 2Q7NA 5LWYL 3BP7A 1UG9A 3ARRA 2GT9B 2CGRL 3IFLL 2Q8BH 3ZKXC 4EN3A 5ETUB 2VXVL 4A6YA 1SYSA 1B88A 3BE1L 5DF0A 3PF2A 3U46A 4ZUVA 5EOQL 3CFJB 3SDXF 1U92B 5CEZE 4JREB 3TBTA 5IW1A 2R1XA 1NC2A 5TFSH 4JZNA 1MIMH 4Y5VC 5FYLE 2R15A 3DO7A 3FB8A 3M8OL 3UYOD 3BJ91 3JSSA 4IRZL 4JZOB 5HHOB 1JF1B 4BZ2L 3UJTH 2EIZB 2JK5B 5D1XC 5I1KH 1AH1A 2QQNH 3WIFB 4APQC 1IQWL 4RA0C 4ZUUB 5MHSD 4WWID 5IIEB 2GUOB 1NBYB 4QTIH 5J9PB 4UIKL 4PJHA 1XGRB 2Z4QB 1MLCB 4AEIH 1I1AD 4GO6B 3BI9X 5DRWA 4PJ8D 1FC2D 3EOBA 1JCKA 4QHKI 2J8UB 3NIFE 2PW1B 3CK0H 3D3VB 4QOKB 1MHCB 1KTLA 1Z0MA 2IQAB 3EFDH 4RGNC 5I2IA 4XH2A 3QUZA 4ZAKC 1JF1A 3PE9A 4XTRD 4S11A 2DWDB 4OIAA 3ARFA 1QPPA 4H26A 5D2NC 3RVXD 5C08A 3S98A 4DZ8B 5DLMH 1YY8A 2WM0A 3QUYA 3OGCA 1YPZA 4OCSH 1F58H 4M6NH 3TVMC 2D03H 3PGCA 3CDYA 4M7LL 3GSRB 1BWWA 4ODVL 3HC3L 3IDMB 4PJGB 2X1XR 4NQEE 3JV4A 4U1IA 4Z0BH 3JTTB 4POUB 4RISH 4Y5VA 1I1YA 3O45B 2BNQE 2KH2B 5C0EB 3QB7C 3LOWA 5E7FA 3SKOA 2ATPB 3MLTA 1Z3GL 3OKNB 3MV7E 3V9FA 3NFPA 4Y4KD 1R3IL 5JUEL 3S35H 2VXQH 1FORH 3LEYH 3LB6D 5F9JA 1MCIA 3AS3A 4KK5C 43C9B 2A9NH 1Q94A 4EVNA 1T4KA 4CW1A 5F6HJ 2RB8A 3DROA 1YNTA 3QHZL 1T1ZB 2Z93B 5EU5B 4XVJL 5HHOA 3QSKB 4WU5A 1YEEL 4U7SA 3N06B 5DK0A 4TUOB 5FCUH 3SE8H 1M4KA 2R0KL 3B5HA 15C8H 3C2SA 3DV6B 4Y5XB 3OXRA 3QHFL 3AFLA 3KPRA 3L3OB 4I18A 3G6JA 3PHOA 1CTNA 2ZPKL 3UTSA 3BYYA 1EO8L 1NC2D 5IHBA 4RGMC 1JTPA 5EC2A 1UB6B 5ANMA 4PRHD 2AEPL 1RFDH 5L8KB 4W6WB 3U2SA 3PWNB 4FG6D 2R9HD 3ARGB 4BFIB 3G5VB 3TO2B 5EZOH 3LQZB 4NKIL 1CL7H 3WD5H 1M05B 2ICEB 3T0ED 4HEPG 2ADGA 1A47A 3LKOB 1U8HA 4LASL 1ED3B 1P7HL 4KVNL 1AO7D 4Y4HA 3O9WA 4N9GA 3H42H 2IBGA 4RGND 5F7NC 1CDYA 4Z7OE 1FFQA 3WIHL 2HFFA 5EUKB 1YNLH 3ARBB 1EUUA 4HMCA 5GPRA 1YA5A 1QBMH 3WSQH 4QHLB 4QRSB 1UWGL 1QFWM 5DJZB 3TO4C 1XCQB 3O3EA 3MJ9L 4E42A 3IT8D 3GSWA 4R26L 2IMNA 3OXSA 5ICZA 1MLBB 5IBUB 4XNMB 3NABL 1AO7B 2AJYL 2ORBH 4UAOC 5GJTL 4KXZI 1KB5L 1FCGA 1NCWH 5IESH 1B4JH 5I76B 3NZHL 1QFPA 2ZG1A 4M5ZL 5ACZA 3BVNA 1FC1A 3MRIB 2O61B 1C7SA 1GHFH 1AR1D 1QR1B 4KI1A 4P5KA 1T89A 2YKLL 3MRRA 4L1DA 4QHUA 2ZJSL 2IANE 3D39A 3KPPB 1GGBL 3KPMB 4NZTL 1OAQH 1EFXD 1EA9C 5D9SB 3TA3C 4CBPA 2AK1H 4PJXA 5F1NA 3MRPA 4JY4B 4Z77A 5MEOB 4H8WL 3C87A 2DS4A 5J12C 5EZJA 4GW4A 3MLYH 3RPIA 4U6HB 1AXSA 4U1NB 3V4UL 3U7YH 1CTOA 5JLZB 3UEZA 1NBZA 2XWBB 5DJAB 5IJKC 4NGHH 1XIWA 2ED8A 4YLQT 5TH2A 1BJMA 4OLYL 4V1DB 2PXYA 1KN4H 2KQNA 1NGWB 1IEAB 5DEZA 5I18H 1DQTA 2VH5H 3VD5A 1LD9A 4S1DC 1NEUA 2D7QA 2BHYA 3RGVB 4HWZA 4NHCH 1G6RA 5HI4D 4HS8H 1CBVL 5EZJB 3N1GC 3RWFA 4IMKC 2EIEA 2DF3A 4P3WA 1RIHH 1YN6B 3RWJB 4X8JB 1IT9H 1EBPA 4MXVE 1FYHB 5MP6H 1U3ZA 1J5OL 5E08L 4X80H 1CLOH 4URTB 2EE3A 1S9WB 4Z7WE 4NOBA 4OD1L 1D5XA 5J6HB 3QH3A 2VXUL 2XZAL 1S78D 2NXYD 3SEPA 4LPUA 2HVJA 4RNRB 4WGWB 5I71C 1KGCE 3P4OB 4JKKA 4X5XB 3O0RL 3QEQE 1R3KA 5DO2C 2FCBA 5F96H 4DN3L 1I7UA 5MI0C 4KK5D 4Y16B 1W8NA 4X4ME 1XGUA 3MXWL 1AJ7L 2CLRB 2VISB 4WFFE 1VB9A 3GSUA 4M7KL 3ORJA 3VXSD 3RUGE 1HWGB 1YEIL 4FQ1L 3FN3A 1D7FA 2CKBL 2EKJA 1EFXA 3NFNA 2AP2A 3BZFA 3O2DH 4WTWA 4E41B 4MNQE 3WFHA 3ARPA 3FMGL 1L7TL 2YD3A 4WFEE 3MPCA 4PJ7F 2IANB 2VUOA 5FOBA 5BRZD 1OSPL 3VI3E 1ZVHA 1IAOB 2VYRE 3O3UN 4NWUL 5C71A 4GG6B 3GMMB 3FAXA 2OCFD 4NNPH 3FQUA 4RFEA 2DBLH 4PJDA 4X6DA 4CJ0A 4HJJH 2V2WA 5GS0D 4OZGB 3T0EB 3R4DA 3S6CA 3VDCA 4JY5L 1F5WA 4FQHB 2DICA 2LU7A 3FRUA 3LN4B 4YBQC 5C0AE 3AUVA 4HZLA 3RVXC 9CGTA 1N5AA 2OQJB 3D69B 3UYRH 3VXTA 2YA0A 4HS6A 1RUQL 3F7VB 1U8IA 3WJJA 3D6GA 1FGVL 2ICWJ 5BZDB 4XCFL 1K8IA 1XGTB 2E27L 4NQCE 4BA8A 4HEME 3TNMB 4YXLH 5IWLC 3DVGB 5GRXG 1UZ6F 1NQBA 2Q76B 1RJCA 1P9MA 5KS9F 5EZLB 5BQ7A 4QRPE 3NBNA 4QXGH 2DQHH 1FLRH 4LVEA 1LK2B 1UJ3C 3JWNC 4GAGL 4JRYD 3WHE0 4WHDA 2LAAA 1S9XA 3O6FB 4JO2H 5BS0D 4APQD 1EZVY 4J3XA 5SX5H 4PD4K 4K3GA 1D5IL 3QUYC 2WIIA 1VFAB 3O6ML 4U1KA 5F9JB 3PQYB 5CEYB 2X89A 4Y4FA 4C58B 3U4BL 3UTTD 1T1YA 2JELH 2R8SH 2XKUA 1UADC 1FPTH 3O9WC 4UV7H 4ORGA 1MY7A 1A6WL 3MV9E 4FFYL 1YC7A 2DM3A 3QI9C 1LEGB 3DSNA 3ELAT 1QNZL 4PRBA 1U8QA 3GB7A 1KCUH 3QG6A 5D7JC 3DUHA 1HH9A 1RULH 3VH8G 2P42B 1CGWA 5EA0H 1G1CA 4G8GB 1ZLSH 2GCYA 5I8EB 1QSED 5ESAB 1WIUA 3IF1B 3L3DA 1NGZB 2GK2A 2GSIA 4PV8A 2C7UB 2ZWLT 2OJZH 2WLYA 4ESKA 4A2MA 1R5WA 1OP9A 4PGDB 4PRHE 5JQ6H 5JW5B 4PJBF 1MCWM 3LKPB 3EBAA 2Q1EA 3BT2L 4M9OA 5C8JB 3WN5C 1F8TH 1BQHB 4F3FA 3KPSB 3QO0A 4H0IA 1TQCC 4KAQL 4LSQL 4PJ5D 4PTUA 4YNYA 4DN4H 4RGOL 2A6KA 4XCYA 1JHKH 3IDNB 2YR3A 3U2SB 2MQ0A 1B0RA 1OM3L 2VDPH 3RX7A 3O3EB 5C3LD 3EJZD 3VGAC 1DZBA 2N1KA 3Q2CA 5TE7H 5KOMC 5ACLA 3L6FA 1TNNA 5KVFL 4QHLA 2IPKB 1J1XL 2P49B 2AXJA 1CU4H 4YPGA 3ECBB 4K94C 2LTQB 1WWCA 2C1OB 4LIQL 3VD7A 1TITA 2SEBA 2QQQA 2DQGL 2F53E 1FIEA 2XWJB 5GGVL 2BVEA 1RQ5A 3BP5A 3IXAA 4PJXF 3WUWA 3RUGB 2QJDA 1DUZB 4ERSL 3FFDA 4KJYB 5F9AC 4OCLC 4X99A 1DBJH 4D9QE 4JFFA 1CFQA 2ESVE 8FABA 1DUYA 1QUNA 3HPLB 4NDMA 4PRIB 2LQRA 4P2RA 8FABB 3I3DA 5JW4M 3TVMB 4XC1H 1H3WM 1BQHG 1DR9A 3O8XB 4I4WA 1Q8MA 4YBHA 3BH9A 4HV8B 2P8MB 1ZGLB 5FYKD 3I50L 3O45A 2D7MA 3LKNB 4OQTH 3VG9B 1N6QL 4FXGA 5CGMA 3SKMA 3VCLA 1BVKB 3CUPA 1HCVA 2WBJB 3MJGX 1MCOL 2K9UA 1G7JB 1NCCL 3PGDB 4OGYH 3IXTA 1XGYL 2HT4D 4UTBH 4HFWA 5I1HH 2BVPB 2LAGB 1P7QA 3O3DA 4X9BA 1HI6B 2YOCA 5C0BB 1QKZH 3TZVC 3K81A 4YHKH 1SEQH 4MWFA 2IPUK 4P59L 3U9PH 4I3RL 4N9OB 1R3JA 4ALAL 2YK1L 2BVUA 4AQOA 1KXVC 3RIFF 3KNBA 4BQ9A 3HI1B 3RVWC 2F8VA 1F3DJ 4TPRL 3RPKA 1CG9B 3KPSE 1TVDA 1VDGA 2ADFL 4MQTB 3RGHA 5EOCJ 5E99H 5IR1A 2JJTC 3IGAB 2LVEA 1BIIA 3CSYA 4KGJA 4NPYB 1PLGL 3CD4A 3NA4A 1VFBB 1H15B 2GFBB 3TYFA 3LEVL 3MJ8A 1EUTA 1MSPA 4HFWB 1V8HA 4HIIB 1S8DB 5BMFH 1S9XB 3ARBD 3OB0K 4MSWA 1L9MA 5T3ZL 5KS9B 3UTSD 5D7KE 5IV2B 1MFEL 3KR3H 2GCYB 3RL1A 4TQEL 2R2EA 1CFSA 4HXAH 4HPOL 3RU8H 3VXUD 5IOPA 1U41A 1MJ7L 1F00I 5E6ID 2BDNH 1J8HE 3MLRH 5KS9E 1PSKH 4R3SB 4JFZH 5D4QA 5DVOA 3MUZ1 2X4NB 5EBLB 4HAGA 4IJ3B 2P43B 5BZDA 1G7HA 3SGJA 2X2YA 2Z91A 3TIEB 2J8UA 1IKFH 3GO1L 5JPMA 1CFNB 2X1WL 2L7UA 3V8OA 4K9EC 5GHWL 4L9LA 1BFOA 5E2VH 5IFHH 4JKLA 4MA1B 4G6ML 3NFSH 5HGBB 1P1ZB 1F3JB 2G2RB 1NGZA 2GSIB 3BOVA 1RUKH 4KH2A 4JB9H 4JQXA 5CEZH 2BJMH 5H2BB 2HLAB 1GSMA 1HHGA 3TT1L 2QHRL 3K7UA 1LO4H 1K4CB 4K94H 5F93C 1T0MB 4BK5A 4FQPA 5EORH 2AKRB 4X4YA 1BVZA 5D7JA 1IEHA 2NTSP 4WRLA 1CGSL 3BZFB 1S5IL 4NWTL 1C5CL 4X7TB 2R1XB 5KW9L 5DRXA 4ODUA 4CMMA 3L6FB 1EMTH 4NO5A 5F7UA 1MJUL 4M00A 5ICXB 3SJVD 1T66C 1ZVYA 1LK3H 3BEWB 2ED9A 4HXBH 2Y72A 2N4IA 1N5AB 4XMPL 1MHEA 1YEHL 1NCAL 3SDYH 3VFGH 4ELKA 4HLZH 4JFFB 4YBQD 2BNUA 2OR9L 4X99B 3U7WH 3T0EA 5IBTH 3KPRD 5F9OL 3H9YA 3B9AA 1EK3A 1IMHC 5DD3H 2FO1A 3AMLA 1H3VA 5SWQA 4WV1A 4LPVA 1HOCA 4QCIA 2CRZA 2RGSA 2NYYD 1BPVA 1KTKE 1H3UA 2NY3C 5DEFA 2PYFB 2VXSH 3RZCA 2NY5H 1H8NA 3VFUA 3K2UL 3L95B 5T3XH 5C0NC 4MS8D 4JVWA 2IG2L 1Q0YH 2ZCLL 4JFQA 2R4RH 3B2VL 4HIXH 3E3QE 4G8GA 4JPIB 3MRBB 5J56B 1FVDA 1WF5A 5J3HC 4XRCB 4BSVA 3VXNA 1HSBA 2FHBA 4PBWD 3UTTE 3L3JA 1ZHLB 5DVMA 1KIRA 3TPUB 1A4KB 1MH5A 1J8HD 1EEUA 4D8PB 3HZVA 1AFVH 6FABL 3WIIL 1QO3A 5GS0H 3DRTB 2WWMC 3BPCA 4Z7WB 1HYRC 3TIDA 1I85C 1VGEL 4WW2C 4Y4FB 4PJEB 3H3BC 5HI5D 5HDBE 1UM6H 4KUCD 4JRXB 2XV6B 3O6KL 4Y4KB 4I3SL 3TWCL 1BJ1H 1AD9B 4TSAL 2IALA 3D18B 5D7IE 3D5OF 4G43B 1JMXA 3TNNB 5JW4R 3QUMA 5FGBA 5KZCD 4TN9A 4Y7MA 1DDHA 3ARUA 1QRNB 1LVEA 4NFBA 3QCVH 5IQ7L 2BCKA 2UYLB 1CD1A 1XF4A 3IB4A 1FH5H 3LIZH 5I71B 2BSRB 2I9TA 1RZKL 2UVEA 32C2A 4JN1H 4XB8A 3CFEA 4OCYL 2UWEE 4NO0B 3MOAH 1FDLH 5EG6C 4TYUA 4NN7B 3U30C 5DJDB 4RAUA 5IUSA 2ZUSA 1DBML 4ELMA 4M3KB 1CXEA 1UWEH 2KZWA 5D2NB 2XXMB 5D7LA 3V0VA 4CVXA 1AR2A 1EVUA 3LPFA 3LDBB 4PJGF 1WAAF 3T8XB 5DA0B 2I27N 3BPLB 5BOZG 1C5DA 5CEXA 2P7TA 2DM7A 4OCNC 2HJKB 4OFKA 4LBEB 1QLFB 3WO4B 5CUSH 3WXVL 5F3BA 2EC8A 4LPWA 1CXIA 3NAAL 1AXTL 5FUZL 4ODWA 3ILPB 4IRJA 4MD5B 4F7EB 4OI8A 2BMKB 3FOMB 4BQ8A 5E6IB 3S88H 1HWHB 1XCQA 1J05B 2ARJB 4QHNB 2F53B 1EFXB 2DJUA 4HJ0C 3H0TB 4NC1E 3RTQB 5DFVC 3MBEB 1OAKH 1K9TA 4PLJC 1BJ8A 4HS3B 4YWGL 5A2JH 4OLXL 3L5HA 3GI8H 4HF5H 4WWKB 3MRFA 4OGZA 4WV1B 2VAAB 2VR4A 4PV9B 3RWIB 3LN5A 1BZ9B 3GUTB 4K23L 4V1DA 5EOCH 1P6FA 1R5IA 1CZ8L 1S7QB 7FABH 1QLFA 4WO4C 1OD7A 4Z7WA 4R7NB 5F6HI 2ZKHH 3D25B 3DI3B 5EU3B 4LLQA 5JXED 1S7QA 1ZHKB 2JF1A 4QWWC 1AIFA 3JWOL 4ENEC 1BQLL 4PY8J 4U0QB 3WFCH 5IBLD 4KFZC 4U6TA 5JDSA 3E6HA 1F6AB 2FL5A 4ZXBD 4DAGL 3A6CH 3BDYH 4DCQA 4NQVB 3UJJH 3DPBA 3OV6A 5ELIA 1RIUL 4D2NA 1P5UA 1UEYA 3QUZD 5DEFB 1INQA 3P3YA 3V5DB 1C1EL 3F58L 5AAWA 1TTFA 4P23B 1JRHL 4KQ4H 4DWHA 2FB4L 3LCYA 1J10A 1TCRB 4NFCA 3TN0A 3DARA 4LSSH 2FH8A 4GAYB 1Q72L 4QKXB 3KPSD 4QTHB 1YQ2A 1AQKL 1G7IB 2UY6A 2AV1B 4XX1E 4L3CA 4NHUA 4X4MA 3ETBF 1CDIA 3EFFA 1JNLH 2HFGH 3KPQA 4GAFB 1IGCH 1L6XA 1WZ1H 4YXHH 4PGZA 1RY7B 4N0YL 5I1LA 1I7RA 3AREA 4U1MA 1QR4A 1Y0LB 2WBWB 4G8FB 3SKOB 2X4OB 5E9DB 4PRNA 1GC1C 1CWVA 3RPIB 4WHCA 2NY0D 1QRNA 4KRMB 5EOQH 1CXHA 2J12B 3BSZH 4GT7A 2WWKO 5DT1H 3RQ3A 1ED3A 3EDFA 4Z76A 4XNXL 1YMHB 2MTPA 4JANB 1E4KA 1JK8B 4LOUD 2QADD 2YRZA 2H2PD 5BCAA 2VE6B 1ZLUK 2NR6D 3FCTB 4MNGE 2EO1A 1RHFA 5I1KL 3GDBA 3PWNA 5F1IA 4L9LB 4HLJA 2E7LA 5LGHH 1AHWB 5F88B 4NRYA 2DYPB 1NEZA 3KLAB 1ADQH 3C8DA 2BSED 1BFVL 4KHTH 4G9DB 1FZOB 1OAUH 5CINL 1QRND 1WAAA 3DVNA 3V5KB 3GMQA 1MLCA 4D9LL 1WEJH 1EEQA 2CR6A 5KG9B 3MMEB 4ZTOL 3LPGA 3BKJL 2FNBA 4MSWB 4PB9H 4U1JB 2UWEA 4HCRH 4CGTA 3QUYB 1CF8H 4PJCB 4P4KB 3JVGA 4LCCB 5HHPB 5C07D 3T4YA 1MCFA 4U1LA 1HN1A 1YMME 3MV8D 5GRYA 3QPXL 2OYPA 4JM2F 4Z0BL 5DC4B 1PAMA 1IQDB 3QCTL 3AS0A 4DTGH 5DVLA 5L88L 1LO5B 5I75C 4OIIL 4KMTL 3QJFA 1MHEB 3OPZH 4Q9QH 3DX6B 1QSFD 3DRQB 5ADOH 2B1HH 3JTTA 2YD8A 1VHPA 4PLOB 2YPVL 5D96C 2HJFA 5LGJB 4DKFL 4P2OC 2ZCKL 4UI2A 4JO1H 1UCBL 1HH6A 1QFWH 3EYSH 4PJ7A 1ETZA 4PB0L 3C6SB 1ZLVH 3KXFA 5ISZE 2NX5A 3Q5TA 4RMSA 3T3ME 4EXPX 5EBWA 1CT8A 5JR1H 4NQDA 2EICA 1N6UA 4R7DA 5F7YC 4QRQB 4RA3A 5HGAA 5KTEH 4PP1C 3O6LH 3KLHD 3IDJB 2UZIH 4UINH 4XPBL 2H8PA 4JQIH 5D7LE 1HK6A 3FFCB 4M93C 3HPJA 1KG0A 4HH9B 1WBXB 4FABH 4ZS7H 3ZKMC 1HINL 5E5UB 4F9LC 3IDNA 1MRDH 3NH7H 5DJ0A 2ED7A 4NRYB 4GMSH 5HHOD 4FZ8L 1GGYA 2QSCL 4N8PA 5BXFB 1MCWW 1MJJA 5TPWH 4PJ8A 3GSNH 2DQIL 5FM4A 4NBXB 4LU5L 4JY6A 3T3MF 2HAZA 3VXME 4LEOB 2P8PB 4QF1B 3ZE1E 1U6AL 3DROB 3I6LE 4U1JA 2YD4A 2BK8A 1DN2A 1A5FL 3MBXH 5HHXH 5J11C 4G8GD 4YO0A 5DYOB 1ITCA 5DGQA 3NVQA 1I8MB 3FQRA 1IM9D 4GS7C 3U36B 3ZHDA 1YMMD 1JZ3A 5ADPH 1HXMB 3I02A 4PJFF 3ZYZA 1KB9K 2VOTA 5D70H 2I9LB 2OI9B 1JGEB 5F72S 2O5ZH 4HKXB 2LVCA 3AROA 3KVQA 4ODXB 5LKNA 1MCPH 4UV4L 4IS6A 3LKPA 3R06A 4KMLB 1IAII 4PJCA 1J0IA 1HZHH 3VG0L 3BEVB 4K8RH 3DSFH 3MV7B 1HQRB 2ATKB 4PR5A 2VXTL 4HSQA 2XXCB 1CLCA 2HRLA 3WLBB 4ODTL 5JTWA 2BRRL 4F33A 1JZ2A 1IGFH 4O9HH 4M43L 4RQQB 2VKWA 1FHGA 4F15C 4YHLH 2ZJSH 4GRWH 4UIMA 3LH2L 1UC6A 1OAQL 4OF5A 2AJ3B 3I6KA 5HTSA 4PLKC 1QOKA 2NY4B 3GMLA 4AIOA 1FO0B 4OLVL 1QBLH 5I1LB 4DOHE 1XR8A 3MLYL 2HJLA 2RBLA 4NRXA 3VDBA 1EGJA 4R4FH 3DBXA 1FAKT 2NY6B 3ULUF 5HYQB 1MFBL 3X3FH 3I84A 3MRQA 4CVZA 4MNQB 3L3GB 3MUJA 1KN4L 4N0CC 5E94A 2AI0L 3HE6A 3RDTA 4GRMA 4S0TD 1JYNA 2CDEB 3VRLE 4POZC 3FN0H 4IDLA 2JJWA 4WNQA 3OKKB 2EXYD 4MQ7A 1A6AB 3BD3A 4IMLB 2DM4A 3VXRE 1D5ZB 1U91A 1FO0L 2FX9L 3FHAA 3SDAB 3ARGD 3RL2B 1WLHA 3DURB 1D3CA 1SYSB 2AXFB 1JTTA 3VXRA 3LN9A 4WI5A 3MRHA 1NEZG 2EDOA 4WU7A 1D6VH 5T1DH 4PG2C 3S9DB 4LPXA 1YY9C 3MR9B 4N0RA 1ORSA 4O4YH 5BV7B 2APWA 3GSOA 4OD1H 2DQFA 4JO4L 4MJIE 4Z78A 5LXGH 1XIWD 2E3VA 4J3SA 4DKAA 1G9NL 5DJCB 4YX2H 5BS0A 4ODBD 3AMKA 4MVBD 2CRIA 5C0JA 4GKZA 2P24B 3MUY1 1MF2H 4F58L 5I0DA 4XBEL 3PP3H 3PQYD 5J6HA 2DD8H 1GPOH 1JHTA 5CBEA 3UTTB 5GZNC 1KXQE 1ND0A 3TV3L 2Z92A 1G0YR 1OTUC 4XAKD 5KSUA 4JPKH 3KAAA 3V6ZA 1OLZA 5MENE 4KTDL 5JHLH 2G75A 4HGWA 1A6VL 4BH8A 5C7XL 2AS5M 1B0RB 3C5JA 1KCRL 2XTJD 1FE8H 4OF6A 3O2DL 2V6HA 4BQCA 1JNHB 5CP3H 1WBZB 5F3BB 3W9EB 4HIHB 3QG7L 4HWEH 1NMCB 3QULB 2VL5A 2BY2A 1DQQB 4I0PA 5F71A 4F3FB 3SGDI 1MI5A 2PW2A 3TPKA 3PWUB 1MCKA 2OTWB 1JV5B 1A7QL 5JNYB 3DLQR 4K71C 5C0RL 4NBYB 3PWPB 2ENYA 4UTAH 4ZFZB 5L6YH 4XP6L 2YBRA 5CIPA 1X5LA 2J5LC 1K6QH 4Z8FL 4PGBB 1DTUA 3CVHA 4HFUL 4M7JH 4PY7A 2E27H 4Z77B 4GRLC 2MHAA 4PRPA 3W9DA 5JO5B 5L7XL 2ZSVA 1RV6X 2HTLC 1ZT7B 4PG9B 2ZNXA 4FTVD 1LWRA 4X7SH 1KJ2A 1DE4B 1MNUL 2W9EH 4PRPD 5JDSB 2AGJL 4N8VA 4KJPD 3EOYG 5CJQH 3QIUC 3BVNB 4JFFE 5GIRB 4PJFB 3WMSA 5ALBH 1MEXL 1D5IH 1MCHA 1OW0C 2OLDA 1YEGL 1P7KB 3LS4H 4HWUA 2B7DT 4YR6B 4PJFE 3G5ZB 2DMCA 3CX5K 3S5LB 4WJ5B 1MRCH 4WFGE 3MLUL 1IBGL 5CJOH 4ZTPL 2APBA 2AXGA 5SV3A 3SDXA 5I19L 4O51A 4E42B 4OKDA 4PRID 1BLNA 1FP5A 5IB2A 5CMAB 4HUXA 1J87A 3ARVA 1FG2B 2VDNH 2CIKA 3DGCR 3SCMC 1SMAA 2VDQL 5FO9B 2IGFL 4Z6AT 2IBZY 4M93B 1UKSA 1QR1A 5D2LE 5DWUL 2R4SL 1HILA 2VO5A 4OFIA 1DBBL 5CHNA 5ACZB 2BFVH 1NGYA 5DD1L 5DUMH 2HH0H 4JFDD 4LKCB 4NQXA 4FXLA 2B2XH 2BY3A 4FQXD 1SJEA 4U1HA 4H20L 5IK3B 1NGXA 2B1AL 2AJSH 1TENA 3DHMA 5M94B 5E00A 1CLZL 1BM3L 3MRJA 5FKPB 3GHBH 1W0VA 2EYTA 3PP3K 4BM7A 4JREC 1FNAA 1FNFA 2QKIA 3MRHB 3NIGE 1FIGL 1DBAH 3BGFC 1U58A 1AGFA 5EO1A 5T1LB 2XPGA 1GGCH 3LQAL 4YGAB 2MCPH 3K1KC 3P4MB 3K8LA 1KPVB 1OM3H 1SVZA 4FS0A 4OZIE 2IJ0C 3MLZH 1MQKL 4FNLL 2APFA 3PWVA 5TE7L 3EGSB 3T0BA 3SPVB 1HIML 4WEMB 5IMOB 1AE6H 2Y36L 5LGKA 3OAUL 1IC5H 4EDWH 5CS7A 3FQWA 1FYTD 1P1ZA 5F7HA 1NLBH 4MNQA 3GMOB 3G5VA 1SBBA 3T8XA 4ZYKB 4Y4KA 4P5MA 5M95B 4Z7QE 4KDWA 4MAYC 4LCIH 1YEFL 2H26A 1X5JA 3H8NA 3N9GH 1KT2A 4YHIB 1S9KC 3P30H 5IB3B 1KLUA 4XX1G 1S7UB 1MAML 4ODUB 4XGZB 4MXQD 5IHUL 3BKCL 5A16A 1T0NA 1Q9WB 4WFGD 3BW9A 1FV1A 3HZKB 3T2NH 3UAJD 2NX5E 2PYEB 3L3JB 5DHXB 4WUUA 2EH7L 1YYLH 4NN6B 4PUBL 2WUCL 1D5BB 4H5SA 4LVOC 3TC9A 5FFLA 4XCCH 4MJ6A 5GXBB 4R8WH 1J1OL 3U7AA 1LP9A 5IJVB 5KSAC 3RWCB 2COQA 3VFMA 4IMLA 4FQCH 1MHHA 2FX7L 5ESQA 3NTCL 5FV2A 2DWDA 1JPSH 3G6JF 5CWSB 5K9KB 1ZXQA 3P0YL 4L8DA 1DVFD 4XH2B 4OZFB 1ORQA 1OPGL 3ESUF 1BWMA 5E8DL 2NY7H 4JHAH 4WI9A 1OAXL 4X6EA 1A6TB 4U1GB 5C0DA 3HZVB 2VN7A 2IAMD 3LZFH 5T5NG 3O2DA 5JIKA 5I16A 3LEXA 4IIQA 3W2DL 4FFZH 1J0YA 1QA9B 2OL3H 5SX5K 5CLWA 3C60D 5GS1B 2YSSB 2HMID 1VGKA 3WNPA 3LKSB 3SBWC 3H7BA 5IB5A 1ZHBB 3BN9D 4J3OC 1ZTXH 1WAAE 3BRDA 3NCYS 4KK9D 4KUZL 4TVPL 4OBRA 3WYRA 1F97A 3JWDH 4JFXA 5DQJA 5GRWA 1I3RB 3NIDF 3LSOB 5F7EH 1S7TB 3QRFM 35C8L 5IR1B 1RSFA 1IGTA 1FFOB 2QADB 2GJ6E 4L8BA 5E2UH 5JOPE 4GG8A 1GL4B 1P4BL 3M45A 4J8RA 2CXGA 3QEHB 1J12A 3BKYH 3QUKB 3L1OH 1GYAA 1B0GA 2FD6H 3FT4A 3QZWB 3F7PC 1FVEB 2ZUXA 4CADB 2VL4A 4PRDA 2P4AB 1OAZH 3EYUL 3VFOB 5JPMB 2AXFA 2VSDA 3I75A 2GITB 1OQOA 1HHHB 1QZ1A 3MV7D 4U7MA 4TUKH 5FUCC 5CEZD 1OAYL 4HDIB 4R3SA 3QXWA 3ARDD 4MQSB 5JOFB 1F90L 3U36A 4Q9RL 1ODAA 5IOPB 3BIKB 1BIHA 3TN0C 3N85L 3CPLA 1I7ZA 4UZGA 2VDOL 1XZ0A 3HHRB 3U1SH 3W0WA 4EIGB 1YEJL 4G9FE 3VGFA 1U92A 2ZUTA 1LO4L 3VFSB 4AEIL 4JE4B 5HGBA 4OT1L 1JFQH 1KF9B 2FLBT 2WUBH 2EDDA 4W81A 1LEIA 4EN3B 1RJLB 4L5FL 4PTTB 3SHSA 1MCLA 2VIRB 2GTZB 2R56H 4GRLB 3U0TA 1UXWA 5TF1H 3ES6B 1KCSH 3T0WA 3VXQB 4M1GL 4Q6IB 7CGTA 2WINA 3KG5A 4MD0B 4J3TA 5JIPA 3CLEH 2X44D 5JW3H 4YHIA 5EO9B 5FHAH 3K1DA 1JRHI 3G5YA 4P9HC 3WO4C 4DKEL 2VLRD 4P5MB 2ICWA 2WV3A 2F19L 2DQJH 4LSVH 1I9IH 3X17A 3WHXA 3O4LA 3S4SA 1ZVSB 3QHTC 1NAMA 4RAVB 5JPNB 1L9NA 4KHXL 4GRLD 5CZVL 1DQDL 4RWYH 4HT1L 2FJGB 3MODL 3OGCB 4O58L 4RGNE 3LHPL 2B0SL 4U6VH 4YHOH 2BOBB 3FB8B 4RIRB 3BW9B 3HI5H 1CL7I 5C6TH 1RMFL 1EJ6A 4YXKH 2C3HA 1V7ML 1A9EA 5JDJA 3TBTB 3D9AL 1CE1L 3F62A 3FFCD 4LPTA 1A1MB 4NJ9L 1LDPL 43CAB 4OB5L 3EJYC 3EDEA 5JXAL 1LGVA 2OBGA 4OZFA 4HUKB 1OARL 3RZCD 4L8DB 5FYKL 4JHWL 5CEYA 2A9NL 3D69A 3EOAA 1AFVL 5DD0H 4L4TA 5HHMD 1FFPB 2YMXL 4CMHB 1HI6A 2B5IC 3MA7A 1QFWI 3PGCB 3W81A 4I2XB 1NBYA 4K7PY 4AIXA 5HXMA 3ZO0A 1J0KA 4LKCA 4NQXB 4NZJA 1ZA6A 3QQ3A 4NM8L 4LCCA 5HHPA 3HCVB 4LLWB 3RKPA 5JQHC 4M6OL 3TBSA 4P23A 2R0KH 5B39B 4JDZB 1D5MA 2BNQA 1I3GL 2RJMA 1NCBL 3WKMH 1CGUA 1BBJA 1LEGA 2J4WH 1ETZB 2CK0L 4MA3B 4XZUB 5B8CC 4G8FA 1WITA 4LCUB 4YPJA 5MENB 2AQ1A 3SDAC 1VGKB 3O8XA 1TJHL 5T1LA 2YUWA 5AUMA 3NCJL 3IKKA 2VN4A 1CDBA 3O6FC 4ZQKA 3OHXB 5KSAA 2F54D 3AB0B 5H8DA 3BDBA 1W8OA 2ICES 1EAJA 3HPJB 3ZMRA 2ENSA 3DUUB 3EFFB 4Z0XB 3TA3A 1NAKL 5I1GL 3HAEA 5IEHA 1OB1B 2DLFL 3TN0D 2V9TA 3QWOB 1RZ8B 2OZ4A 2B4CL 4FFVD 2XRAL 4KVNH 4FQIH 2V9RA 4OAWA 3GIZH 3T0EE 3WDHA 4UNUA 2FHCA 3HS0B 2PTTB 3ARGC 3BWAB 5DHVH 4WI6A 4LF3B 4ZUWB 1HNFA 5HGHA 4U49A 4Z7VA 4P5TB 4CU6A 3BGFB 4KKAD 3STLB 3FT3B 4UT7H 4OTXH 4Y2DB 2FECI 3FO0H 4R0LC 1KJ2L 3L3DB 1BF2A 1I9RL 2MNUA 2V17H 2PXYD 4KXZH 4PG2A 1GGTA 3IDXL 1TZGL 4PRPB 2E9WA 5IFAL 1R5VA 1LE9A 1UFUA 5D2LA 1R24B 4JFYB 1T0NB 4KTYA 1CGYA 4AEFA 1RPQA 2DYPA 2GY5A 2VRAA 4NO2B 3TJHD 2H45A 4QRRD 1MI5E 1AQDB 4LCYA 4BZ1H 4JO3H 2GKIA 5D93B 4YDIL 3NCYP 1CR9H 3CVIL 1A1OA 3GM0A 3GRWL 4XPAH 5HHME 1JL8A 4P4KA 3RIFK 4OQ1A 5EULV 4P9HH 4LFHG 3VA6A 3OB8A 5IW6A 3G5XB 1A1NA 1T2QL 3H0TA 1A3RH 3U9UB 2R69L 4YGVA 3IJYA 3STBA 1UZ8A 4M62H 2DQCH 3SKUD 2I24N 5BVJB 3SGKC 3RRQA 5DJ2B 5DRNA 4Y8AA 5GSRA 3SDXB 1SHMA 2NY2D 5DUPH 5GJSH 4MB5A 5HGDA 3HNTH 1N7MH 3PL6D 4Q74A 2APXA 3MACL 4OLYH 5EU6B 3RWEB 5F1KC 2HFTA 5SWSD 5KSAD 1PEZA 2FB4H 2VH5L 4Z9KB 4MCYA 1E4XL 3TBYA 1YPZF 4P4KD 3LMJH 5F3HB 5I8CB 4UT6H 4S10A 4J6RL 3D0LA 4L3CB 3K2MC 4KTEL 3PNWA 3IRZA 5DZLA 3CSPA 3CXDL 1MVUA 4XP5L 5E1HB 5DUBB 1FNLA 4JG1L 5ICYA 1K5NB 1LMKA 3OXSB 4X6CA 4NO0D 4WTXA 4FFVC 3VXNB 3QNXB 4NBZB 3QNZB 4MLSA 3CXHK 4X80L 5HDQL 5JOPD 5AWNL 4XMLL 4GW5A 1YECH 1C16A 1JVKA 1CE6A 4HGMA 1MIEL 4ZFOL 3ZT7A 1HQ4A 1I7RB 3AREB 4U1MB 4MQXD 3RZCB 5T5FH 4APQB 3KPTA 1U58B 4KQ3L 3O4LE 1D9KA 3U30B 1VACB 2DAVA 3HNSL 4XVTH 4LSDA 5CSBA 3SKJH 1GOGA 3SDAD 1B4RA 3HG1A 4JRYE 3QPQC 1NPUA 4XHJC 1N2RB 4Y5YB 3PWUA 5JW4Q 5TH2B 2CDEA 2X7LA 3HE7A 2AV1A 1IGJB 1R3LA 2R29L 3DRTA 5CCKL 2OSLB 1UA6H 3MRGB 4JM4H 3PGFL 2UV3A 3DUUA 4UDUB 1KOAA 4J23A 1OTTC 2EXYC 3QRGH 1U8JA 4YHNA 4LAQL 1U8KB 1LE9B 5SWSA 3BPNB 3MV8A 4I0CC 2IQ9H 1ADQL 4GKSB 1P4IH 4HAFA 1FGNH 5E1AB 5EUOF 3G6JB 3KJ4B 4NZUH 4OZFH 3T4AA 5CBAA 1LE5B 1BX2B 4GKSA 1NMCC 5DMYA 2R0LL 3W0WE 2AXHA 1DDHB 4Q58C 5EN2A 5JHDE 1NLDL 4IDJH 3EYQC 5BRZE 2O61A 2PTTA 1V05A 3GKWH 1I4FB 2FO4B 3TYGL 1KN2L 2A9ML 2PUQT 2ZUYA 4HWBA 1VEOA 1N0LA 1U3HC 2EDQA 5SWSE 4W4OA 1CVRA 4KK8C 2EYRB 1X5XA 1RZIA 2VDML 2XKNA 5I73C 4PV9A 3RWIA 5GISH 1AY1H 1X9QA 5T3XD 4X7EC 1MCJA 3QCUH 2AEQL 4AH2A 4AEHL 3HMWL 2DDQH 3ZT6A 4KGLA 3W5NA 2DLGA 4HKZB 4NO5B 1G7HB 4ZFOA 2W0KA 4QRSA 4FQJH 1A22B 3QIWD 32C2B 1JGDA 1QBBA 4LLYB 2BVQA 4N5EC 3HMXL 2HFFB 1T1WB 2BMKA 3V4VL 3FB7A 2OK0H 1SJHA 5K9OA 4PY7B 4WNQB 4RQQA 2F58L 12E8L 5FKAB 3BESR 1KTRL 1WIPA 2X4SA 1JNJA 4TVSa 3PL6C 3WO3B 1F4HA 1JWUA 3J7HA 3O4LD 4X6CE 5KTEL 5F3HA 3U4AA 4HK0A 1G7MA 4UT9H 3QIBC 5J1SC 1KCLA 3JTSA 4WW2F 3ZKQD 5I76A 5IMKB 3DOSA 2DQUH 2A0LC 2W65B 5TDNA 1T03L 1Q1JL 5HY9B 1BD2E 3GMLB 3MTRA 1AO7A 1XH3A 5IROC 1CD1B 1A4KA 1KSRA 2HLFC 4ZD3H 5C0FB 4FZ8H 4P3DB 4PRHB 2XA8L 5EFIB 5HBBA 5TPWL 3DURA 1G6RL 3GMPA 4NCC1 3BFOA 3C60A 4GLRI 3TNNA 3S37H 3S97C 5FF6A 4XVSL 2Y1VA 5BOPA 2FBOJ 1GC1H 2Y6SC 3BAEL 2NY4C 4R7DB 3T04D 1U6AH 2WANA 1X6LA 4S2SA 3BKML 4LRNH 4EI6B 2FSEB 3O2VH 1J1PH 2FHFA 3N1QC 4QHMB 1KB9J 2XTJC 3KWWA 4MX7B 1XMWA 5CP3A 5DJCA 5C0CD 2BOCB 3Q6GH 2R2CA 3OKNA 4Z7UF 4H1LA 4OLEA 4XNUL 3QBTB 3QWOA 2WZPD 1ULVA 3V6OC 1ORSB 2VDPL 2ADJA 3MGOB 2JE8A 3HUJA 3VXMA 3TPUA 5LQBH 4LHJB 1F6LL 3EYFB 4DGYL 2E6JA 1FVCA 4UOW1 3WBDA 3GK8L 1UB5B 1IGML 1CDCA 1UVQB 4CMHC 3S35L 4DFHA 3WUWG 3L3OA 3RTQD 2VWEC 5T1KB 1F4XL 2H1PH 4PGCA 3NCBB 1H3TA 3VRIB 2H9GA 3B43A 3OWEA 3ZKNC 5DK0B 1JF6A 4MA8L 1NBVL 3LKOA 4M7ZB 4OAWB 3QHZH 4ONHA 1DBJL 5E03A 4KC3B 1HKLL 2ATKA 4PJ9D 4PR5B 2MCG1 2PW1A 4KZEL 4CUCA 5EBGA 4JCLA 1FVCB 3MRCA 2HKHL 2R0ZH 3UZEA 5MEPA 1OQXA 3BEWA 3B8YA 3G5YB 5DQDL 5F1SA 3WEXA 3MJ9A 2FJFB 5GS0C 4PJHB 3PDOA 2QL1A 3GIVB 1BBDH 4X5LA 5I66B 1X7QA 5KBNC 1RJYB 5EZIL 2C3XA 3HAEH 4XPTL 5C92A 2ZCHL 1OVZA 2DQEL 3L5XH 5IVZA 4L3EE 4MAYA 4NZRL 3STZB 4KKLD 2DQDH 3RWGB 4LKXA 2EE9A 1YMMA 1H3GA 3H3PL 4MYWB 1KCVL 3QEGH 1FL3B 5I75B 3UDWC 4DZ8A 2PTUA 1VFUA 3DYMA 5I15H 4UILL 5E2WL 2H41A 3NCCB 5GGTH 4KJWD 1RVFL 4EBQL 1OWWA 2YD2A 5JORA 2ARWA 1PYWB 1Q38A 1BHGA 1QLRB 3P0GB 1XF2B 3E3QC 1D6VL 5T1DL 1A7BA 3HI1A 1DLHA 2MSPA 3V4PH 3HKFA 3GMNB 3NABH 3RI5K 1S78C 2NXYC 3FONB 2XKSA 4B5EA 2J8OA 2DTMH 4F8TA 4LLDA 2RCSL 2J88L 3CGTA 3RUGA 2P48B 4PJIB 4IIQC 2P5EA 3T0AA 3FOLA 4ODHL 1WFUA 3P9LB 4IRSC 1FFOA 3VXUA 5IHZB 5I1JL 2VZ1A 1U95B 1OWRM 5B3JF 2YZ8A 1IJ9A 2A6IA 5EBWB 3INUL 5CKGA 5C9KA 5FGCE 3HA0A 4WCYL 6CGTA 4HDIA 2P8MA 4PJBA 4G8EB 2PO6C 3HC4L 4BKLB 4M6AA 1J8KA 3M8OH 1Q9LA 3I6GB 1VEMA 3QQ9D 5I1EH 2JLLA 4QRRA 5DR5L 1B0GB 4K2UH 1VFAA 4XCYB 3MGOA 1MFDH 5BW7A 4FP8L 2DIJA 1G7IA 3D85A 5DSCA 2O5YL 5H35A 2ESVB 4LHQB 4NRZA 1ZE3C 1LEKB 2DJ4A 3OZ9L 1O7VA 3F65A 4K94L 1FN4A 3WFDH 3BO8A 3OKDA 4JR9H 3QXDA 4YHMH 5EN2B 4Q0XH 4QLRA 1TZHA 4L9LC 3CDGA 4X7CC 1Q0XH 2E9JA 5ITBH 4JZJA 3VRIA 5AYUH 3T4AB 5T3ZE 5GRUL 3ARYA 3QIBA 3UTPD 2BXYA 4CKVX 4JG0L 3S36H 4HKZA 1MPAH 2PO6B 3GSVA 4FQXA 4JM2B 1PG7L 1OSZA 1T89C 1T7YA 4MD5A 4F7EA 2HT2D 2CMRH 3SJVE 1MVFA 5DLML 3U83A 5IBTL 2AAVA 4P23C 2JJSA 2AGJH 4H1LG 5F88A 2BVTA 4EI5D 4NKMB 3BP6B 3D25A 1KJ3L 4ZFGL 3QFDB 4MJIA 4K3HA 2HMIC 2VLKE 3CJJA 3DETD 3JTSB 5DMGD 5EU7C 3U0PA 3C60C 4PJ5A 5FGSA 4ONGH 5TDPA 3MV11 1NDGA 4WUUE 2FIRT 5IB1B 5DTFB 1H3XA 2W0LA 4MXWH 2IG2H 5IJVA 1HCFX 2PR4H 3CCHB 5D5MF 3K8MA 4XP4L 4NQVA 3G6JE 4MJ6B 4R90L 3SOBL 4KVCH 1FBIL 3Q1SL 1S7VA 4MNGB 2CKBH 2X42A 5D1ZD 3T0EC 2YD1A 5GS0L 3IFNH 3B2UC 3OKOA 1IAIH 4KJQD 5E8NA 3EO1B 3PV7A 4RWHA 4WUKH 1XGTA 2AJZA 5L2KB 4R7NA 3T65B 3ZSTA 4PJIE 1KC5L 1HHKA 2F5BL 3BZ4B 1OP5K 5LVEA 3TWCH 4HIEB 4HPYL 1OTUD 3GSNB 4HJJL 1N5YL 3FO1B 4Z7NF 3DIFA 5GZND 4LHUG 3LQMA 1S7WB 3ROOB 3GBML 4QTHA 4WW1A 1JNNL 5JW4N 4GW5B 1DQLH 4N8CL 4NQDE 2Y7QB 1S5HA 1SJHB 1UH4A 1FH5L 3LIZL 2ICWI 1XIWC 4V1DD 4Y2DD 3ZKND 5C07A 5EZOL 3DX7A 4OZGF 3HZYA 4NUGH 5KSBE 4L29A 4U33A 3RTQC 1ACYH 2DQHL 2M8XA 1CXFA 1L0YA 2WQRA 4N90E 3RI5F 5HGHB 1YN7A 5BZWA 3MGTB 5EU7E 1ZV5A 3D2UA 3IFOA 5TJWK 3GGWB 4TTGA 4UDUA 4PJCE 3RVWD 1A6UH 3M1BB 5DJ6A 3GI9H 3JWOC 4ZYKA 3SJVB 1EHXA 4Y19A 4JPWL 3HRZB 3E6FB 4M3JA 3MJ9H 1QYGL 3OBAA 3OAZK 3W9EA 2W1NA 1PY9A 3U48A 2NY3D 4N0FB 5J7CC 1OSZB 2RFXB 3CH1B 3WS6C 5DURD 4APQA 4Y19D 3J8F7 4JQVA 3MBEA 3MCLH 2NY4D 3TVMD 4LSPH 5DD6B 4UOJA 4FTVA 3SN6N 2EH7H 3QA3A 1JWMA 2PNDA 4K7PH 4QHNA 4X0KB 5EA0L 3EDJA 3UTTA 5CBEB 3BYTA 3CDGB 2IMMA 2R1YA 4G5ZH 4JRXA 2VLKB 3OKDB 4OCRL 3SO5A 4Y16A 4E41E 3IETA 4TULH 1H5BC 3CAFA 4OM1L 3KGRA 5HVGB 3QUZC 5HYFA 3BJLA 5B21A 1UH2A 3SCMD 3BZDA 3RY5A 4BSWB 2Y9RT 4JFPA 5JNYA 1R24A 3MRFB 2CDFB 2FGZA 2P8LA 5FXCH 3FB5A 4LARL 3R8QA 3RTQA 3JV6B 1BAFH 3TT3L 1DSFL 2YN3A 1IRAY 4QWWD 1QD0A 1Z6JT 2X1QA 3UO1L 1G9ML 3WV0A 1QRNE 3WN5B 2KKQA 2I60L 1Z9SA 4Y4HB 3UJIH 1A7PL 4KJPC 1Q72H 1ZTXL 3SKNB 4F9PA 3EJZC 4R2GB 3E2HC 1X4ZA 4XNYL 1N4XL 5F6IB 4HULB 4NHCL 2G60L 2VWEE 3FAWA 5HYSB 4RAVA 4GQ9L 5JPNA 3UAJC 4LDEB 3D85B 5DSCB 4AL8L 3DMMC 3PL6B 3ZTJG 5F8QC 1RI8A 4U6XA 5FDWB 4ELKB 2ZUWA 1FFPA 4M5YH 4PJFA 3DBXB 4JQVC 5EBMB 5B3NA 1EJOH 3OHXA 5KSAB 3MV8E 3NACL 2ZSWB 2IEPA 1I8IA 2A1WL 4X9GA 3GKZA 4LCUA 5MENA 4BFGA 4DGVH 5I8KL 4D8PA 4V2BA 2EDWA 4TNVK 4UDTA 1S9VB 1YQVH 4XC3L 5JORB 4ACPA 4S1RL 3EYQD 2EDLA 3HB3C 3IAQA 1FZKB 5ILTH 2NW2B 3VXRB 1V3MA 1PGRB 5I1IL 4GW1A 3DXAB 4GSDH 4Y88A 4IOFD 4HBQA 5IM7A 2Y06L 3RWDB 3VWJC 4WI7A 2IALB 1YEKH 2NY6C 4YDVA 1DFBL 5SX4I 1A6ZA 1AJ7H 4J7RA 4LDOB 3MOBL 1R6VA 4HC1L 4ZUWA 1S9YB 1PX4A 3IGAA 1YEIH 1O5DT 3EYVB 1JGVH 1RUAH 4PJ8B 3MNZA 1U8MA 1CYGA 4PP1D 5SWZA 2VSCA 2ESVA 5IROA 2C1PA 1KV3A 1KJMB 1CK0L 2H3NA 3DXAD 3TBVB 5IEHB 4LLUA 3X3GL 3IVKA 4F15B 5J6GA 1AGCA 4NWUH 4P57A 5D2LB 4I0KA 2VDRL 5GGQL 3QFJB 5K33A 1S7VB 1SMOA 1FNGA 2PO6A 3ALXA 1FL6B 3AAZA 4I5BA 1E6JL 4QGTA 1MWAH 5E99L 2CD0A 2IBBA 3HI6L 3C5SB 1I75A 2VZVA 3ARBA 3VRJB 3MXVH 2Y07H 4ZXBB 1HXYB 1I7ZB 4U3XA 3ZE2F 3G6DH 3FRPG 3RBGA 2J8HA 4GRWE 5B38A 2X9WA 1NAMH 4QYOB 3UC0H 4RWYL 3CLFH 1FRGL 2VERN 1DQMH 1PVHA 2F8XC 2DQTL 3HC0B 3VXOB 4O58H 2GITA 3LHPH 4U6VL 2JB5L 3AM8A 3HI5L 3HG1E 5C6TL 2NW3A 5ADOL 4OZIB 2FJHA 5KSVA 1YEDA 2XNAB 3ME0A 3ARDA 3L5IA 2YPLA 4HGKC 4YDKH 3ULVE 1VEPA 2QQLH 1T6VN 4OZHB 5DJZA 1FO0A 3ESVF 4C55A 1CICD 1PKQB 5DD0L 1G7JA 1ORQB 1U3HA 3BP5B 4ONHB 1TFHA 5C70A 5IGXL 1IAKB 1YYMH 1WTLA 4OLZL 2Z8SA 3P0VL 3UBXG 3C2AH 3V6OA 2CSPA 5DK3A 3L7EB 5LCVH 4P0DA 3HNVL 2C3VA 3ZTJH 3H9HB 1ZA6B 3QQ3B 2FJGA 2IFGA 2LU4A 3C5ZA 3RNKA 3HR5B 4DK6A 1BOGA 1T66D 5DK2B 1T5WB 1A64A 4I3GA 3CFJA 4GMTL 1YPZB 1XGQA 4O2CA 2JCCB 3C09C 4XAKE 1SM3H 4XI5C 2C3WA 5D7LD 1CLYH 1GH7A 1AKJB 1JUFB 2AABH 3DVNB 4G80A 1JI2A 4NQSB 5CILL 2HVKB 4YHYB 3LD8B 1CI5A 3VXMB 1LO2H 3T0DA 2OM5A 5I30L 2C4XA 4G8EA 3O11A 3KHQA 2ZOKB 5FHBL 5HHNA 5JQ6L 3RGVC 1GGIH 3PQYA 1A2YA 5KVMC 4Y5VB 2BOBA 3FQTB 1CFSB 3QR2A 4C4KT 1TJGL 4N68A 1NUGA 2PXYC 3C5SA 3PGDA 4ZPVA 3S4SG 5FYLL 3GMPB 4OLWL 4FFWD 4CW1B 5KSBA 5HSFA 4OF3A 3B9VA 1HH9B 4OTXL 4P3DA 4PRHA 4HJGB 5E70A 5AG8A 1FZOA 1F11A 3LEXB 2BSSB 4M48L 2VQUA 3CFKA 5AEAA 1JBJA 3B2VH 4HIXL 4HKXA 4NQCD 1QFUL 4XPGH 2EE2A 2VJXA 4J3VA 1TZGH 4LQ1A 4HQQL 4KV5F 3QO0B 1WZKA 4AENA 5EO1B 3PV6B 2Q6WB 2FZ3A 3TH3T 4K8RD 2Z31B 2VB5A 4PREB 2GTZA 5FYJH 5IB4B 2Y23A 5F7LB 5GS1C 4HH9A 2VXTH 1C12A 1G7QB 5HVHB 4XVUC 1LEIB 4GRWB 4L4TE 4MJID 4KJYA 2XI9A 1ONQB 5FGCB 2VE6A 3RWDA 3PIQB 2DI7A 2VTFA 1H3PH 5ESAA 3WFBH 4P9HL 4LKXB 5DVNA 4Z76B 4YQXH 5BW7C 2EZ0D 2E7HA 5DI8B 4G6AC 3Q3GB 3OL2A 4HWNA 2DB8A 3DMMA 4LRIA 5CGYC 4U31A 3GHEH 3VRJA 3S8WA 4GXUM 3T2OA 2EC9T 1IFHH 1KJVB 3MRDA 3RNQA 5E1AA 3I50H 1A7NL 3U46B 1UJTA 4Y1AB 4ZSOB 5GJSL 3TVMA 2EKSB 1N6QH 4OKVB 2IFFL 3EOBB 1AGDB 4Z5RB 4JN1L 1RD6A 1U93A 3IDGB 3C6LD 3MRCB 2ITCA 4W68A 3MRNB 4I77H 1JHLH 2NW3B 5AZEH 1XGRA 3MOAL 1F02I 4CNIA 1QSVA 3HRZA 3IYLW 4Y8DC 1DBMH 4LASH 2EEAA 4OF8A 4ZUUA 1QKZL 5ENWA 1LP9F 4M6ML 1IAMA 1MWAB 5EB9A 3NCMA 1RUPH 3MV01 1RU9H 2FSEA 4NN5C 2HN7B 1A6ZB 1E28B 2C1OA 2V7NB 3RY4A 4WTZA 2OR7A 2NLJB 5I1CL 4K3JL 3GMRA 5HYJD 3NPSB 3RJDA 3DNKA 4D0BB 2IPTH 3QA3B 3H7BB 1RIVL 2IPKA 1EAPA 3OX8A 1ZWIB 4CN6A 4L3EB 3VXPA 1N6VA 1R3HB 2D7PA 3S88L 2DOCA 2A6JA 2LABA 2D2OA 2CKNA 2HYMA 3DX6A 1MQ8A 1MIEH 4JO4H 4I1NB 1LO5A 5T5FL 2PCPB 4KQ3H 4S1SH 3VD3A 3V5HB 3ZDXF 1UGNA 4X6EB 5C6PB 4M5ZH 1SJEB 4U1HB 5IK3A 3WNLA 4FMFA 2D4FA 4KUCF 2AJXL 1WCQA 1BF8A 4EI6A 1I9JH 4NJAL 2PXYB 1ZGLM 4OFYD 4JFZL 3VFNB 1MCEA 4HH8A 1DBKL 3UCRA 2HKFL 1F4WL 2ADIA 1QLEH 4GBXB 1J8HB 1BEYH 3QRGL 2DLIA 5IMMA 5TFSL 1A6VH 3IU4L 5HI5C 5J1AB 2V5YA 4OV5B 3QUXB 1H5BB 2OL3B 2NW2A 2RFXA 3HR6A 4P99A 3EGSA 4E0RB 2NX5D 2DJSA 2A6DB 3CC5B 2Q3ZA 3T3PF 3BGAA 3U7YL 4KZDL 1DJSA 4NGHL 1RK0A 3GSQB 5DMJB 4JB9L 3OGOE 1MCBA 3SE4A 1Y0LA 5F8RC 2VLLA 2ERJC 1JRHH 2QHRH 1AGFB 1F3DH 3PWPA 4ZO6A 3IDIA 2R23B 5LWYH 1AP2B 3D2UB 5H94B 4L8SA 4MS8C 2NCMA 4LFHD 2MKLC 5EIVA 5I8OL 1Q9KB 4NO0A 3VFPB 1GZQB 3CK0L 4ONOA 3ZKMD 3PP4L 3EZ8A 5MI0B 4YHPB 5JLZA 3N50A 4JAMB 1XCTA 4YXHL 4PJAB 4RCAA 1YN6A 4OUOA 1NCAH 2EDHA 4ZAKA 3GSWB 3CMOH 4JFDA 2R2BA 1OP5H 3TCLB 4LLYA 1I3VA 1NGQH 3SGEI 1JI1A 3V4VH 4M7LH 4X5WA 1RAMA 5EUKA 4P5TA 3AXLB 5J13C 5KJRL 5MERA 1UM5H 2BSTB 1U8JB 4YHNB 2W60B 3OKKA 4YEFA 5FM5M 3L5JA 4MJIB 5TE6H 4P2QB 1A7OL 2P44B 1KEGH 3P11L 5D1QA 4RX4A 2YEZB 1KELH 4F7MA 5FM8A 4UT9L 2MFNA 4NIKB 4PJ9B 4ZPTB 5GGSY 3LN5B 4M7KH 1OGTA 5C08D 3GUTA 4TNVF 3D0VB 1KIRB 1T80A 3VXUE 4Y1AE 3MBED 3U79A 1G84A 1EGJL 4Z7OF 3VFVA 3TESA 2MQ3A 2XQYK 2R1YB 4NUJA 2R1WB 3BPLC 2H2SD 3CSBA 6FABH 2J6EH 2IGFH 4E41A 1EAPB 2JJSC 1CE6B 4P2OA 1V3KA 4WO4D 1WFOA 4XXCA 4PG9A 3E6HB 2A6DA 1YEEH 4R4NC 2J6EA 3PJSB 3BKJH 5EUOB 3VMNA 4A6YH 1D6EB 4D9RD 5FO7A 1X5KA 3U4EA 5H37H 3ZT5A 4GXVH 3VGGA 3IJYB 1TLKA 4X7FC 2X5PA 1JYVA 4MXQC 1LEKA 4PJIA 2NY1B 3PNWB 3T77B 3NMEA 4HKBA 1KTDB 1J1PL 4M1CC 1TVHB 4NYLB 1AD0B 3RUGF 4NCC2 1RFDL 5KANI 4JFOA 4DOHB 3FN9A 1LHZA 4XNUH 4PYHA 1JYWA 1Q9LB 3I6GA 4P5TD 4XWGH 4BYHA 3VGEA 3HUJE 1QO3B 3MZGB 4XPFL 4X98B 4O00A 1FLRL 4UAOB 3UZVB 5D93C 1IC5L 3C5JB 4XCNB 5I1AB 4G3YL 3MUHL 3ARSA 1YNLL 5KVDL 4OV5A 1ZEAH 3I9GL 2ADGB 2DI8A 3KPRE 4RBPH 1AI1H 1F3JA 2G2RA 5AAMA 1S8DA 1J0HA 3RVTD 1MREL 4XAWH 3B3IA 2K1MA 1NBVH 2IWGA 5E9DD 5FUOH 1ZS8B 3KYKL 5ITFA 5F6IC