2I27N

Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
109
Chain Sequence
RVDQTPQTITKETGESLTINCVLRDSNCALSSTYWYRKKSGSTNEESISKGGRYVETVNSGSKSFSLRINDLTVEDSGTYRCKPESRDAECAALNDQYGGGTVVTVNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords New Antigen Receptor Ancestral
publication title Maturation of Shark Single-domain (IgNAR) Antibodies: Evidence for Induced-fit Binding.
pubmed doi rcsb
source organism Ginglymostoma cirratum
molecule tags Immune system
total genus 29
structure length 109
sequence length 113
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i27N00
4GKZB 4LRIC 1IKFH 2IALB 2J8UA 5JORA 2Z93B 5T3XH 4NZDA 4JPVL 1MIML 4EDWL 1CL7I 1PQZA 3N1FC 3SGDI 3PP3H 2E3VA 3OKEA 2QR0B 4FFYH 3FB8B 2CLVB 4FZEL 3VG9B 3LEYH 1MJ7H 1QKZL 3IF1A 2CIIA 2AVGA 3VG0L 4X9GA 5HHQA 2O5YH 5HGAA 2UWEB 4KJQC 1DDHB 1MCIA 4MJ5A 4HKZB 4Y5XB 4LQFL 3JUYA 3MCLL 2A6DA 3P9MB 4OLYL 1LDPH 2I9LB 4OBRA 3VE0A 3VWKD 2DYPA 1YEGL 3GMNA 5L6YL 4IIQC 4BQBA 1JWMA 4PJ7B 3PL6B 1OD7A 5T1MA 1YPZF 4X98B 5C0BA 4Y19B 1D5XA 1R3LB 3N1QC 5ACLA 4FFVD 2GUOA 1ZLUK 3MREA 1AXTH 2BVPB 5GGRA 5GSRB 4HIHB 3QEHA 1ZVYA 3RZCB 2CDEA 3F6IA 4XNXH 1KGCD 1FNEB 4GG6F 2FX7H 4EN3C 3U0PA 1W0YT 1KIRB 3GSQA 5FGSA 3KVQA 3T08A 1D5IL 3RA7L 4WI9A 5GSVB 1C5BL 1R3IL 4OD1L 3O4LE 2YA2A 1CDUA 2R56L 1KULA 4UUJA 3NIGF 1HHIA 4OZFB 1X6NA 1U0QA 1YQ2A 4ZYKA 4K23L 5KW9H 3WDHA 4FQCL 2OL3H 4OSUL 3GBMH 1M71A 1BEYL 1TJGL 3MNWA 5FKPA 3G5XA 3T8XA 4XNMB 4YQXH 4JQVA 1IEBA 1WWWX 4KJQD 3D3VA 1NUGA 3T3PF 5F1IB 5DYOA 3DXAA 5F1OB 2PTTA 1HH9B 1NAMH 1OPGH 5LBSL 1KB5B 1U91B 2VITB 1ZT4A 4XNUH 5D7LB 2X4RB 3FFDB 2AW2A 1JPGA 3VGFA 5C0AA 2OTPA 4FQPA 2YKLL 3HAEA 1B0WA 3FB5B 1Z6JT 1OQOA 4QF1B 1W0WA 4WW1A 4GKNB 4AEHH 2D7NA 1NBVL 4GXVH 4XCFH 1TVBB 1RHFA 3ZTJH 2MNUA 3WS3B 5D2LF 4G8GA 4MQ7A 1GXEA 4JB9H 4IM8A 5CSZB 1PD6A 5E6YA 4BSWA 2PW2B 1FIGL 3MV9E 5DJAB 4EN3D 5INCA 1NCCH 3MRFB 3Q0HA 1JYNA 4PJXB 5C0CA 1JGEB 3RWEA 2YPLE 2CKBL 3T0BA 4GW5B 1KTDB 3MRJA 1G7HB 4NM8H 2P8PB 3MLWH 2Q3AA 3X14B 4DKAA 5DUBB 1IC4H 1YEJH 3C6LC 2O5XL 3HPJB 5DZOA 1J87A 2E9JA 2VDQH 4EIGB 1CXLA 5FYLE 1I1AA 4HIEA 2VDLH 5L2JA 3HAEG 5SV4A 3C8KA 5I0ZA 1KJ2B 1EO5A 4U6VL 2VLJD 3P77A 3PGCB 5DT1H 2W9LA 4MAUL 1MFEH 5D2LA 5D1QA 2DJUA 3MLTA 4RDQG 4WUUA 3ZYOA 1PZ5B 4OI7A 4M43H 5J11C 3WHE1 1NMCC 1EK3A 1CD0A 1NJ9A 3LY6A 4JREC 5I1IH 2KH2B 5ELIA 2YD1A 1N64L 1ZHNB 4PGDA 1ZHBA 4GRWF 3J7HA 2VISA 1DBKH 4L9DA 3ZKNC 1KPRB 3MRQB 3BZDA 3OKLB 2H9GA 1IAOA 1ZEAL 3M8OL 2ID5A 1JZ5A 4F15B 4JO2H 2ESVA 3MFFB 3S97C 1PLGL 2PXYA 4LSRH 1U8OB 3FB6A 3KYOB 4LNRA 4L3ED 4YAQB 2X70A 1A7BA 4PLNC 4KMQA 3I3BA 1AGBA 1JGUH 3SGEH 2ICWA 3H7BB 1S7VA 3C6LD 3VG9C 5IROA 5DRXA 1XR9A 3HCVB 1BECA 1WTGT 1A6ZA 3K81A 5F9JB 4P5MB 1JWSA 2BOCA 5EC2B 5AZEL 1UWXK 1YMMD 4Z7VF 2EDFA 4Y5XC 3DNKA 1Q9WB 1UKSA 5C0GA 1S9YA 5HHPA 5JHLL 2X4UB 3PQYB 5FXCH 1YYLL 1N3NB 1GZPA 3ET9F 1LE5B 3HZYA 3WLWC 3UDWA 4DKFL 5AZ2H 3BD3A 3ZKND 2WK2A 3RL1A 2COQA 1G9NL 1GGYA 3CX2A 5I18L 1A1MA 1DQLH 1UH2A 1R3HA 4LASL 2HJLA 4BJLA 2R23B 1CDJA 2YK1H 4U1GB 3O11A 4H26B 5HPMA 1WITA 4S11A 3V7AE 3D0LA 1XIWA 5E2UL 2LABA 4UIKH 3NFPB 4NOFA 3EDJA 4S2SB 2K9UA 3DUUA 4R4FH 1T1YA 4L3CB 5FF6A 1QZ1A 1TZIA 2HFEB 3OQ3B 2F8OA 1II4E 4CU7A 2RQ8A 1DTUA 3DIFA 4QHKI 3EDDA 5D8JL 2C1OB 2AK1L 4O58L 4U0RB 3GKWH 1U8HA 5GJSH 32C2B 2Z0BA 3P30L 3PE9A 4PJEB 1PBYA 4GAFB 1X7QB 4D8PA 3DRQA 4Z7WB 1K8IA 2NY7L 4GAYA 3T4AB 3GNMH 1EVUA 3G5ZA 4DOHE 3U7WL 1TQCB 3WJJA 1FBIL 2PYFA 2WLZA 1VERA 3DO3A 5B3JE 5FUOH 1EJOH 2J8UB 2LTQB 5JORB 5ESAA 3WLWD 4FQIH 2NW3A 1PQZB 3H6JA 3OKEB 5D5ME 1VA9A 3MODL 4AEEA 3RZCD 1KTKE 4TVPE 4BFBD 1NPUA 1FGVH 3HN3A 2CIIB 3IF1B 1WZ1H 1S5IH 5HHQB 3KPSD 5HGAB 3OWEA 1UJ3A 1N4XH 3CSYA 1S7XA 4MJ5B 3MZTA 4D9LL 5ITFA 4DGVH 1AO7D 2ATKA 3S96A 1RUML 4OFKA 2A6DB 2XZZA 5TF1H 3VE0B 3ZE1E 4E41A 5BRZD 4JFZH 2DYPB 3GMNB 3T4YA 1I7RA 1URLA 1JWMB 5T1MB 5C0BB 5L7XH 1D5XB 2XY2A 3WKNA 4HQQH 2GUOB 3KYKH 3MREB 3L3HA 5GGRB 4G6JH 3QEHB 3CU1A 3RVWC 2CDEB 2NX5A 4KH2A 1A4JA 3U0PB 4M3KB 3GSQB 5DD0H 5JIIA 1QEWA 5J57B 5DHVA 2BHYA 5KBNC 5HVHB 2K1MA 4X6BA 3CD4A 4NKIH 4NN6B 4UUJB 4OT1H 5CJQH 9CGTA 2RBLA 1HHIB 4U3HA 5D96B 1NFDE 4D94A 4ZYKB 4AM0B 2RAMA 1UACL 2Q8AL 2NXYB 3EAKA 5FKPB 1M71B 3MNWB 2F53A 3G5XB 1JNLL 3T8XB 1P4BH 1A7NH 1AQDA 1IEBB 3IU3A 3PDOA 2O61A 4M8VA 4S1QH 3A6CL 4I18A 4PG2C 4PRAA 5DYOB 3DXAB 2R4SL 2PTTB 1GGBL 2N7BA 3AS3A 4KVNL 1WWAX 4W4NA 1ZT4B 3MSPA 1JPGB 4N0CC 5FEBA 1SMAA 3WN5A 3MLVH 5C0AB 3HAEB 1MQKL 1MFAL 3GMPA 4I3RH 4HJJH 5AUMA 1P9MA 1W0WB 4WW1B 3GRWA 2VLRE 2XKSA 3WNLA 1IC5L 3FT3A 4FP8H 3MV11 3RVWD 3UYPA 4G8GB 4XBEL 4MQ7B 4BSWB 3GHBH 4K7FA 5INCB 5D7JA 3UTTA 3I50H 1KCKA 4JM2F 5C0CB 3RPIA 1V3JA 3RWEB 3I9GH 2BOBA 3TO4A 4UTAL 3MR9A 1T20A 3WKML 1BGXH 2DLHA 1OAQL 3QDJE 3MRJB 1GAFH 3N85L 1LO4L 3T2NH 4HG4J 1F97A 5EORH 3OG6B 3MX0A 3NTCH 1IE5A 2DQGH 1INDL 1IM9A 4LHUA 4M6OL 1I1AB 4HIEB 5L2JB 3E1F1 3LQAH 3C8KB 3QEGL 5H35A 3W0WA 1HKLL 3P77B 3EDEA 2FX8H 1K9TA 5D2LB 5D1QB 4Y2DA 1YNKH 1A1OA 3SDAA 1WWBX 4PY7A 3MLTB 4WUUB 3GMMA 3I6GA 4JM2A 3C8DA 4N0CD 1NJ9B 5C6TL 2E7LA 3C2SA 5F7FA 1TCRA 3QUMH 4U0RC 4PGDB 1ZHBB 2VISB 4CVUA 5MERA 4LAQH 4YC2B 3OF6D 1IGFH 2H9GB 4PGJA 1IAOB 1BMGA 1CDIA 2ESVB 4CVXA 1KELH 5AWNH 4UNTA 1FG2A 4GAJL 5TPWH 1NCWL 2PXYB 1NGZA 1G6RH 5A40E 3FB6B 2LTQC 1RUKL 4LNRB 3U83A 3VI4E 2HKFL 2X70B 2HP4A 3DSNA 1JGLL 4W6XB 1AGBB 3VGAB 2ICWB 4ODUA 1S7VB 2HVKA 4V2CB 4EJ1C 1EHXA 1IAMA 5DRXB 1I9IL 1XR9B 2BC4A 3NGBB 1A6ZB 4G6KH 2X10A 1JWSB 1G1CA 2BOCB 3MLPA 4GRWB 2UV3A 4K07A 1X44A 3NPSC 1CL7L 3SBWA 4QTIH 1A0QH 1MAJA 5HVGB 1ITBB 5C0GB 1S9YB 5HHPB 5JOPE 1KCRH 2WUCL 1KACB 1YN7A 3ALPA 1LEGA 3OKMA 1FE8L 1RZGA 5IBLC 2BVTA 5IHUH 3GI8L 5CILH 2EYTA 1AP2A 1GZPB 5F1SA 3HZYB 4U4BA 3VXUE 4UINL 3RL1B 1ZGLA 1BVLA 1DUYA 1MIEH 1U8IA 1EAPA 1RJLA 3T0XA 3RZWA 1WK0A 1X5IA 1I3GH 1A1MB 1RURL 1R3HB 2JTDA 2HJLB 4GQ9L 2D7PA 1A7OL 2X89A 3QI9C 5EWIL 43C9A 3O11B 5HPMB 5FYJE 3D0LB 1XIWB 2XICA 1BAFH 4Q9QH 1MCPL 4LIQH 2QSTA 4H20H 4WFFE 3DUUB 1T1YB 1VFBA 5IVZA 1NCNA 4WO4B 4JG0H 4HWNA 4WTZA 2EE9A 5FF6B 1TZIB 5TF0A 2OJZL 4K3EH 4OJFL 1I9JL 3DIFB 1VDGA 4RNRA 4Z8FH 3S88L 4OTXL 4LDOB 4XPTH 2YXFA 2XZQH 1U8HB 1WEJH 5MI0B 4OF6A 4RMVA 4D8PB 3DRQB 1K8IB 4NKOA 2D9QB 4GAYB 3AS1A 5EUOB 5HHXH 4LCWD 3G5ZB 1BQUA 1ZANL 2DYPD 1LK2A 2PYFB 5IBLD 1E4WH 2CK0H 2BVQA 5ICXA 3MJ7A 5ESAB 1F02I 4ZUTA 3EFDH 4JQIL 2NW3B 4EOWL 3DETD 2GK0A 5BOPA 1JFQL 1YC8A 5CSBA 4WTZG 1H9VA 3ZKQD 3C87A 5KS9E 1AR1C 1ZXQA 4BYHA 3QI9D 1WZMA 5GHWL 5IMKA 4QHNA 2EDBA 4PB0H 1T89C 1UJ3B 3VRIA 3CSYB 3RTQC 1T04A 1S7XB 2AKRA 5ITFB 1XGRA 1HINL 2ATKB 3S96B 5B38A 1J18A 2VXSH 1IKNA 2XA8H 4GQPH 2NY0B 1CF8L 1L7IL 4R6UA 4E41B 2LVCA 4ZPVA 4TSBH 3T4YB 1I7RB 2NXYD 2VH5H 3UROR 4HDIA 4OKVA 5EZIL 3D3VD 4DQOH 1T0MA 4JDTH 3L3HB 1KCSL 3HA0A 2P5WA 3T0EE 3QFJE 4JHBA 5D1QC 3U7YL 5KANI 2WBJC 1HXMA 4JR9H 2NX5B 1GHFH 5FK9A 2IBZX 1HSBA 4MXQC 5DVLA 1A4JB 1WAAE 1JI2A 1JRHI 1UXSA 4F3FA 1L4IA 3NA4A 1QEWB 4ZFOL 4PV8A 5DHVB 4AG4H 2DN7A 4YHZL 1EFQA 3UAJC 4X6BB 2EDEA 4YC2C 5B38G 1YC7A 5T5FL 3ALXA 1JPSH 1FCGA 2BX5A 4W4OA 3I6LD 1AR1D 4OZFH 1KCVL 1T1ZA 4KTDL 3VD5A 1RUQH 2NR6C 3ZKMC 5C0CD 2F53B 2VZVA 1AQDB 2ZP0T 3IU3B 3PDOB 2O61B 4I18B 4PRAB 1NLBL 1S3KH 2H2SC 1WC7A 3MROA 4XC3L 5D2NC 4I48A 5DJZA 4P4KA 4L4VE 3C60A 3BRFA 1C12A 1OQXA 3GMRA 1E4XI 1KB5H 3FO1A 1LO2L 1BF2A 3WN5B 4HPOH 2D2OA 5F3BA 3ARQA 3NH7H 3GMPB 2P47B 3BKCH 5AUMB 3DYOA 1A9EA 3MCKA 1Q9LA 1K4CA 1WF5A 1V7ML 1SMOA 2CDFA 3FT3B 4UIMA 4KKLC 2WBJD 5D1QD 5A1AA 3MZGB 4WUUD 1PYWA 4K7FB 3QXWA 4MXQD 5D7JB 4YR6A 2CKBA 3GO1L 3UTTB 3RPIB 2BOBB 3TO4B 5DJ0A 3MR9B 1X5JA 1CU4L 1T20B 4HEME 4CADA 3UDWC 3MUZ1 2OR9H 3JWNC 4QOKD 3HNVL 4CNIA 5F9AC 1N8ZA 1F58H 1A6AA 4BUHA 3O2VH 3E8UH 2XKUA 1IGTA 2NR6D 5CJXC 5IB1A 3ZKMD 1T2QL 5JW3H 3BWUC 3GSUA 2XKNA 1IM9B 4LHUB 2PXYD 2HKHH 4ZO6A 5H35B 5FDWA 3W0WB 2H2SD 4C56A 1UT9A 4X5XA 3C8HA 4HLJA 4XP4H 4Y2DB 1ZHKA 1A1OB 3SDAB 1QR1A 4PY7B 4WCYH 3CVIL 3GMMB 3I6GB 4JM2B 2VZ1A 5T3ZE 4OZIF 4LPYA 1M1SA 3NZHH 1CDBA 4PRIA 4F8TA 4ZAKC 5C08D 1TCRB 4HD9A 3VRLE 2NY4B 5DHXB 5AG8A 5MERB 5C0IA 1CK0L 2NPLX 3CK0H 5EFIA 5MI0C 1JMXA 3GBLA 4PUBL 3WO3B 4KZEL 4KKLD 4S1SH 1X4ZA 2DBLL 5DQDL 1Y18A 4J3UA 4CVXB 3U9UA 1RIVH 1EHLH 1EMTH 3QISA 4LVEA 1FG2B 2DAVA 1NGZB 4JKWA 3L3GA 3KHOA 1V7NL 5HYFA 2VDOH 4OD2A 1FVCA 4MMXC 2EO1A 3EOYG 5DZLA 4YEFA 4YDVA 3EYSL 3RGVC 4DCQA 5CCKH 4ODUB 3QEQB 3WDIA 2HVKB 5GRWA 1FO0L 4OZIA 3W39A 5D72H 3KYMA 2BC4B 3CFDA 2XG4A 3HUJA 1F6LL 2QADB 4M5YL 2XWTA 3P9LA 4QHUA 2XQBH 4YHKL 2XZAL 3EDKA 3EJYC 5EA0H 4ALAH 2VL4A 3I3DA 4S0TD 5F7EL 2DQJL 2HT3C 1HXYA 2H6PA 1YN7B 1LEGB 1RZGB 2XTLA 4JFDE 5IWLA 2APFA 2NY0C 5JW4R 4NHCH 1UA6L 3B5GA 3BJ91 3BPOC 1EO8H 4ZAKD 2EYTB 4F58H 1FYHB 4I4WA 1AP2B 2P46B 3Q3GA 1SBSL 1KN4L 3MLYL 3IAGC 5EOCL 1WT5C 2CRIA 2P8MA 2OQJA 1ZGLB 1CD8A 1BVLB 1DUYB 1U8IB 3L3IA 1EAPB 1MWAL 4I9WD 3FQRA 4ZD3H 1T7XA 3CFCL 2OM5A 43C9B 3H9SE 4AMKL 5F7DA 4KXZH 1X4XA 3FCTA 5LJYH 3MACH 2D7OA 3ROLA 1H3XA 1VFAA 1VFBB 5IVZB 5I8EA 1MJJA 2X1OA 2QSCH 3RGVD 3WUZA 5DD5L 3U46A 4WFHD 4DKDC 4OAWA 1YEEH 5I1GH 4RNRB 3BFOA 4KDTA 4PJGE 5ANMA 2PKDA 1JYWA 2VKXA 5BOZG 4ZNCD 3EJYD 3SGKC 5C9JA 3VWJA 2HT3D 4NKOB 5TGBA 3A6OA 5J1AA 4P48A 4BZ2H 2EDKA 3V4UL 2NY0D 3RU8H 4E41D 4Q97A 1JHKH 1LK2B 5KTEL 1BM3H 2BVQB 3NCCB 4ZO9A 3X3FH 5ICXB 3MJ7B 3V0WH 4Z7OF 4RGNC 4M62L 4ZUTB 4OF0A 2AJUH 1P9MC 4PGBA 2GK0B 3FN0L 5C8JA 5DS8A 1N7MH 1CICA 2CJUL 5ID0A 2B0SH 5FYLL 3TH3T 4PRPA 5IMKB 3PDDA 4OF8A 1QYGL 4QHNB 3CLFH 3THMH 4NFDA 4OLVH 3VRIB 3LD8B 1T04B 2AKRB 4C83A 3ARGC 4P2RA 5B38B 5BS0E 3HI5H 3L3JA 3BAEH 4HCRL 1IFHL 2JJVA 4PJCF 4ZPVB 2R0LL 4Y4FA 3BPNB 3VXSA 4CJ0A 4HDIB 2BY2A 4OKVB 1B4JH 1DVFC 3VW3L 3QUXC 1QNZH 2ZJSL 4PJDF 1T0MB 4JDVA 1PJ9A 2P5WB 4YUEL 3HZVA 3H9ZA 1HXMB 3OAZH 5FK9B 1HSBB 5JXEA 4ZS6C 1UXSB 3NCJH 4X6CF 4F3FB 1MRCH 4JM2C 4PV8B 1BX2A 4XX1G 1XGYL 1D7FA 1G84A 4RGND 5D71L 4JY4A 1PEZA 1PFCA 5DC9B 5I1EH 3U0TA 4PJCA 2BNQE 5E5RB 3RI5K 1MCWM 4FNLH 5T1LA 3MUHL 4KK9C 4K94C 5DLML 1GSMA 1DN2A 3LAFA 1PKQE 3NFNB 4WW2F 1G7JA 4FTVE 3BD5A 3TO4D 4X7DC 2K7QA 2DQTH 4PJDA 2CUIA 4O02L 3ARGD 3FN3A 1AC0A 5DRNA 1X5GA 1WC7B 3MROB 4I48B 5FYKD 4KDVA 4Y16C 5DJZB 4P4KB 5I1DA 3C60B 1J0HA 4X6CA 1C12B 3GMRB 4CVWA 3OKDA 3FO1B 3INUH 5BW7C 3IT8D 5F3BB 5I1HL 3SKNA 1CIUA 4LHUD 1DVFD 2JJSA 5F88A 1A9EB 1T2XA 3QUXD 3MCKB 4MJID 5GRJL 4HC1L 4U2ZA 3SBWC 1Q9LB 1K4CB 3HAEH 3TWCH 3W0WD 4JFYA 4RMWA 4AYFA 2CDFB 4UIMB 4JRXD 4Y2DD 2Q6WA 3QIUA 3SDAD 2KDGA 1PYWB 4Z18A 2AJSH 4YR6B 2EXWD 4ZS6D 3BGFB 2CKBB 4JM2D 4PRHA 1IEAA 2GJ6A 5ITBL 4PJHE 1UM6H 1T66D 4QY8A 1Z9OA 5DJ0B 4Z7UE 3H9HA 4CADB 1DJSA 3KDMA 5LQBL 4ORZC 3HLAB 4CNIB 1N8ZB 1X5YA 1IC1A 3NCMA 1A6AB 3K8MA 2I60H 1IGTB 4GH7B 5CD5C 4KK9D 3U9PH 3UJTL 5IB1B 2CKNA 3GSUB 5DK2A 1NCAL 1IILE 1YNTA 4Y1AA 3D85D 3AS0A 5FDWB 4Z0BH 1CLZH 1IBGH 4C56B 4X5XB 3HS0A 4M9PA 4H88L 1NCUA 1XGTA 2I07A 1ZHKB 4P2CG 1B2WL 1QR1B 4QYOA 1HZHL 4KUCD 3WIHL 4FQ2L 1A6VL 2DLFH 5FYKU 2RGSA 4TULH 1CGTA 2PF6A 3QQ9C 4DZBA 3DGCR 4PRIB 2ARWA 4B50A 1UKQA 2L4OA 2GITA 5C0IB 4CJ1A 3IAPA 3RDTC 5EFIB 1DLFH 4J7RA 4TVPL 1IZJA 2P42B 1JGVL 5EIQA 4Q9RH 3BKJL 3B8YA 1Y18B 3B9DA 4N90E 5A43C 3U9UB 5L2KA 2MQCA 3F65A 1F4WL 4LRNL 3AREA 3CFKA 4ZDHA 2VC2L 4LLDA 5IMOA 4YHML 3WXVH 4OD2B 2W0KA 1FVCB 3HRZA 2HWZH 5DEGA 3Q6GL 4YDVB 4DCQB 4ODHL 4ZTOL 3KGRA 4OZIB 5CD5D 5EH1A 3W39B 3KYMB 5IW1A 5EO1A 3CFDB 1I3VA 4KV5F 3HUJB 2XWTB 3P9LB 4QHUB 5K9QI 3LD8C 3KPPA 5LGKA 1U42A 5F7WC 4GRWH 5MENE 5TE6L 1CZ8H 4I13B 3P4MA 1LD9A 2ZCHL 1JZ8A 4M93C 2BERA 1HXYB 2H6PB 2ZSVA 2GQHA 3O4OB 3BEVA 5BQ7A 4J4PC 1KJ3L 3VFRA 1QBML 3QQ9D 1H3PH 2AJ3A 4I4WB 4WRLA 4L5FL 2HRLA 2UVFA 3Q3GB 5HDLA 1UKTA 3D39E 1Z5LA 2IMNA 5F44A 3RDTD 2P8MB 2OQJB 1MAKA 5JW4M 1BVZA 3L3IB 4ETYA 4P9ML 3FQRB 4PJFF 4YBHA 4Y5VA 4P3DA 3BT2L 4YHYC 4JM4L 4NJ9H 3R8BB 1C08A 2ARJA 3P11L 5F7DB 3NCYP 2JB6A 3FCTB 1QRNE 3ROLB 5KSBF 2VWEC 1VFAB 5I8EB 1MJJB 3MBEA 3WNKA 4E9LA 2AJVH 4MXWL 1XF1A 1DQDL 3KPMA 3U46B 5TDNA 4IRJA 1JRHL 3NFSL 5EU6D 4OAWB 2JF1A 3VRJA 1T7YA 2RHEA 5DQJA 4HKJA 4U6HA 1KFAH 4N0RA 4NZRH 5ANMB 2NCMA 2HAZA 1QLEL 2F8XC 5C9JB 3VWJB 3ZO0A 4P4KC 4DN4L 4PJFA 5TGBB 3C60C 3IDXL 5J1AB 3LB6C 1L9MA 4CMMA 1UM5L 4JCLA 5GS2D 1C8PA 4WNQA 2R4RL 5KSBA 3FRUA 2W60A 4HJGA 1ZA6A 3HC4H 2IWGA 4PGBB 4UILL 5C8JB 3BPCA 5DS8B 4WFGD 1KJVA 1CICB 1YECL 3E3QE 1DE4A 3IJSA 5ID0B 2AEIT 4UB0L 1C5DA 4RMRA 3PQYE 4PRPB 3HE7A 4CW1A 3KPOA 2BSED 2VR4A 3GM0A 1ODAA 3ZT7A 4F7EA 4C83B 4P2RB 4XT1C 3DSFL 3L3JB 1K6QL 1GGTA 1CGUA 1NCTA 2DQDH 1MJUL 4X7FC 2BNRD 4Y4FB 5EU7C 4R97C 2Z8SA 3VXSB 2HFFA 1GGCL 4ERSL 5E8EA 1WISA 2Z35A 4URTB 4RAUA 2EIZA 4JDVB 4FQ1H 3HZVB 1KPVA 2P7TA 3OAYH 4P4KD 1P2CA 3C60D 5I1JH 4HUVA 3LB6D 3M1BA 4ZFOA 4EI5A 3MRLA 3B5TA 4LSSL 1BX2B 5KVDH 1DFBL 5E5MA 2WP3O 3L1OL 3HPLA 1KCUL 5DHVH 1RZIA 4JY4B 3QUYA 2DIJA 1VSCA 1NCBH 4Z7WE 12E8L 3U0TB 2EEAA 4LLQA 1EA9C 5T5NF 2W65A 3UYOD 4PJCB 1G9EA 3DVFA 1YQVL 4ZSOA 1FNFA 5T1LB 2R0ZH 2Y5EA 4HJ0C 3BZ4A 4UT9H 4OV5A 1BPVA 1G7JB 2LU3A 1EZVX 3B9KC 1YMHA 4LVOB 4CBPA 4PJDB 1YNLH 5DRNB 1PG7X 4KK5C 3V95A 2ZKHH 3M45A 3K3QA 1GC1C 4GAGL 5I1DB 4X6CB 2ADIA 4YFEA 3OKDB 3KLSA 4I8DA 1RVFL 3SKNB 3TN0C 1T83C 2FECL 4XNYL 5F88B 1CTOA 1UVQA 1U8LA 2GKIA 4Z7NE 4K9EH 4NQEA 4C56D 4JFYB 4YHNA 4NZUH 4C59B 4XAKE 4M61A 5SV3A 4I3SH 3GRWH 2Q6WB 4NN7C 3QIUB 3T65A 1RZJL 5FYJL 3O0RH 1DBJH 5F72S 1EV2E 3PWPD 4PRHB 1IEAB 2GJ6B 4XP1H 5IWLC 2A6KA 4LDEB 5C0BE 4QY8B 3RAJL 1MCOH 2ZNWA 3O6MH 4KMLB 3H9HB 3RIFF 1OSPL 3KDMB 2C26A 4OLXH 4N1HB 2MQ3A 1NMBL 3QCVL 4UAOC 5LCVH 1MCHA 2YD2A 1BBJA 4KC3B 3H7LA 4HJ0D 4UV4L 5CWSA 5DK2B 4XGZA 4WI4A 2ED9A 2R2CA 3B9KD 1RZ7L 1YNTB 1P1ZA 1BF8A 4Y1AB 4OB5H 4KK5D 3HS0B 2ZCKH 2P8LA 2B7DT 1XGTB 2I07B 1CXKA 4QYOB 5EIVA 3BX7C 3O41A 4GRLA 4ZUVA 5FFLA 1MAML 3A67L 3DUHA 4F9PA 1CLYL 2Q3ZA 5IKCA 4DZBB 4ZQKA 4DN3H 3TN0D 4NPYA 4OQTL 4KDTC 2GITB 2KPNA 4HBCL 2PTUA 4OIIL 1IQWH 1JPST 1I7TA 1RU9L 5FO9A 4IRSC 1FFRA 1OAZL 3PF2A 4Y0GA 2ED7A 3P0GB 5L2KB 1FC2D 3EIFA 3AREB 3CFKB 5E2WH 4RWYL 4K94H 4ZDHB 5DJ2A 3HE6C 4LLDB 5IMOB 4GW1A 3HRZB 5DEGB 4U1IA 1FO0A 1YYMH 3QNXA 5CBEA 2HLFC 1CICC 3K2UL 5JA8B 5KVGL 1FZJA 4GLRH 3NIDF 3TYFA 5E0QA 4LLWA 5IW1B 5EO1B 3SHSA 3MJ8A 3GJEA 4O51A 1RUPL 2IBZY 3KPPB 3LH2H 3P4MB 1LD9B 2RCSL 4OFDA 1MQ8A 4LVNC 2ZSVB 3RY6A 2DIAA 3BEVB 3O4LA 5BQ7B 1QACA 2Y36H 4HX1A 2J88L 4NKQB 3VFRB 4Y4FC 4B7IA 5BV7L 2AJ3B 2Z8VC 1HN1A 2Z91A 1RD6A 2XYCA 4WEMB 4JFFE 1NUFA 3SEPA 1Z5LB 1G7LA 1MWAA 5E4EB 1V3LA 5DMIL 4V1DD 2A74A 4IRSD 5EU5A 3KNBA 2BJML 2EDLA 2MKWA 1FGNL 4Y5VB 4H0HB 4P3DB 1J5OL 4ZO7A 5KJRL 3IDGA 3ZE2E 1C08B 2ARJB 3HE6D 2JB6B 3DGGA 2DQFA 1DZBA 1HEZA 2OR7A 4UQ3A 3F7PC 4F7MA 1DN0A 3MBEB 1LO3L 5IVXE 5TQ2L 2ESVE 3KPMB 5TDNB 2HLFD 4IRJB 1CICD 4D3CL 3T3ME 3VRJB 5FCUH 5J12C 4D0BA 5DQJB 4HKJB 4NUGL 4U6HB 3KS0H 4PJAE 2MKLC 3MV9A 4LVOC 2A9NH 3QPXL 1JNJA 1MY7A 4P2RD 3TYGL 2YPLA 3S4SG 1RULL 1DANU 4MLSA 5LWYL 2C3XA 5DA4A 3R1GL 4M7ZB 4PJFB 5IF0A 5BVPH 5IQ7L 2FWOA 4CMMB 4QXGH 5JW5A 1IGJA 4Y4FD 5J13C 1UWEL 2FBOJ 3SO5A 2VUYA 4WNQB 4S1RL 2HA1A 5KSBB 3FRUB 1MHEA 2W60B 4LP5A 3H42L 2WBWB 4HJGB 2BSTA 1MIMH 1ZA6B 1UC6A 2DLGA 3FMGL 4JPVH 3JVGC 4AK1A 3BPCB 1FFQA 4P46C 1QSFD 1KJVB 3IJSB 3A0OA 3QQ3A 1DE4B 4FZEH 3WSQL 4MNQD 2E9WA 5JPNA 5JXED 1C5DB 5HHOE 3LVEA 2H41A 3HE7B 3VG0H 4WW2C 4CW1B 3KPOB 2F74A 3MXVL 2R29L 4F7EB 2X4SA 3LN5A 5CZVL 1OTSC 3RUGE 4HCRA 3BE1L 4YPGA 5T3ZL 1GIGL 1H3TA 1QTYT 1OGAD 3MJ6A 4XP9L 4QRRE 4XMPL 5T1LD 5L6YH 4KMTL 3FOMA 2HFFB 5ADPL 1CXHA 2X2YA 5E8EB 5GS2H 1P7QA 3LKQA 5GGVY 2Z35B 1EUTA 1F5WA 4RAUB 2EIZB 1ZOXA 4M7LH 1S5HA 1WV7T 2V5YA 1KPVB 2P7TB 3D25A 1P2CB 4Z78A 4RMTA 2VYRE 4HUVB 3O6FC 3M1BB 5A2LH 4ZFOB 3DV4A 4B5EA 4EI5B 4RSVA 4GXUN 2QQKL 3PHOB 1PEWA 5CZXC 1VADA 3HPLB 4GSDL 5GGQL 3RJDA 1C5BH 1R3IH 4OD1H 1RZIB 3QUYB 3TZVC 2VLLA 1ZTXH 2R56H 2A9ML 4OCYL 3BGMA 4LLQB 1T5WA 1TXKA 4MZ3A 2W65B 3QIUD 1MHPL 4U3CA 5EUOE 2I5YL 2VDKL 4ZSOB 3P40A 4K23H 1ADQL 3BZ4B 5D1XA 4FQCH 4ODXA 2GJ6D 1MVUA 4NFCA 1BZ9A 1TJGH 1BEYH 4OV5B 2R8SL 1YMHB 2I27N 4MQXC 2R0WL 5GJTL 4IJ3C 1OTSD 4KDWA 4ORGA 1GGIL 3ARYA 1CE6A 3LMJL 5LBSH 3ARVA 1JCKA 1NGPL 2ADIB 1J8HA 4TN9A 2YZ1A 1JBJA 1RUAL 4IDLA 3LN4A 1JTTA 2YKLH 4HC1A 4MSWA 1RK1A 1UH3A 1UVQB 4Y1AD 4J6RL 3V6ZA 1U8LB 4NQEB 3DYPA 4YHNB 4XCEA 4M61B 5FM4A 4MJ2A 3JUZA 3LKPA 3T65B 2JB5L 4UBDC 3O6FD 5B3JF 1FIGH 3P3YA 2NMSA 5KOVC 1A3QA 3TO2A 2HT4C 3WS6C 4KROB 1AHWA 3OKOA 2A6KB 3MOAL 2CKBH 4N0FA 2YRLA 3S35H 3GEWB 3TZVD 4KZDL 2X1QA 2EKJA 4IDJH 2NX5E 3ARTA 4RGOL 4LKXA 1BBJB 5CWSB 4YFLF 4DEPB 2O5XH 5L2KD 4YH6A 4XGZB 3EYFA 5I73B 1AE6L 3V52H 1P1ZB 2KL6A 3K74B 4XXCC 4HGWA 5AAMA 2ZWLT 3WIHA 2P8LB 2K7PA 2Y1VA 3V7AG 5JLZA 2H1PL 3O41B 4GRLB 5E8PA 4ZUVB 5EDXA 3B9VA 1I1FA 2AJYL 5SWSE 4HIXH 2B4CC 3MUY1 1BFVL 2VO5A 4NBXB 2F53E 5IKCB 4ZQKB 5D5MA 5IJKA 1X6LA 1WBZA 4NPYB 3AB0C 1N64H 3UZQA 5KG9A 1A6UL 2VDRL 1I7TB 5FO9B 4P2QD 3M8OH 3ULVE 2NQCA 4FZ8L 5FKAA 4UBDD 4RMSA 3P4OA 1OAKH 2HT4D 2C9AA 1PLGH 5GPRA 5DJ2B 2YPVL 1Y6NR 2EYSB 1LNUA 1NFDF 4GW1B 2CDGA 1CXEA 4BQCA 4NQCA 4IOFC 4U1IB 1FO0B 4NNPL 3QNXB 5CBEB 1ZAGA 5C09D 1A6PA 1GC1H 1FZJB 3KR3L 3EJJX 1U8QA 4RAHA 3TYFB 1FFOA 4LLWB 4BQ8A 3TM6A 3MJ8B 3WMSA 3GJEB 1EUUA 2A77L 4O51B 5CLTA 4AIZA 5AZEH 2ORBL 2EDRA 4FXLA 4TSAL 4MDJA 4C4KT 3WD5L 4LLVA 5C0FA 1QHOA 3JXAA 5DVMA 1LP9E 3TGXA 5SX5K 3SDCC 5JHLH 3FKUS 1QBLH 5CSGA 3O4LB 3WNPA 1G0DA 4HX1B 5KSAA 2EIDA 5MEQA 4XAWL 2Z91B 1CTNA 1YYLH 4KTYA 1NFDA 4ODTL 5J6HA 1LDSA 4DKFH 1D5ZA 2Y9RT 5E8NA 1G7LB 1MWAB 4UI2A 2A74B 3F7QA 4BH8B 1G9NH 5EU5B 1H8SA 2IBBA 2Z8WC 5I18H 3KNBB 3P4LA 4L1DA 2B20A 1EIBA 4FXGA 3IDGB 4RMUA 3DGGB 4YEEA 2DQFB 3QUYC 4LLYA 4P23C 4ZFGH 1HEZB 4ZG1A 4UQ3B 4IOFD 4F7MB 1DN0B 3GSXA 2KBGA 3F7RA 2OK0L 1ZS8A 5F6HI 2EZ0C 4NWUL 2DTMH 3W9EA 4D0BB 3G9VA 2D31A 1BZ7A 2VLRA 3QEUA 4F9LC 2AK1H 4O58H 1I1RA 5DMGC 5FM5M 3MV9B 5DUML 1BP3B 3KPRE 3VD3A 1E6JL 2E6JA 3P30H 3C5SA 4L8CA 2XWJA 5JOEA 2YPLB 2R9HC 2E27L 3C9NA 3CGTA 1ZLWH 3L7EA 2BRRL 3QEQE 2NY7H 5IF0B 2QLVB 3SDCD 1CFVL 4YK4C 2XTJE 2FWOB 5JW5B 1IGJB 3QDJA 4JGMA 1FBIH 1A64A 3WCYA 3S34L 1MHEB 4DVBA 3DUSA 5KANG 2BSTB 4WI3A 4WY7H 1TIUA 4PLKC 5GRYA 2DMBA 4KGLA 4XNZC 5JIKA 1OGTA 3MODH 4L8BA 3QQ3B 2PO6A 3O8XA 2WBKA 4L8DA 3BQUC 5JPNB 5CAYB 4WENB 3N9GL 3G04A 4KROC 1SYVA 1OCWL 2F74B 4LP4A 3EHBC 1KLGA 2X4SB 4U1LA 3LN5B 5KVFL 1MNUL 3QUYD 4P23D 5D6DC 1RUMH 4HMCA 2EZ0D 2VXQL 4YPGB 3D9AL 1BJ8A 4DEPC 2QQQA 3A6BL 3CDYA 3FOMB 2JJTA 4NGHL 4IRZL 5DMGD 1Q0XL 1P7QB 4MMZC 3UTSE 3LKQB 1JI1A 1WIUA 1S5HB 2R9HD 4XCCH 3D25B 4KKBC 4Z78B 1A3RL 3DV4B 2X1PA 1VGEH 5T1KD 1CIDA 5CJ5A 2PYED 4XMKL 3ARWA 5I19H 1VADB 2VLLB 2QL1A 4XZUA 3L5JA 2ARJQ 5IGXH 4KFZC 1T5WB 4LKCA 2ZUWA 3I2CH 4DAGL 3BQUD 3SGEI 1UACH 3KLHC 4NYLA 2Q8AH 5D1XB 1D9KC 4ODXB 1MVUB 1BZ9B 3ARBA 4KROD 1JNLH 5CJOL 3EHBD 4BZ1L 3CCHA 4RA0C 3OGOE 5ALCL 1GGBH 1F90L 4ORGB 4KVNH 5ADOL 1CE6B 3G9AB 3K4ZA 4ODBD 3UYRH 3CVHL 4Q2ZA 4PIRF 1J8HB 4F2MA 3LN4B 4MSWB 5B8CA 1FAKT 1MFAH 1RK1B 5HDBF 4DW2L 3MLXL 4QEGA 3V6ZB 3QDGD 4XCEB 5FV2A 4TRPH 1IC5H 3LKPB 1ZLSH 3IU4L 5C0JA 4KKBD 4JPWL 1PSKL 5LXGL 1CQYA 2A6JA 3TO2B 4X6FA 4HZLA 3QP3A 3G6JE 3SCMA 4GMSL 1AHWB 3OKOB 3KJ4B 4N0FB 3F58L 3WKMH 2W0PA 5KS9F 3NOIA 1F6FB 2HTKC 2J6EL 1PVHA 4LCYA 4LLMA 5I8KL 2R1YA 2DD8L 2JE8A 5HD8C 3QDME 1FG9C 3CFJA 4LKXB 1OP3H 3KLHD 1D9KD 1E4JA 1TQBC 5B4MC 4BUGA 3RIFK 3SE3A 1INDH 2APTA 3EYFB 3WUWA 4M6OH 3V9FA 3QEGH 4M3JA 1HKLH 4HGWB 5DI8A 4DOHB 4GS7C 2IH1A 4W70A 3X11A 5JLZB 3UBXI 5E8PB 5IR1A 5L0QB 5E6IC 1I1FB 3EO9L 2E9BA 5C6TH 2I26N 4OQTA 1D6EA 4HF5H 5D5MB 1WBZB 1YEHL 2J5LB 2GJJA 5KG9B 5KS9A 4OM0H 1P69B 4DTGL 1WAAF 5FO8A 4GBXA 4MD0A 1AGFA 4LIQE 4OFPA 1T80A 2M2DA 1YMME 3P4OB 4TUKH 1E28A 3O4LD 4UV7H 3SOBL 1WBYA 1YDPA 4GAJH 3WUWG 5IHBA 1OT1A 1LNUB 5DEFA 2CDGB 1RUKH 4MAYA 5H37G 4PJ5D 2HTKD 2HKFH 2HVJA 4NQCB 4Y4KA 5FUZH 4BK4A 4LSQL 5HD8D 4KI5E 2MPAL 4RCAA 4UTBL 2DKUA 2X4NA 3PP4L 1U8QB 4CAGA 4NKDA 1FFOB 3AAZA 1GH7A 5B4MD 4JKLA 3T0EA 3QFJA 1HHHA 2FEEI 4I0PC 5F6IB 4AIZB 1IAIM 3LSOA 4ZUUA 1JL8A 1WAAA 4MDJB 4LLVB 1S9WA 1VB9A 2UY6A 5C0FB 2AS5M 4L4JA 2ADGA 5E6ID 1UXWA 1A9BA 1NGQH 1FE8H 3U0WL 3BKML 5KSAB 3ESUF 5MEQB 3GI8H 1A7PL 5JXAL 1NFDB 3ORJA 1D5ZB 5E8NB 3IKKA 3T0VA 3EOTH 3SN6N 2YPLD 5H8DA 4DUVA 4XPHL 3CU7A 2DQEL 1RURH 5IBTL 1NBQA 4GQ9H 1RIUL 5IFJA 3KJ6L 4FXGB 1IGYA 4PRIE 5SX5H 4H5SA 4L4VA 1TVDA 1KXQE 1FNSL 1MCPH 4ODVL 4KVCL 3MA7A 2G75A 4LLYB 4LEXH 5FDYA 5C3TA 1F00I 3GSXB 4MVBC 2Q1EA 3BMWA 4K8RC 5FYLD 3W9EB 2EDDA 1OTUC 3EYUH 1I9JH 2D31B 1BZ7B 2VLRB 4NQVA 3S88H 1JK8A 1I7ZA 1S7TA 3QEUB 1RHHA 5GGTL 4TPRH 1KBGL 3QCUL 2W9EL 2FD6H 5HI5C 3C5SB 4L8CB 2XWJB 4K55A 2XOTA 3C9NB 1YEFL 3KPSE 3L7EB 4HIJA 3GSRA 5E8DL 3GSNL 4Q9BA 3WDJA 1JTPA 3OX8A 1ZANH 3CX5J 3QDJB 4PFEA 5CINH 3VRLF 5E2TH 5DTFA 3HUJE 3HNTH 2IQ9L 2DDQL 2FH6A 1E4KA 2F58L 4DVBB 3DUSB 5DJYA 1NFKA 1TZGL 2ZUSA 4EOWH 2IANE 4X83A 5LG1A 1OB1A 5DF0A 2UZIL 1OGTB 1X4YA 4L8BB 1FVDA 2AV1A 4MNGE 2PO6B 5CP3A 3O8XB 4L8DB 4J12A 1F4AA 1E6OL 3Q5TA 1S7SA 5EZOL 2W59A 4ZNEE 3DECA 1TFHA 3G04B 4OUOA 4BH7A 1SYVB 2G2RA 3T0AA 1KLGB 3IRPX 1ED3A 4U1LB 2DMKA 2BNUA 4OCWL 5KSVA 1A2YA 2IMMA 4X99A 4XWOC 4MVBD 3P0VL 2WQ8A 5IVOA 4G3YL 3NCBB 4K8RD 4Y2OA 1OTUD 3QHFL 4AL8H 1CF8H 1L7IH 2EECA 4IMLA 1FAIL 1UZ6E 2Q8BL 4P2OA 1WZKA 2Y07L 1EEZA 4Y4HC 5EZIH 4U31A 1J12A 1PG7W 2X40A 3BOVA 3S7GA 5HI5D 2X42A 3RNQA 2CH8A 2NTSP 3MMEA 3QQNA 1KCSH 4MD4B 3QO1A 3U7YH 4L8SC 1F6AA 3V6BR 1U8MA 4CU6A 4HWZA 1MOEA 4O5LL 2E7MA 4LMQE 3OZ9L 5EPMA 1OM3L 1AJ7L 2X09A 1NAKL 5ANME 3IRZA 4MA8L 4MXVE 3MYZA 2V7HA 1PKOA 4I5BA 4N1EA 4XZUB 4PBVC 1U3HC 1CG9A 4U1MA 2IPTL 1F8TL 4LKCB 5T5FH 1ADQA 3AU1A 35C8L 4L4TE 5CS7A 1QQDA 4NYLB 5GXBB 4KTDH 4LVHB 4ELKA 1MPAL 3ARBB 4QRUA 3CFBA 1TVHA 4TOYH 4W6YB 5GISL 3EFFA 1Y0LA 2ZUTA 3VFGH 3CCHB 4JFDA 1NLBH 3QIWA 4LPUA 4KRPC 4XWOD 3ROOA 4Q2ZB 3ZT5A 1NH6A 5EO9A 4PJGF 1I8IA 5F93C 5CGMA 3LEYL 3N1PC 4JVWA 2RIKA 1LO2H 3EYVA 2E8YA 4XX1E 5HYSA 3ZYZA 4F2MB 5F71A 2VLKD 5B8CB 1J0YA 3WIIH 4Y4HD 3MOQA 5F6IC 3QAZB 2JK5A 4G7VL 4G7YL 3H9SA 2YUXA 1V7MH 1DSFL 3X3GL 2H3NA 5C0JB 3FAWA 1W0VA 1TJHH 2HG5A 5I75C 2A6JB 4X6FB 3VFUA 4HZLB 3SCMB 4YGVA 4FQXC 3JV0A 5F7UA 3OR6A 1P7HL 3JWDL 3O3DA 5HHMD 4LCYB 1U3HD 4LLMB 3BZEA 1AXTL 2R1YB 3HNVH 3KPQA 4XNXL 3CFJB 3QDAA 2AABL 3R0MA 3B2VL 5E08H 2EDNA 3WUWB 4M7LT 3CXDL 5DURB 2V17H 4KRPD 5DI8B 2IH1B 5HI3C 3WO4B 3ZZ1A 3X11B 5HBBA 2FJHA 2ZUXA 5IR1B 1G7PA 2FIRT 3CVIH 2VABA 3H3PL 4LSPL 5KW9L 2WSKA 1JIBA 5K9QG 2AXGA 1D6EB 3VGEA 4U0QB 5KS9B 1JHLL 5ETUA 1QSZA 4DWHA 4HWUA 5FO8B 4GBXB 5FGRA 5K93A 4MD0B 4CRPA 1AGFB 4UU9A 3EUUA 4HS3A 1KB9K 2DBLH 4MD5A 5DQDH 2CR6A 3CXHJ 1FYTE 1E28B 4JDZA 4G43A 1WBYB 1YDPB 5BS0A 2MOVA 4FQXD 3L7FA 2I25N 3X12A 5DEFB 4PD4J 4MAYB 2NY2C 1UGNA 1IGIH 2HVJB 4Y4KB 3WHXA 3HNSL 3HC3L 4FMKA 3CUPA 3BIAX 4JB9L 2X4NB 1FO0H 4NKDB 4PGZA 3AAZB 3DPBA 3T0EB 3QFJB 1HHHB 4M5YH 2EO9A 4U1SA 4YDLC 1GCFA 2VTFA 1PW3A 3RWDA 3LSOB 4ZUUB 3G6DH 3SDXE 1EGJL 1KG0A 3TESA 5HI3D 2DJSA 4OLEA 4O9HL 1QPXA 1S9WB 5F7EH 2DQJH 2ADGB 1UXWB 1A9BB 4GKSA 5BV7B 3GJFA 1CDHA 5DRWA 1IC4L 4NC1C 2FSEA 4WWKA 2VLRD 3WFDH 1L0QA 2DQCH 1CN4A 2JJTC 3VGGA 2BNQA 2VDLL 1SBSH 2V5MA 1KN4H 1KUMA 3MLYH 3WNMA 2VIRA 5EOCH 3MOBL 1PKQA 3EOBA 4FTVA 1MWAH 2DI8A 4KHXL 2PUQT 3OKNA 4M43L 3K1DA 3QSKB 3CFCH 4Z7UF 5IFJB 3QDJD 4JHWH 4UZGA 1IGYB 4XCNA 4AMKH 4H5SB 4L4VB 3NZ8A 4LCWE 2EH7H 3MA7B 2NY2D 2G75B 1AQKL 3VA6A 4CVZA 4X4XA 1KIUA 2RJMA 3PHSA 1VFMA 4JRWA 3ZHLA 4JO2L 5IMLA 2F5AL 4IOIA 2A0LC 4LVHC 4NQVB 1WFUA 1JK8B 1I7ZB 1S7TB 5AG9A 1RHHB 5GZNC 4O00A 3DMMA 15C8L 4PRBA 4LSRL 5HI4C 3VXMD 3WYRA 4Z95H 4PJHA 4HIJB 2BXYA 3GSRB 3QHTC 3MV7E 1Y6KR 4FXKA 4Z7UA 3V4UH 3OX8B 4HXAH 3RIAK 1UQSA 5IP4A 5DTFB 1U41A 1LO5A 4XTRC 5KTEH 5ESQA 5MP6L 2NXZB 2AJZA 4M62H 1MI5A 5DJYB 4X5LA 2YRPA 1OB1B 4Y5YA 1A21A 4G6ML 2BMKA 5E94A 1L7TL 1FVDB 2AV1B 3BUYA 2CJUH 1C5CL 2Z31A 2F5BL 5HHVL 1MEXL 5FYLH 1S7SB 4P3CH 1MHCA 1QYGH 4BH7B 2G2RB 5BJTA 3S98A 4LPCA 5AD0A 4LGPB 1ED3B 4JGJA 4JFPA 4WI6A 2BNUB 3EDFA 2W0LA 5CEXA 2UZXB 5KSVB 1A2YB 4X99B 5JDJA 5D7IE 1T1WA 5D7SL 4NO0D 4HCRH 1OSZA 1IFHH 1DQLL 4JRYA 5F1IA 1RJYA 2QSVA 2BHUA 3MUJA 4IMLB 2A0LD 1JJUA 4P2OB 1FL3A 4NZTH 5GZND 1INQA 3SE3C 4PG9A 1EEZB 1T5XA 4E5XA 3WIFA 4UIKL 5HI4D 3TNMA 3VW3H 4ELME 2BP3A 3ULVL 3RNQB 1R5VA 3MMEB 4A6YH 3QO1B 4Y89A 4YUEH 2XWBA 4D9RD 1AKJD 1F6AB 3T3PE 1U8MB 4LGRB 1J1XH 3QJFA 4HWZB 5F96L 3VXUD 5F9WB 4AEIL 5EPMB 3KPTA 1F3DH 2DM4A 4XTRD 1IAKA 5CSZA 3FFCE 1S7WA 3UTQA 4I0CC 1WIOA 1DANT 5D71H 2V7HB 4KY1L 5DC0A 4I5BB 2VERN 2ZNXA 1NDMA 1R5WA 5J1TC 1CG9B 4U1MB 5FYJD 1N5YL 1QSVA 1OY3B 5FOBA 3L95A 1KTDA 2V9TA 1HQRA 3AU1B 1BQLH 4G6FD 4AIOA 1QQDB 3STBA 2DM7A 6CGTA 4ELKB 4WFFD 5MENA 5DLMH 2FHFA 4QRUB 3CFBB 4G5ZH 1TVHB 1WBXB 2X4TA 1OAYL 3EFFB 4EUPA 2AK4A 1Y0LB 5BXFA 3JWOL 3PXJA 1EJOL 4OLUL 3QUZC 4O02H 1G9ML 4JFDB 4UOJA 3QIWB 4MAYC 3PABA 1CR9H 5DQ9A 3CVHA 5DC4B 1J0IA 2ZPKL 3O9WA 3ROOB 3AY4A 3D39A 5EO9B 1I8IB 3WNNA 1OHQA 1AI1L 3IJYA 3EYVB 4L9LA 3UMTA 4JQXA 2WANA 4R4NC 5HYSB 3HMXL 3CMOH 3T0EC 5I1HH 5IW6A 5DURD 1T3FA 3MV8E 2JK5B 3WXWH 4KAQH 5GRJH 3MRKA 4LLUA 3LS5H 3H9SB 5IUSA 1P7KB 2DQUL 2YR3A 2H3NB 3JV4A 1W0VB 2FX9L 2YWZA 4KQ3L 2HG5B 1QRNA 2CLZA 5BV7C 3GIVA 3VFUB 5GS1C 1WLHA 3OB0H 4JFZL 3IFLL 4YXHL 1D5BA 5D2NE 4POYA 2HJFA 4MYWB 4R2GC 3VFMA 2FEEL 4YGVB 3EO0A 3K1KC 1HNGA 4EUPG 2J6EA 5F6HJ 4KXZI 1GPOH 1RIHH 3OR6B 4R26L 1NGYA 5D7KD 3WJLA 3V79C 3O3DB 1PY9A 2D4DA 3BZEB 4GBXD 3TA3A 3RWIA 3KPQB 4RFOH 5C08E 3TV3L 1A02N 5FYJU 4NQUA 3UJTH 1IAIL 3MFGB 3SO3C 3VXRA 2CO6B 1NCAH 1JNNL 2FDBP 4XB7A 1N0LA 3QUZD 3LRHA 2CD0A 4MAYD 4NKIL 3DHMA 2ITCA 4DZ8A 2FJHB 1HZHH 3O6LL 1G7PB 2VSCA 3WIHH 4FQ2H 4HLZH 3VXNA 3UZEA 3C5ZA 2VABB 4HT1L 4JFXA 3LIZL 5C0RH 2AXGB 3QPQC 1VACA 2QQLH 4HWBH 2FH8A 1QA9A 3T0ED 1A7NL 5DO2C 2YWYA 1UZ8A 5ETUB 5D93B 5DMKA 1M7XA 3R0NA 3RY5A 3VDBA 1IQDA 4TVPH 1HCFX 1JUFA 4UU9B 1AFVH 1JGVH 4HS3B 4MD5B 5TDOA 3BKJH 1ZT1A 4Z7VE 1JGDA 1FHGA 4JDZB 4G43B 4PJEF 3CNKA 4LRNH 5BS0B 5CMAA 1JHTA 4Z7WF 5EOQH 3L7FB 4MX7A 3X12B 4MA7L 3F8UB 3ULSA 1ROWA 4NQEE 1C7SA 4YDIH 2OTUA 3WHXB 3R8QA 3CUPB 3Q6GH 1H5BB 4LARL 4ODHH 4PJIE 1MF2L 1SVCP 1KEGL 3WFZA 2HH0H 2JIXD 4ISVA 1FJ1A 3I50L 4NJAH 3S36L 5FM8A 3OR7A 5CFHA 4U1SB 4XPBL 2XZCL 3RWDB 3ARXA 3BW9A 5HPOA 4AY0A 3W2DL 1KG0B 1S9KC 1CT8A 3HG1D 1IGML 3NN8A 5FGBA 3BISA 2QHRH 3VFWA 3QRGL 4GJTB 3T2NL 3VXOA 4FFVC 4GKSB 3GJFB 5DRWB 5CHNA 3FHAA 2FSEB 4RFNB 4WWKB 1KJ3H 1QBMH 3QPQD 4Z7NF 4GXUM 4PBXA 2BNQB 3HI6L 4L5FH 5DO2D 2OR8A 2X7LA 4WFHE 5FAAA 2VIRB 3SQBA 1PKQB 3EOBB 4FTVB 4ZS7L 4XPFL 3OKNB 4HUMB 3BT2H 4JM4H 4Q74A 4XCNB 2XNAA 3P11H 4KPHL 3NZ8B 1OW0A 3TIDA 3QUML 4ZOAA 1I8MA 1R6VA 1R3JA 4HV8A 5T1DL 4CVZB 1JMZA 4HBQA 2PR4L 2YN3A 4X4XB 5HYIA 5DD3L 4H1LA 4MXWH 4XVTL 4CDGC 1FLRH 4QRSA 5C07D 3SJVE 5IMLB 1KELL 5GGTA 4IOIB 3ZSSA 3DMMB 5C9KA 3NACH 4PRBB 5TPWL 1CGYA 1FSKB 1WSST 3FQWA 2XI9A 4JCMA 2LV4A 4PJHB 1ZKAA 3GSNA 2OP4L 5T3ZD 3LQAC 3V4VL 1QO3A 3IDXH 4XWGH 3C09C 2CMRL 2R2BA 4FXKB 4Z7UB 1UM5H 1UQSB 2EC9U 2Z4QA 4I77H 1T0NA 4A2LA 1LO5B 1QRKA 4G6KL 1YEKH 5ESQB 2R4RH 2AJZB 1MI5B 4EBQH 1KENL 5I76A 5HYJA 4UILH 3TVMA 4Y5YB 2XV6B 3FONA 1J8KA 5D1ZC 5IIEA 2BMKB 4H1LG 5E94B 1Z9MA 1YECH 5JW4N 3BUYB 2Z31B 1V8HA 1UADC 4M5ZL 2FIKA 4UB0H 4EI6A 3UPRA 1NLDH 4HGMA 4WGVB 2G9HA 3FO0L 1MHCB 3MYJA 5DK3A 4ZXBA 5BJTB 1T21A 4LCCC 4RDQF 4AM0A 5AD0B 2ADJA 5DXWA 1QUNA 2P1YA 4JFPB 4CMHB 2EDTA 5CEXB 5HJ3A 2F9BT 1T1WB 3DSFH 1K6QH 1OSZB 1MJUH 4JRYB 1RJYB 4WUKH 1A7RL 4JAMA 4ODWA 1FL3B 1INQB 4PG9B 4ACPA 1HCVA 1U3YA 1T5XB 2WNGA 3WIFB 4E5XB 1BAFL 4ERSH 4Q9QL 3TNMB 4WV1C 4LIQL 1CCZA 5CIPA 1R5VB 3NA9L 5E99L 2XWBB 5H2BA 4D0CA 2LQRA 3ARUA 3QJFB 2VZSA 3SKJL 3LHPH 4LSSH 5FYKE 1IAKB 3UTPD 2YN5A 2QHLA 3L1OH 1S7WB 3UTQB 4IHOA 1KCUH 2ILLA 2ZUQB 5E9DD 1C1EL 3RP1A 1NDMB 3T77A 1R5WB 5E24E 4M6MH 12E8H 5D1ZD 5F89A 4D9QD 5FOBB 3ZE2F 3L95B 2F19H 1HQRB 3PWNA 1YQVH 4MB3A 4NQSA 5MENB 2F8VA 4JRXE 2X4TB 1E4WL 4TUJA 2AGJH 4EUPB 2AK4B 5BXFB 5IVXF 1A3LH 2WW8A 4F7PA 5IHLB 3T3MF 3PABB 5DQ9B 3CVHB 1M6OA 1L6XA 43CAA 4YBLB 3ZKXB 4HUWA 4GAGH 3O9WB 4JZJA 4PJAF 4JFFA 4PJ9A 3D39B 1WWCA 3IJYB 3NIFE 4L9LB 3KYAA 1RVFH 3HRPA 5IW6B 4PB0L 4BK5A 1T3FB 4XNYH 4NM4L 1IJ9A 5ISZE 4FS0A 3MRKB 4LLUB 1QR4A 1MCKA 2ZOKA 3ZMRA 3JV4B 5JIHA 3QNYA 1RZJH 5FYJH 1QRNB 2CLZB 3BJLA 3GIVB 5J3HC 1D5BB 4TSBL 4WWKC 2HJFB 2VH5L 3VFMB 5C2BL 3F62A 5IVXA 3EO0B 3H8NA 1E27A 3S6CA 3S8WA 1NGYB 1OSPH 3QXDA 1ACYL 3F12A 4PJAA 1UCBL 3TA3B 3RWIB 3QCVH 1KXVC 4ODSH 1TTUA 2DWDA 2MJWA 3VXRB 3RUGF 1P84J 2WWMC 1RZ7H 4MJ6A 3MRGA 1H3GA 5CEZD 1AGDA 2ITCB 4DZ8B 4JY6A 5H37H 1MREH 4POZC 1CFQA 1MAMH 4MNHA 1JPSL 3VXNB 3A67H 3C5ZB 2Q7YA 1CLYH 4JFXB 3ISWA 1VACB 4LCIL 1QA9B 3QBTB 3U30B 1KLUB 2AP2A 3DMMC 5JHDE 1CGXA 1BVKA 4OQTH 1CGSL 4WDIA 1UZ8B 4HBCH 5HHOA 4F33A 1PGRB 5DMKB 4OIIH 1FQ9C 1IQDB 2HLAA 3PL6C 1JUFB 1RU9H 3L3KA 5TDOB 3DURA 2BSRA 1OAZH 1J8HE 1G6VK 1ZT1B 1FCCA 1JGDB 4WIQA 4PBWD 5J3HD 3FO9A 2NZ9C 4HFWA 4WWKD 3RUGA 4HS8H 5CMAB 1JHTB 3RZCC 4RWYH 1MFNA 4MX7B 4UT6H 2BNQD 2JELL 3GBNH 5EUOF 3ULSB 4QRRA 2OTUB 3UX9B 4KUZL 5IOPA 2FGWL 1G7MA 1S7UA 3FAXA 3GJFK 3OTTA 5GRVL 1EEUA 4NOBA 4DUWA 4ISVB 1FJ1B 1MJ8H 1RAMA 4WO4A 3TJEH 1TENA 3OR7B 2WWMD 1EGJA 4M6AA 1RUPH 3BW9B 1G7QA 5GGUA 1X9QA 3L9RA 1CT8B 4X7CC 2RCSH 1CBVL 3NN8B 3OHXA 3MRNA 3VFSA 1NDGB 3VFWB 4POZD 5KOMC 3VXOB 3O2VL 3E8UL 3SDDA 5CHNB 2J88H 3GIZL 5BV7H 4N8VG 4TQEL 3DMMD 4O2FA 5EUOA 5EG6C 2GEEA 2X7LB 1J10A 3CH1A 3ARDA 5TJWK 3ZTJG 1Z3GL 3PL6D 1BJMA 3O2DL 2QV2A 2B5IB 3RWHA 4EXKA 4Y19D 4WCYL 2BJMH 4JJHA 1LK3L 2CRZA 3MXWL 2NZ9D 1J5OH 5KSUA 3ZLQC 4K3JH 2XNAB 5CP7A 3RVVC 2CK2A 5I30L 1VPOL 5FM5O 3TIDB 1I8MB 1R3JB 4HV8B 2ZUQC 3ARZA 4MHHI 4FN0A 1LO3H 4B7LA 4H1LB 5TQ2H 4D3CH 4QRSB 3UPCA 4KJYA 4NUGH 4NBZB 5LKNA 2EXYC 4M03A 4BFEA 4KKAC 4X7TA 3FQWB 2W07A 1G7IA 5JW4Q 4NQCE 4AH2A 3GSNB 4M7KL 3TYGH 5CJ8A 1RULH 4M8QA 5LWYH 3QCTL 1FH5H 4IMKA 5CCKL 3R1GH 1QO3B 2ZSWA 3O9WC 5IQ7H 5FGCE 2R2BB 1X5FA 2VWEE 4W6WB 2Z4QB 5D72L 1T0NB 2C7UA 1UWEH 3MBXL 4HUNB 3O6KL 4S1RH 3ULVF 5D7LD 4N90D 3H42H 3O3AA 3FMGH 5I76B 5HYJB 1T2JA 3TVMB 5EA0L 3FONB 3AXLA 3RI5F 5IIEB 4WFEE 4GG8A 2B8OT 3JSSA 3WSQH 3TPKA 5HYEA 3CX5K 1JZ6A 4YHLH 4EI6B 2FIKB 4R3SA 3UPRB 3TT3L 3BSZH 4LFHG 5TE7H 5CP3H 2G9HB 1TJIH 3MYJB 4NHCL 1RMFH 4ZXBB 3AM8C 1EO8L 1T21B 3QWRA 3RVVD 3WBDA 3QHZL 3MXVH 4F15C 2R29H 2ADJB 1ZLUH 5SWSA 4BSVA 3TT1L 5HJ3B 3BE1H 2Q87A 3I84A 3TA3C 3CSBA 4G6AC 5T3ZH 1GIGH 2B2XL 3TBVA 1FVEA 4R8WH 1BBDL 4ZD3L 4XMPH 3E2HB 4JAMB 4PTUA 4KMTH 4I2XE 5MEND 4ODWB 3MJ9H 4EQ3A 5ADPH 2EXYD 4KKAD 4LPVA 4NUJA 4OFYD 2IF7A 3QFDA 5CIPB 5E5UB 4QRPA 3IDNA 5H2BB 5ESVA 4D0CB 3O9WD 4XPGL 5GRZA 1K3ZA 3OAUL 4LOUC 2APXA 2QQKH 3IKCA 1JE6A 3LRGA 4IHOB 4GSDH 1U8JA 5GGQH 5GRUL 4NO3A 3UBXA 4MA3A 1B90A 3T77B 1XF5A 2A9MH 2P5EA 4OCYH 5F89B 4M7JH 1MHPH 3MRHA 2I5YH 1CDGA 2VDKH 2HT2D 3PWNB 4NQSB 1QRND 1O7VA 5E70A 1ADQH 4GLRI 1JHKL 2I24N 4IBLT 5AAWA 2NY1B 4YXKL 4TUJB 2YD9A 3HI1A 2R8SH 1LP9A 3DTXA 3UP1A 2DLIA 3X3FL 2R0WH 5GJTH 4F7PB 2AJUL 3PWPE 3RX8A 3D69A 1LWRA 2PETA 4U1GC 1YZZA 1M6OB 1GGIH 43CAB 2E9IA 2NY6B 4X9HA 3RX7A 4HUWB 3TA3D 3LMJH 2OCFD 3BP4A 4G6AD 3MLRL 4JFFB 4JZJB 4PJ9B 1K2DA 1NGPH 2IEPA 3HMXA 2RB8A 5DR5L 2A1WL 3U79A 4XXDA 3CLFL 3THML 2F54E 5IESH 4J6RH 3SKOA 3UBXG 2N7AA 2DKMA 2X9WA 1J11A 2ZOKB 3QNYB 4WTXA 3OBAA 1NANH 1ORSA 4LOUD 2VXUL 3TJHC 3MRDA 1UEMA 2EYRA 3MOAH 5I9QB 5IVXB 1E27B 4WHYH 2EDWA 3QXDB 3P2TA 3U36A 2WMPA 5LVEA 3PQYD 1TQCC 3SE9L 4KZDH 3F12B 4QXUH 4PJAB 5IM7A 5IVNA 4U49A 2VXVL 1HIML 4RGOH 5SX4H 3UTZA 3KPRA 3NCJL 1MRCL 2DWDB 4LPTA 4YX2L 1AE6H 3QEQA 4MJ6B 3MRGB 3U1SL 1AGDB 1MCEA 5FHBH 2Z92A 4JY6B 4P59L 2YD6A 2IPKA 1CFQB 4MNHB 3VWKA 2AJYH 3FT4A 4FNLL 2Q7YB 5JQ6L 2YD5A 3ECBA 2HJKA 2VE6A 2HRPH 5I1CL 1BVKB 2IH3A 4WDIB 3QR2A 4X0KA 2GTZA 1A6UH 4F33B 5DDHA 5HHOB 2VDRH 4N5EC 2YPKA 2HLAB 3MJGX 2FO1A 3L3KB 3DURB 4K71B 2BSRB 4FZ8H 5IHZB 3FRPG 2R0KL 5DFTA 1EBPA 3DETC 3KXFE 4OLWL 3TJHD 3FO9B 4R0LA 4Q9CA 4HFWB 3RUGB 4Z76A 3ARPA 1XCQA 4I1NB 1UWXH 4LRIA 2YPVH 4ZOEA 4R9HA 5DJCA 4QRRB 1U36A 1DBAH 1QFUL 3TWCL 5CEZH 5IOPB 1AD9A 1G7MB 1S7UB 3REWA 4NNPH 5HVHC 3KR3H 3UTSA 3FZUC 1CDCA 3C2AL 2OYPA 4NN6C 1CI5A 4V1DE 2A77H 4PD4K 5D96C 5DA0B 3OPZL 5L88L 2ORBH 1G7QB 4TSAH 5GGUB 2NXYC 1CLOL 3L9RB 4JZNA 4MB4A 1T6WA 3OHXB 1QPPA 1TZHA 3MRNB 5J0BA 3VFSB 4JQVC 3SDDB 3VXQA 2DOCA 3W5NA 3ILQC 4YE4L 3E2HC 4XAWH 3GJFH 4XAKD 4AZ8A 4Z7QE 4N68A 1EJ6A 4O2FB 1FZKA 2ADFL 3T1FA 3V6OE 3CH1B 3ARDB 3U4AA 2FB4H 5C1MB 4HAFA 5CLWA 4PRNA 1UJTA 4N5ED 1UM4L 3G6JF 4WJ5A 3RWHB 5C0BD 4F37K 5IB4A 4EN3A 1TDQA 4QO1A 3MCG1 4P5TA 1OVZA 5KSUB 3QUMA 3QA3A 5CP7B 3UJIL 2M26A 4TUOA 3CFIC 2XIDA 1SM3L 4O4YL 4PLOB 1EO7A 4NP4L 2OK0H 2XT1B 2CUHA 3EOAA 3TC9A 1MCLA 4NWUH 1F4YL 4H8WL 4Q9RL 3OB8A 2DQHH 2MQ0A 3FZUD 2ERJB 4KJYB 3TBTA 3WE6A 3C08L 1UB5A 3WFHA 5K59E 1K85A 2D03L 1INEL 4X7TB 1QLRA 4MNQE 1BREA 1XH3A 4JHZA 1G7IB 2O93L 3QULA 4AH2B 4XPAH 3G6JA 1IVLA 3EYOA 4OGXH 3V2AR 4P2YA 5CGTA 2HWZL 2E27H 4PREA 4M8QB 4U7MA 1KYOK 2BRRH 4EXPX 4X4ZA 1I1AC 2ZSWB 1HHGA 4JZJC 1CFVH 1HE7A 4ENEC 3LS4L 4M1GL 3DXAD 3ILQD 2C7UB 3TBYA 1A5FL 1BJ1H 3ZDXE 3QDMA 3S34H 5I8OL 3ULUE 1OGAE 3O3AB 3SKUD 5ILTL 1EBAA 3AXLB 5C0AD 2V6HA 4P57A 4GG8B 1J86A 2EIEA 4R3SB 3N9GH 1J1OL 4U3XA 4G8GD 4OF5A 3JWDC 4KI5F 2KKQA 5SWSB 4KRLB 4BSVB 4L3EA 1MNUH 2OMBA 3NFNA 5GIRA 5T33H 2PXYC 1KLFA 2VXQH 2IGFH 3TBVB 1FVEB 2FBJL 3C6LA 3QWQB 2PNDA 1RZFH 1LVEA 4PTUB 3A6BH 2IFFH 5HXMA 3VGAC 5C92A 1Q0XH 4XVUC 1YMMA 4NUJB 3QFDB 5IROC 1DBBL 2VDPL 3NGBC 4RISH 4QRPB 1I9RL 2ICES 1W72L 3IDNB 4HSQA 2AQ1A 2NY6D 1SHMA 1P6FA 1I1AD 5ESVB 5DJ8A 4ENED 5IFAL 1A3RH 4JFFD 5TQ0L 4OZGE 1W2KT 4K7PY 3WFBL 3IKCB 2P44B 3MNVA 1U8JB 4NO3B 3UBXB 5C70A 4MA3B 1XF5B 4K3GA 2P5EB 4YWGH 4GMTH 2EDQA 4K71C 3MRHB 4DAGH 2CGRH 4AENA 3HLAA 2EDYA 1HWHB 3HI1B 1LP9B 3DTXB 1YA5A 3HKFA 3Q6FA 5CJOH 2ESVD 5IBUG 4BZ1H 4C57C 1EXUA 3D69B 5ALCH 2GK2A 2J7LA 4YLQT 2RFXA 1F90H 5JOFA 1CD1A 1XIWC 4FHBD 3RVUD 3BP4B 2BFVL 3CVHH 1K2DB 3OSKA 1MRFL 5FA4A 4CU8A 2WUBL 1N6QL 1KJ2H 4WO4C 4XXDB 5GGVH 4DW2H 1YN6A 3MLXH 4XVUD 1TLKA 3SKOB 4J3OC 1A4KA 3ARFA 4J23A 5EUKA 1U8KA 1YEDA 3HUJF 3IU4H 1G1YA 5C2UB 4JPWH 5LXGH 2DQDL 3VI3E 1MLBA 1ORSB 3CFEA 3QJHA 3MRDB 3QT2A 4GMSH 2EYRB 2DF3A 2J12B 3MGOA 3BO8A 3MTRA 5DD1L 1NSNH 2NY5C 3BKYL 3F58H 2H32A 4HHAA 4AT6A 2WWKT 3U36B 5KZCB 2J6EH 3IFPA 3WJJC 5DUPL 5F9OL 4G8EA 5IM7B 4KQ4H 2WM0A 4XVSH 1HI6B 4X8XA 1U6AH 3ALWA 3UTZB 3KPRB 2ITDA 1BFOA 3KPSA 4OGYL 4P2QE 4HMDA 4PRDA 1HNFA 2XTJB 1BWMA 4EIZC 1TPXB 1AO7A 1WFNA 2Z92B 1XIWD 1UZ6F 1Q72L 1UJ3C 2IPKB 3CDCA 3EO9H 3VWKB 3FT4B 5BRZA 2W92A 3LQZA 2IANA 3ECBB 3SKMB 4WO4D 2HJKB 4KKNA 2VE6B 1YEHH 2KZWA 4NSKA 4MNGA 5C09E 2IH3B 4X0KB 2GTZB 5A2JH 5J06A 5DDHB 4N9OB 4DTGH 3TCXA 2YPKB 2WV3A 4ZNEA 4J8RA 1Q94A 4P4RA 3V4PL 2N56A 1CFSA 4MXVF 1B0GA 2IG2L 4XP5L 5GGSA 1DL7L 4R0LB 5F8RC 4Z76B 3SOBH 1XCQB 3UJJH 1QOKA 3Q5YA 5H94A 4OF3A 4QRQA 2MCPL 5DJCB 4ZPTA 4OV6F 3ARDD 1UG9A 4JFEE 1AD9B 3IXTA 3TH4T 1CS6A 4TYUA 3REWB 2MPAH 3GUTA 3UTSB 3PP4H 3O0RL 1DBJL 1KEMH 5B22A 2VDNH 3DYMA 3WEXA 2C1PA 2AJXL 3BGAA 5HDOA 4OCRL 4JZNB 1SY6L 3DLQR 1TZHB 5LCVL 3U2SA 5FYKL 2W9DH 4N8PA 3VXQB 3C6SA 4I18C 3U0WH 3J8F7 1LO0L 1IGCL 4BQ6A 1A7PH 5JXAH 3QG7H 3ULVC 1FZKB 3T1FB 4YDKL 4L4TA 3O2DA 1JPTL 4PRNB 5E7BA 3WN5C 3LPFA 1AIFA 4WJ5B 2J3SA 5IB4B 4XPHH 4K9EC 2O5ZH 2DQEH 4EN3B 5IBTH 1GRWA 3UZVB 4P5TB 3KJ6H 3QUMB 3BH9A 3QA3B 3VXTA 4TUOB 2NX5D 1FNSH 5D7JC 4KVCH 4M1CC 5D70L 5DGQA 3KYNA 5JUEL 4PY8I 1IQWL 2FATL 3EOAB 5EU3A 3TO4C 1H3WM 1R3KA 4WHDA 3TBTB 3WE6B 1IL1A 2D7MA 1UB5B 4NNYA 3WFHB 5GGTH 1F2XK 1OAXL 4K94L 1KBGH 3QCUH 1QLRB 2W9EH 3FN9A 5I17A 1XH3B 2VZOA 4PG2A 5SWSD 3OL2A 3QULB 3G6JB 3EYOB 1OP5K 2F53D 4PREB 1YEFH 5E8DH 1HHGB 2YHGA 3K80A 2Y25A 2GTWA 4AQ1B 3BDYL 1XF2A 3TBYB 4Y2DC 3SDAC 1GYAA 3FJTA 3TPUA 2DDQH 5LGHL 3QDMB 3ULVD 1TMCB 1MCFA 3ZHDA 1TTGA 2EXWC 3V5DA 3O2WL 4ZUSA 1T66C 3OF6A 2E7LC 2AXFA 4P57B 2G60L 3DX8A 1UWGH 3VDCA 4EQ2A 2NY4C 1E6OH 2IPUG 4GRMA 3I75A 4RMQA 3LDBB 5KVEL 5IEHA 1M05A 5D7JD 2B39A 1NGWB 2HFGH 1RZ8A 4L3EB 4M1CD 4OCWH 3UTTD 4N0YL 3R4DA 3ZTNH 5GIRB 3P0VH 4G3YH 3QHFH 1VFOA 3C6LB 3CDGA 1IZKA 3DX6A 1RJCA 3SDXF 1FAIH 2Q8BH 3SDYL 1RZKC 4PR5A 4NCC2 3MLUL 1Q0YH 2Y07H 5I15H 1R0AL 5IBUB 1YMMB 1FYTA 2AEQL 2XTJC 4P5KA 2Q86A 1IM9D 2QADC 2QQNH 5CIPH 5DJ8B 1V3KA 5J11B 5J6GA 1JV5A 1NMCB 3LPWA 3OZ9H 4JREB 2L7JA 1OM3H 1NAKH 2AAVA 3FHQA 4MA8H 3MNVB 4R7NA 4JFHD 4OM1L 2A9NL 2FYYA 2K3TA 1XZ0A 2X4QA 5FUCC 2EC9T 2IPTH 1F8TH 5INDA 3GHEL 2JCCE 2NY4D 1T03H 3SDXA 3QDGE 4ZTPL 4M48L 4F7TA 4AENB 1MPAH 4DVRL 2EICA 3Q6FB 5GISH 1MI5E 3CMGA 3HC0A 5HVFB 4FFZL 1EXUB 1X5AA 5KZCD 4DFIA 2RFXB 5JOFB 1CD1B 3W81A 4ZOCA 4Y8AA 1I8KA 5FA4B 3KPRD 5HDQL 3E0GA 1XF4A 3NAAL 1YEIL 4WU7A 1FV1A 3P0YH 3QEQD 2APWA 1YN6B 5JZ7C 2HMIC 1A14L 2XTJD 4G7VH 1A4KB 1U95A 3ARFB 4G7YH 5EUKB 1DSFH 3X3GH 2IJ0C 2QADD 1U8KB 1YEDB 1QSEE 5IB2A 4JRYE 4K7PL 3MGAA 4LCWA 4U05A 5SWQA 3MV01 1MLBB 3CFEB 3QJHB 5IFHL 3JV5A 3MGOB 3BO8B 4JO4L 2BXZA 1UYWH 2J1KA 2OZ4L 2H32B 4HHAB 3VH8A 4AT6B 2CRYA 5JPMA 1S9XA 3WFEL 1ETZA 3JWDH 1OT2A 4N0UE 2BY0A 3IFPB 3K2MC 2H45A 4M7LL 4G8EB 4PS4L 1ZSDA 3NVQA 3HFML 2AABH 4X7SH 2VLMD 4XB8A 2ITDB 3QI9A 3VD9A 1HWGB 3B2VH 3GI9L 1EAJA 4P5TC 4C58B 3HHRB 1BFOB 3KPSB 1MFDH 2DI7A 4PRDB 3MV7A 2BVEA 3CXDH 5D7IF 3PUCA 1Q1JL 4RIRA 2X89D 5BO1H 1AO7B 1QFHA 3L3OA 1ZTXL 3N1MC 4XVJL 3RL2A 2LE9A 3O3UN 1LGVA 3HMWL 3UTSD 5BRZB 3LQZB 3H3PH 4LSPH 2IANB 4PJ5E 1P84K 4ELMF 1NMAL 1YPZA 4ONHA 1IKNC 2AK4E 2ENYA 4NSKB 3NIDE 4MNGB 5JZ7D 2HMID 2YUWA 3ILPA 1JHLH 3DVGA 2AQ3A 5LAXA 3EZJB 5ALBH 3VH8G 3BPNC 1J05A 1QHPA 4J8RB 1Q94B 4P4RB 4GG6A 1CFSB 2L7UA 1BQHA 5HHNA 5ERWA 1B0GB 2W0FA 4NNXA 4JEGB 5GGSB 2P24A 1D6VH 3V6FA 1FZOA 5D7IA 2Z8RA 5H94B 4QGYA 4QRQB 3KAAA 5AYUL 2FR4A 4ZPTB 3RX5A 3GB7A 4WHTA 4LCUA 4PV9A 3HNSH 3IXTB 3HC3H 3T09A 2Q7NA 4YNYA 1JYVA 3GUTB 5JR1L 1B9ZA 2UUDK 1FNGA 4ELMA 3NABH 4P5TD 5D6CA 3BI9X 4FQLL 3WEXB 2C1PB 1T89A 3IB4A 3H0TA 4W4OC 3LDBC 3RTQA 3S35L 3MC0A 4Z5RA 1EGJH 5I74B 2I9TA 3C5JA 4O9HH 1JZ7A 3FFCA 4IDJL 1BD2E 1ZLVK 2Y23A 3U2SB 2DLEA 5GS0L 1BQHG 3C6SB 5CD3A 2EE2A 3VXRE 1P4IL 3ZSTA 4TVSa 1MFBL 3V52L 5E4IA 3RBSA 4L4TB 2NY5H 3N0PB 1B88A 1AIFB 2V5SA 3IGAA 4TNWK 3MOBH 3DVNA 2WBJA 3HR6A 2GSIA 4KHXH 5IT2L 1VENA 2OXHA 4C4KO 2BRQA 4HIXL 5I71B 2R1XA 1QFPA 2P5WD 3BH9B 3BP7A 3VXTB 1AD0A 1FZMA 3B9EA 1WIPA 1E4XL 3QDMD 4KI5C 1FDLH 3BGFC 1AQKH 3HZKA 3KYNB 4PJBE 5DEZA 4QOKA 1AH1A 2X1WL 5EU3B 2OLDA 1LEKA 1R3KB 3D48R 3MV8A 4Y7MA 2F5AH 1OARL 1OAKL 1IL1B 1FLTX 3RNKA 3QXUA 4NNYB 1FORL 1C7TA 15C8H 1X5HA 2GT9A 4ONFL 5I17B 2D7TH 2IBGA 3B4NA 5D2NA 1CQKA 1MCWW 1P5UA 4IOSD 3O81A 4R90L 1GC1L 4WI2A 2GTWB 1XF2B 1MCBA 2A38A 5FOJA 1N59A 3TPUB 5MP6H 3B6SA 5C08A 2UVEA 3V5DB 3PV7A 5CUSH 3L5HA 3RWFA 4ZUSB 3PHOA 5ICZA 2MHAA 3ARFC 4G6MH 2AQ2A 2AXFB 2KQNA 1L7TH 3DX8B 1C5CH 1PG7H 1QBLL 5K9KA 2F5BH 5HHVH 1MEXH 3KS0J 3I02A 1UB6A 2DTSA 1OP5H 1VEOA 4X6DE 4BFGA 4GRMB 3QQ4A 3I75B 3SE4A 4NWTH 3BP6A 4KI5D 4PJIF 5IEHB 1M05B 2W1NA 3AUVA 1RZ8B 4G9FE 5E03A 5D7SH 3ZT6A 4WEUD 4JZOA 3CDGB 3DX6B 1L0YA 1P6AB 5CJXA 4YHIA 5B3NA 4PR5B 8FABA 5TH2A 1FYTB 2BDNH 1W72A 2QKIA 4Z7VA 3ULVH 1CFNA 4ZFGL 5L9DL 4P5KB 1AY1L 1XFPA 2Q86B 2DTML 5J6GB 1JV5B 1XGQA 3PWJA 5F96H 4KKCC 3IDIA 4AEIH 2FHBA 3VGBA 2GJZA 4JHAL 4PJIA 4ZAKA 2V9QA 4U7KA 4EDXA 4WU5A 1FNHA 4R7NB 3TIEA 3O4OC 4KY1H 5DVKA 2FYYB 2VZUA 2VZ3A 1XZ0B 2X4QB 3ARFD 1W8OA 1N5YH 4PRID 3UC0L 2H26A 2VLKE 3MA9L 5INDB 3NBNA 1EERB 4GUPA 3SDXB 3SPVA 3LKSA 1EEQA 1G9NC 1MFCL 4G42A 4Y88A 3ZE0E 4F7TB 4WHCA 4UDUA 3V5HA 1OAYH 4P3WA 1FPTH 2R69H 3JWOH 4OLUH 3HC0B 1G9MH 5HYJE 4WY7L 4P0DA 4DFHA 3RRQA 3JBG7 5F7HA 3RGVA 3VXPA 4MJ4A 2ZPKH 4QLRA 4LBEA 2DQIL 1I8KB 1AI1H 1U58A 3PIQA 1QFWH 4HG4K 5HHME 1XF4B 4GW4A 3HMXH 1T22A 4WU7B 1FV1B 3NPSB 4DJMA 1U95B 5J7CC 5I74C 5J8OA 2BVOA 4FQJL 2DQUH 1I4FA 1A1NA 1CVRA 5DWUL 5IB2B 5I66A 2FX9H 3KWWA 4KQ3H 4PB9L 4LCWB 5SWQB 4KKCD 3IFLH 4YXHH 2IAND 1ZT7A 5IG7A 3VWJC 1HOCA 3DVIA 3SJVA 3VH8B 5JPMB 4R26H 1S9XB 2AI0L 1ETZB 1WT5A 4F57L 25C8H 5E2VL 4XCCL 2EYSA 1I3RA 3LV3A 3TV3H 1ZSDB 2KQMA 3ZL4H 1VGEL 3QI9B 1IAIH 5I71C 1KN2H 4OCMC 5I19L 1NEUA 1JNNH 1Q8MA 3MV7B 7FABL 4RIRB 1RZKH 5EOTA 3L3OB 3RL2B 5MHSE 3ESVF 5DRZA 1KIPA 2FHCA 4JKPL 5IGXL 4ZFFA 1P4LA 3F7YA 3O6LH 4FQHA 4HWEH 4P9HL 2W91A 3I2CL 1DBML 1NFIA 2WAHA 2MTPA 4OD3L 4LF3A 5FHAH 4HT1H 3LIZH 4LSUH 4GO6B 3ULUL 1YPZB 5T3XE 4ONHB 4R7DA 4TSCH 3GKZA 4JO1L 1MCNA 5LAXB 1DQML 3DVGB 3D3VB 3ILPB 3BESR 5GRVK 4G80A 1J05B 3SGKA 4B0MM 3OKKA 2C3HA 5K9JL 1PAMA 3UYRL 4GG6B 1BQHB 5HHNB 5ERWB 4CN1A 2W0FB 2XN9E 4NNXB 4YXLH 2J4WL 2P24B 3S4SA 3PHQA 3V6FB 4K2UH 1FZOB 2V2XA 4BH8A 4PTTA 5D7IB 3VWJD 4N8CL 1NUNB 2KUTA 4U6XA 1L9NA 2FR4B 4MA7H 5JXEC 4PJ8A 3GB7B 4WHTB 4L4TD 4LCUB 4JGUA 1XF3A 4PV9B 1D5MA 3FQXA 2OXGA 4TRPL 4LARH 4N9GA 1MF2H 4YNYB 1ZLSL 1KEGH 2XA3A 1KC5H 1WJ3A 4LHQB 1FNGB 1ORQA 4ELMB 5D6CB 2XPGA 3S36H 3Q1SL 4MHHG 4JVPA 3H0TB 4XPBH 2XZCH 3MRMA 3RTQB 2Z9TA 5C7XL 1SY6A 3ARGA 3W2DH 4Z5RB 1U9KA 3NMEA 1NEZA 4PRPD 2I9TB 3D5OF 5TE4H 3C5JB 3ZKSD 1IGMH 3NIFF 1NKOA 3FFCB 3QRGH 4QXTA 2RR3A 3UXFA 4HGKC 5CD3B 4Q6YA 4YHOL 1CVSC 2GY5A 3OG4B 4WEBL 1ZA3A 2NZIA 3S36X 2UUDH 3AGVA 1DVFA 3HI6H 3QUXA 4MJIA 4Q58C 3UO1H 4S10A 3IGAB 5HGGS 3VXSD 3DVNB