2I27N

Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
109
Chain Sequence
b'RVDQTPQTITKETGESLTINCVLRDSNCALSSTYWYRKKSGSTNEESISKGGRYVETVNSGSKSFSLRINDLTVEDSGTYRCKPESRDAECAALNDQYGGGTVVTVNAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords New Antigen Receptor Ancestral
molecule tags Immune system
source organism Ginglymostoma cirratum
publication title Maturation of Shark Single-domain (IgNAR) Antibodies: Evidence for Induced-fit Binding.
pubmed doi rcsb
total genus 29
structure length 109
sequence length 113
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i27N00
4I48B 1WZKA 5FM5O 2PF6A 4NO0B 5C0AA 4MJ5B 5IK3B 3VGAB 1QSFA 1ZT7A 5HY9B 3ZE0F 5IB1B 2IPTL 4XVSL 1JGLH 4XC1L 3AS3A 4G8EA 2OTPA 2HRLA 3T4YA 5E5MA 3FB7A 1JWUB 3VGBA 4Z5RA 3QUMB 4CMMB 3MRIA 3V6ZA 3EFDH 5JW5A 1FZKA 1S9WB 5TH2B 1ZSDA 5JOPE 4BJLA 4Z8FL 3G6JF 2NW2B 4MQ7A 3MX0A 3QIUB 5F1NB 4KQ3L 2ATPA 1LD9B 1KNOB 3N85H 2C1OB 3QEHA 5E8PA 1J8HD 4JO3L 5D71L 4UU9B 1NCAL 2FECI 1DQLL 4U0QB 2VLJA 4OCRL 4DKAA 1FDLL 2GHWB 4MHHI 1H5BB 4YHPB 4HMCA 4U3HA 3NAAH 1NL0H 4ODUB 4PPTA 4XCFL 5E2VL 1MQ8A 4D0CB 1ZHBB 4HUVA 3OKDB 5ESQB 4MWFA 1NH6A 4TSBH 2E9IA 3T04D 3HFMH 5D7JC 4XPTL 2NPLX 3SQOL 5I30H 4X8JB 1AO7A 5CBEB 1AKJD 3GSQB 5I0DA 1XFPA 1T0PB 2VR5A 2CUMA 3LKRA 5JDSB 3L3DA 2OJEA 5E9DD 4ENED 3RPIA 1I75A 3RY5A 2AXGB 4QT5B 5DJ2B 3F5WA 2DQEH 2KL6A 2Z93B 3MUJA 1Y0LA 5CHNB 1YEJL 2W9DL 4K2UH 3F12A 1U3HB 2XFXB 1X5FA 5EIQA 1ZLVK 5DMYA 2DIAA 1OGTB 2EDEA 3IFNL 3VXTA 5A16B 4G3YL 3V4PH 3FMGH 1INDH 2YKLH 2IJ0C 5D6DA 2VLMD 4JRXB 3MV11 1D5ZB 3QWRA 1UWGH 1MCWW 4NQXA 3BH9A 2WINB 4U1KA 3HI6H 2R1WB 4GAGH 1D9KA 5DWUL 4X5WB 1DVFC 4KC3B 4PRIA 4XMKL 4P2YA 1MFAH 2NZIA 2VWEC 4LIQL 1RK0A 3U36B 1C08B 5DT1H 4IDJL 4QGYA 1XR8A 4OIAA 1JHTA 2ICCA 4NO3B 3BRFA 4XP1L 5CD3A 4MNGA 5DMGC 2NTSP 1C12B 1SY6H 3KAAA 2JCCB 4N0CC 1YMHB 4CDGC 3QB7C 4JKPH 5HDBE 2CDEB 1V5JA 5IW1A 1PLGH 3ISWA 1FO0A 3MRPA 1F3DJ 4S1DC 5FYKE 3SDCC 3SPVA 2AJVH 1LMKA 4RFOL 4Y5VA 1NCBL 3GKWH 1T22A 1QSFE 4Y16B 3F7YA 3QUYD 4URTB 5I8OL 2PXYA 1FYHB 5CBEA 3O4OB 5DEGB 4LSQL 4PGBA 5FHBH 3KDMA 2M26A 5IFHL 4XPAL 4LKCB 1IT9L 3A6BL 3QP3A 1M7XA 4CVXB 3EYUH 5B4MC 5C2UB 1S9YB 1A6VL 3VW3H 3PGCB 2D7QA 4I5BB 1S7WB 1JGDB 5KANG 5CKGA 2BY0A 3INUH 1EXUA 5A16A 3ULVE 4KUZL 2X4UB 4LCCC 5IV2B 3RIFK 5J6GA 3MV7A 5ALBL 2VZVA 1VCAA 4DKFL 5BCAA 1DQQA 3W82A 1I1AA 4LLUB 3NH7H 2H2PC 4WO4C 5JPMA 3FB5A 5M95B 3BKYH 2BNRA 4LCIH 4OCXL 3WLWC 4AZ8A 1PVHA 4CBPA 4MB5A 5EO0A 4LSTH 3QYCA 4OFYD 3C2SA 3OJMB 1OCWL 4FQXC 3A6CL 3Q6FA 4KROD 4F2MA 3LEXA 2PKDA 5C0CA 5FV1L 3STBA 3UTZB 3O3EB 1QTYT 3C2AH 4XBPB 4BH8B 3VXQB 1I8LC 2VYRE 1I7UA 5KTEH 1XH3A 4PUBH 5JTWA 3G08A 1UEMA 3V0WH 2VL5A 1VHPA 5GS0D 1KCSH 3AUVA 3LHPH 3EOYG 5K9OA 1FVDB 1NEZG 1TQBC 4WHDA 3PWVA 5FKPB 2PW2B 5D2NB 2PXYD 3O8XB 2OTWA 1WFNA 2J12B 3PGCA 3OHXA 4NHUB 1WWBX 4KDWA 4HIEA 4NZUL 3SJVA 1T89A 5DUPH 4KI1A 4OSUH 3IFNH 3QNZA 5D5ME 2FZ3B 2NZ9D 2YN5A 3MV7B 4K71B 1JF1A 3RVXC 4OCYL 3T1FA 1A64A 4YDIH 1N0LA 5HXMA 2V5RA 3PWPA 3I6KB 1AIFA 4PJBE 2P5WE 2C7UA 3K4DA 4JPVH 3LD8C 2V7NB 4JJHA 5TJWK 1Y18B 2XWTA 4OZGE 4UAOC 5GGRB 3VG0H 5F9JA 4W70A 1JNNH 3HA0A 1EAPA 1AGBA 3KPLB 4GW5B 4KK9D 5CLTA 4OF7A 4L4TB 2NXYD 2GFBB 3FQXB 4YFLI 1MFCL 1YEFH 3HRPA 1WAAE 4OCNC 5T33H 1CU4H 1TZHA 3Q5TA 5C0CD 3SO5A 3F58H 4PJ7B 5I8KL 3VXSE 3MROB 4M1DH 5EWIL 2V17H 1IGCH 3H3PL 5C07B 2ZP0T 5F89A 5F6IC 1JPSL 1PBYA 3KYKH 4R2GD 3B83A 3KLHC 3DMMC 3QA3A 4IJ3B 3EIFA 5BVPL 2HJKB 1MCLA 2DQTL 4BQBA 1YY8A 4OV5B 4G43A 1PG7W 3O3DB 1EFXB 3WNPA 3E1F1 3OKOA 3B6SB 3F5WB 3N06B 2DKUA 1CLYL 1BGXH 4QRRE 2WLYA 4NM8L 4YBQD 2Y5TA 4GMSL 5JHLH 3OBAA 2IEPA 3BSZH 3MSPA 3MRMA 1ZS8A 4Y4KD 4P2QA 2ZG2A 5CSGA 4OZFH 3PIQB 1YEHL 5I19L 3CVHH 2R23A 1XEDA 4RAHA 3OR6B 3MODL 2H8PA 3QEQE 2VDRL 4O2FB 2XI9A 2NY4C 4IMLB 4ZXBD 4ZS7H 3GNMH 5CUSH 3IFOB 4Z7WA 3L1OH 5CCKL 3EYOB 2CKBB 4H0GA 5TDOA 5EIIB 1U42A 4G8IB 3MLZH 5ISZB 3WS6A 1J05B 5I1CH 3DXAD 5I8CA 1F4HA 5EC1B 2OZ4L 3V5HB 5K33A 4JLRA 4Q6IB 2EDBA 3V7AG 1UZ8B 4R96A 2YK1H 5TF1H 3IVKA 3UO1H 3DIFB 2AJSH 3MJGX 4GXUM 3UAJC 2XV6B 5EBLB 2EDDA 3V95A 3QCTH 1Q1JH 4NNPH 4F8TA 1P9MC 4HCRH 4HLZH 5L6YL 3NPZB 3BQUC 4EI6B 5JQ6H 4ZO8A 1CU4L 1GIGH 4AL8H 3MFGB 4KGLA 1LEKB 3MXWL 3MRFA 3PWUB 5ADPH 4X0KB 3OXSA 5EBWB 2AABL 1P2CB 1J8KA 1MFBH 4U6YB 5I16B 1UM6L 4ODBD 1G9NC 2QQLH 3OXRA 2QV2A 4F3FA 1OAKL 2B5IB 3VCLA 1D6VL 4MS8C 5IJVA 3JSSA 5FUCE 1U8LA 3CDFA 3D25A 2K1MA 5KZCB 4Y5VB 4GG6A 5DA4A 1CD8A 5HHNA 5I17B 4R97B 2Z31B 3QIBA 3WHE0 4JFEB 2XZQL 2VRAA 2P5WD 2J5LB 3KR3L 3P0VL 1CLZL 4OLZH 3U0PB 5EZJB 4MXVF 3HNSL 4U1LB 3R0NA 3OB8A 3ZT5A 3F65A 3VFNB 2LABA 1BOYA 3NTCL 3WFZA 3T0XA 1P4LA 4NN5C 4AEHL 2LAGB 4RMSA 4OLWL 2LU7A 5GHWH 4D0DA 4ZXBA 5DVKA 2A6KB 4NN6C 1QSEE 1PKOA 3L1OL 3RUGF 1HNFA 1VADB 3PP4H 3D0LB 5JQHC 3TA3B 1ROWA 4NUJA 4XBPA 3KPQA 4LHUB 5HBBA 3BE1L 4MXQC 1VDGA 4LLVB 4KZDL 3CPLA 3TP4A 1QEWB 4LLAA 4APQA 4KHTH 3NCFB 3CZFA 4KJYA 3DGCR 1NBQA 3BAEL 3I50H 4JZJC 1MQKH 1D9KC 4UBDD 3TPKA 2XTJE 4JVWA 1C5DA 1F6LL 4GRMA 2ICWA 3WFEL 3WFBL 1CDCA 4MNQA 2DQGL 2QEJA 1VPOL 4I1NB 4JVUA 4GW4B 3KYNB 3MXWH 3R8QA 5C2BL 5L88H 2FJHB 3MRNB 3VXOA 1QNZH 3MACH 1BZQK 3WIHA 3UP1A 1ZGLA 4YEFA 5FHAL 3U9PH 1KYOJ 3K80A 3WD5L 3DO3A 4LOUC 3FRPA 4AT6B 5I30L 3OKKA 2IQAA 5IMMA 4YXKH 3VWKD 1FGVH 1QR1A 4NKQB 4X83A 1G7MB 1WBZB 4LCWE 4NSKB 5HDLA 1GPOL 2Y4SA 3N1QC 4U1MA 2YUWA 1T83C 5KAQG 1FZJB 5D1XA 1II4E 2AGJH 5F7NC 3HRZB 1SJEA 4NC0B 1LVEA 4PTUB 2MCPH 4E5XB 3GM0A 2YD4A 5IESL 5L8JB 4GAJL 1S7XA 2I07B 3K8KA 2BHYA 3CMOL 2OJZH 1RURL 4D0DB 4LK4A 1FDLH 4QHLA 4X4ZA 1WBXB 5F8QC 4IIQB 1M7DA 3VXUA 1UB5B 4KI5D 1AGBB 4M6OL 4MD4B 1MCNA 5D8JL 2VXUL 1YDPB 4MA3A 5KG9B 4IMKA 3NFSL 2Z4QA 3UTPE 1R0AL 1J0YA 1N2RA 1HEZB 2PTTA 1QEWA 5ITBH 3I6KA 1K8DB 4HH8A 4GS7B 1ZLVH 5I1AA 4HGWA 4IHOA 5I15H 3QDME 4G6ML 5CZXD 5ELIA 4KY1L 4XCFH 4L4JA 4DUWA 2GJ6A 3VGEA 3FOLB 1G84A 3FQRB 1E0OB 1EAPB 1YEHH 2UWEA 3P77A 1AY1H 1TTUA 1YUHA 3K7UA 3R06B 3REVA 2H1PH 4KH2A 1GC1C 2PW1B 3DSFL 4XP5L 4CU8A 3ARYA 4Z77A 1A14H 3FQNA 4POZC 1ZHKA 3H3KA 3SE4A 3QHFH 3U4BL 3REWA 5B38G 3TYGH 1S7VA 1D5MB 5EZLB 5L2KE 3I02B 3HAEG 4TNVF 4G7VH 1FL3A 1MRDH 1H15A 5A1AA 4X9BA 5D2LF 4ONFL 5L2KB 2AK4B 1A6WL 2GUOA 4QY8A 5A3IC 3NFPB 4P9MH 1ZHNB 5HGBA 4NNYA 1IZKA 4WFGD 4LCWD 1NFDF 1N5YL 3X11B 5D7JB 5EPMB 4TSCL 2RCSL 3N1MC 4ENEC 3FFDA 4H26A 3VGHA 3QCVL 4Z78B 2D31B 1SVCP 2N7BA 2F5BH 1YMMA 1WUNT 5T1MB 3TVMB 4MJ5A 1RURH 5HY9A 5IK3A 4PJ8A 1J8HE 5C09B 4JN1L 3W0WD 3KS0J 3FT2A 3VXUD 1XF2B 3QT2A 2WUBL 4WUKL 3TN0B 4LSRL 2H32A 4HEPG 4TSBL 4W81A 5IHZA 2XTLA 3PQYD 3M8OL 4GMTL 2CIIA 2FWOB 3BP7B 3EDJA 2IADA 4X8JA 5ID0A 3VFTA 2NW2A 4MQ7B 1HHIB 3RL1A 2QADC 4M7LL 5IWLC 1IAOA 1UXSA 5F9AC 3H9ZA 1J05A 3BDYL 1CE1H 3NIGF 1FVCB 3GUTA 2FYYA 1QACA 3RWDB 4MCZB 4DCQB 2YZ1A 3INUL 4D9RE 5E94A 1HXMA 1NGQH 5JW3H 4BZ1H 2EZ0D 2R2CA 4APQC 3L95B 4F3FB 5LGHL 1KG0B 2A77L 2BSRA 2ICWJ 5IEKA 1RZIA 3P0GB 2GSIA 1QRNB 1RUQL 3JV4B 3QFDA 3BT2L 2Z8RA 1R3KA 4Q9BA 4YNYB 3GJFA 4P23D 4JANB 4XMKH 3L3IB 4R7NA 4CADA 3PWJB 2AXGA 3BE1H 3HNTL 4OLVL 3GKWL 3MYJB 1WICA 4XP1H 4CVWA 4CMHB 4V1DA 2E7HA 1OM3H 1XR8B 4M6OH 3T0VA 1V7MH 2NY1C 5GISH 3O2WH 4RNRA 1RZ8A 1FRGL 3HCVB 1DVFD 5D7IE 2FEDC 4HWZA 3V6BR 4KXZH 1VPOH 5E8NB 2XWBB 1JFQL 1NGXA 3O3BB 1OPGL 1A5FH 2R4SL 5EFIB 5DJDB 4ZQKA 5F1KC 2QHLA 3ZYZA 4MJ6A 3RGVB 2EEDA 4PRHD 4LCCB 3AM8C 1BQUA 3IGAA 3PQYA 5C0DB 1OARL 4IS6B 2PNDA 5SV4A 4YHLH 4PLNC 1A6UH 5HYSG 4OLEA 1EAJA 3T65A 4Z7NF 4G7YL 3BPNB 4P59L 3ESVF 3T8XA 3ZSTA 1MCJA 3VG9B 4CNIB 4MLSA 5AWNL 5T1KB 3K4AA 2VL4A 5JIPA 4RGMB 3IDMB 4KMTL 5LWYL 4ZDHB 4D0BB 4F8QA 2AEQH 1CICD 3D18B 4AEFA 1BQHB 4NKDA 5F7EL 1KGCD 4JO1L 5LAXB 5JLZB 2FCBA 3WN5A 4EI5A 3QPXL 3LQZA 4QHNA 5T5NG 2VQ1B 3QFDB 1EZVY 1KIQA 1NGQL 1DQQB 2WP3T 3TV3H 5DGRA 1RFDH 5FCUL 3HE6C 1GHFL 1AO7E 4WFGE 3IFPA 3I6GB 5E03A 2ATKB 4WUUA 3RY4A 4FABH 4FQQA 3RIAK 4OZIB 4WV1B 4U1SA 4MNQB 4RWHA 3UTSD 3MODH 4BK5A 5F7LB 3LQAH 1ADQL 4PJ9B 2QHRH 1KTLA 3O6LH 4JFHE 1X6NA 4LPVA 5IOPA 2GEEA 3DGGA 2P44B 4JN1H 5ITFA 3FZUD 3VXME 1JNNL 2QSQA 2R69H 5HYSA 1MCHA 3WE6A 4FTVE 3X3GL 4M02A 1IGCL 3H3PH 3GI8H 4R4FL 4OFKA 1TJHL 2W65A 5IV2A 1U41A 3U7WL 1D5XA 3LH2H 4JFDB 3FB5B 1JWUA 3ARVA 3BUTA 3LRSB 4J3TA 3IFLH 4LCCA 2XACC 4KRMB 5DRXA 3T2NL 2EE6A 2E27L 4P4KB 4ERSH 1E4XI 4PRIE 1QFWL 1MRDL 2C1OA 3DROB 3VFVA 4LSSH 1EDQA 5DUPL 4B53A 5F7DB 4R4BB 1IQWH 2DIJA 1F3JB 1NCNA 3LN9A 1FV1B 4MA3B 3U46A 5CD5D 1AI1H 2FZ3A 4L4VD 4PGJA 5KSUB 5E2UL 1E28B 2FHCA 2C3XA 4TULL 3OAYH 2AJZB 1K6QL 1MH5B 1NCTA 1J12A 2BSTA 4PP1C 2F53B 5DI8A 3RVWC 43C9A 4Z18A 2WBJB 4ZUSB 2IFFL 5B3JF 3QBTB 5BO1L 2P5ED 4NNYB 5D2NA 3KLHD 1QLEL 5C86A 3BZFB 4U33A 3QDAA 3PWVB 4HDIA 3HZVA 2PO6B 2WM0A 5DMIH 3V0WL 4ZTPH 1G7LA 3AREB 2OZ4H 3AY4C 2H9GB 3L3KA 5HHME 4QT5A 1J0HA 4ZS7L 4R26L 3G6DL 1JMXA 3S36L 4KPHH 2P5WA 3DTXA 4JRWA 1WQVT 4WEUD 5T1LD 4KAQL 1BF2A 4J6RL 1WVZA 4JFXA 4PRAB 3L7FA 5EWIH 2XZCH 4RQQB 1U8HA 1SBSL 4LGSB 2NY2D 4X6FB 1HINL 2CMRH 4QOKD 1KEMH 3I9GH 5JIHA 1YEEL 3VXMB 1R5IB 4UT6L 1PEZA 5TFSH 1JVKA 3QXWA 3E8UL 5I9QC 5F9JB 3MC0A 5C0BD 4BH7A 1RK1A 4FFYH 5JHLL 4EVNB 4YJZL 3V0VA 1WITA 4TNWK 4X4ME 4M7ZB 1A02N 2ORBL 2CK0L 2ZWLT 1KJ3H 4E0RA 3QQ4B 4JEGB 3C60B 5DXWA 1NFDA 4A6YL 1CGWA 2GJ6E 2ZUVA 3GSNA 3HZYB 4U1NA 1L6XA 4X8XA 4WRLA 1AI1L 3DYMA 3CGTA 1MCRA 3GMRB 3E2HC 5JUEL 1TZIA 1D7FA 1RULH 3QHZH 4JO2L 4JO4L 3RX8A 5IMOB 4M7KH 3RVTC 4ZUUB 4A6YB 2BNQE 1IKFL 2APFA 3VXRB 1UT9A 4LEXH 4HCRL 4PGEA 1T89C 2Y5TB 1X5LA 3PHQB 5IBLC 4BFGA 2VAAB 2YD3A 3RHWK 4UDTB 1JGDA 2ICWI 5GS1C 3MRCA 2C9AA 4K07A 2HKHH 1CFSA 3GO1L 4C4KT 4DGYH 4X9GA 1EHAA 3LH2L 1EVTC 3NABL 1G9NL 1JGUL 1UJ3B 3EAKA 3U48A 3ULUL 4YFLF 1B2WH 4QF1B 5EB9A 2YEZA 1NDGA 5C6PB 3GIVA 2BNUA 1OP5K 2NXZD 3MYJA 5FM4A 1BD2E 3OKMB 5C0EB 1BLNB 2V9TA 4YPGB 5KBNC 5L2JB 1XGYL 1JNJA 3CK0L 1CL7I 1RZKH 3QNYA 3C87A 3TCXA 4M48H 1ZLWH 1T20B 1SY6A 1K4DA 4G8GD 3AY4A 4R4NC 5J1SC 4HC1A 1MAMH 1ZT4A 4EUPH 5FYLD 1NSNH 3V4UH 5FM8A 5TDNA 1UWGL 2PN5A 3T3MF 5D7IF 5EBLA 4U49A 5I17A 4C57C 4TUKH 2G2RB 3C9NA 5L88L 3SJVD 3U0WH 2ORBH 5I2IB 3WNNA 3BP4B 5IMKB 3PP4L 5IHLB 5IVNA 4A6YH 2PYEA 3AROA 4FQ2L 3QCTL 4FRWA 2UUDK 3OL2A 4G6FD 4JZJB 4KKBD 4ODXA 4TNWF 5I1DA 3WLWD 3SDDB 2HFGH 4B5EA 3VD3A 3GSUA 3VFMB 1P7KB 1CFQA 4K9EL 4ODTH 1VADA 2DQDH 3HI1A 3B9KD 1EBPA 3MLRH 2QSCH 2FATH 5SX5H 5DQDH 5HGDA 1AH1A 4ODWA 1IGYA 1UWEL 2DQCH 2EYRB 2CMRL 5DD1L 1QLRB 5EU7C 1AIFB 1U8KA 1YN7A 2ERJC 4UT7L 4UIKL 1N3NB 3Q3GA 3TNNA 3W2DH 2F5BL 4O51A 4L8BA 1MCQA 1U93B 2DQJL 3FO1A 4GKZB 1X7QA 5KN5B 3QJFB 4YHMH 1NAML 3X13A 5SWSE 1D9KD 1Y6NR 3WUZA 5T1DL 3WD5H 2EXYD 2YR3A 2LFGA 1RVFH 4OD2A 4Y5YB 3TCLA 3OGCA 1A14L 4MHHG 1R3HA 5HGAB 2H41A 4LF3B 5TGBA 4KVCH 5KS9F 1U8OB 2OXHA 2GTWA 1HHKB 4FQIL 1FLTX 1D3CA 1RIHH 3MRBB 5EOCJ 2P47B 3IXAB 3H6JA 5JORA 2V2TA 1B0WA 4AYFA 1XGUB 3KPPA 4G6MH 4QHLB 4J3XA 4Q74A 1I1AC 4KVNH 3UBXA 5BRZE 1QSZA 1HH6A 3LD8B 5FO9B 3QDGE 4MXWH 2H1PL 4JFOB 3M8OH 4GMTH 4N5UA 2DQGH 1V3MA 2O5ZH 4DN4L 1NFIB 4WUUE 2VH5H 1NCAH 2EZ0C 5FGRA 5IMMB 1KF9B 1YEDA 5F3HA 4NC1E 1V3LA 1I7TA 5C8JB 1P84K 3TJEH 3C8HA 2Y07H 1XGQB 4HWEL 4N0UB 1JPST 1ZT1B 2DQCL 4F57H 4NZUH 5FF6B 1RK1B 3G6AB 1G6VK 4IIQA 4NDMB 1AD9A 1JV5B 5F6IB 2DQTH 4WI7A 1WC7B 3VXSB 2BRRL 4YDIL 1EJOH 4GBXA 5CJXA 4L9DA 2COQA 1H5BA 1MY5A 3A0OA 1G7JA 3H42H 4MAUH 3QFJB 3TVMC 3HI5L 4JGJA 4FMFA 4EXKA 5GGTA 3OKLA 4NNXB 3K8LA 3FT4A 5D7LE 3RNQA 4OLXL 4ZPVB 3VI4F 1S7QB 5E2WL 4DN3L 4NHCH 1JP5A 4LARH 1MRCH 3BEWA 5DURD 2H45A 3UZQA 5JDSA 5GZOC 1KB5B 3O2DL 5FUOH 1EHNA 4PIRF 1OB1B 3AXLB 4H88H 4PY8I 1Y0LB 4M61A 5HPMA 2PW1A 3LV3B 2FD6H 3KPOA 3UYRH 3TO4B 1URLA 5KSAD 3ZE2E 3IU4H 1QPXA 1HHJA 3SQBA 2HFFA 5EU3B 2V5TA 3O9WC 1MREH 4N9GA 5C09A 3SGKC 3TT1L 4HD9A 4LSUH 5H94B 4HKBA 1OPGH 2IAMB 4LPUA 1J0IA 1CG9B 1N59A 5D2NE 5HHNB 5EBMA 4PRNB 1GZQA 1F3RB 3U2SA 1F3DH 1FQ9C 4UT7H 4M5ZL 5HGHB 3WFDH 3HKFA 1DBML 2CJUL 1R24B 4N0CD 1ADQA 4OZHE 4CU7A 1EH9A 1ADQH 5BOPA 4KJQD 3CCHA 2CLRB 2Y7QB 4XVUD 4IM8A 4PJ9C 3MTRA 2VQUA 3BP6A 4IRZL 3T4AA 8FABA 1OW0C 3S35L 1QKZH 1U3HA 2XFXA 3SN6N 3NA9L 3VD4A 1NUGA 1FYTE 2JIXA 1A1NB 1WIUA 1Z5LA 1A4JB 1T7WA 3O41A 4YBHA 3TN0A 3RU8L 3GMOB 1V7ML 4WFFE 4OKDA 4YGVB 5F89B 1IAIL 3BD5A 4XCCL 1ZOXA 3VH8B 2DM2A 1XZ0A 3BMWA 2H3NA 1BX2B 5DK0B 5I8EB 1KSRA 1N0XL 2BJML 2PTUA 1Q0YL 1A3RH 4ZFOL 4JDVA 3KXFE 2DTMH 1A5FL 2R4SH 4HKXB 1AGEB 2Q1EA 5EC2B 4GAYA 1XF3B 4DQOH 1PQZB 2EECA 1OAZH 2JCCA 1H8SA 3BUYB 4HFUL 3IAGC 1PX3A 4YDLC 5E2UH 1CICC 2HT2D 3FFCA 3VG9C 4MNGE 4XVJH 3BKYL 2H2PD 1T1YA 5E6YA 1DBKL 4NQSA 4U1GB 5KANI 5GGTL 4R8WL 3KNBB 4J4PA 3SDXA 3RVUC 3GMQA 4O4YL 3WS6C 5HDBF 3ARDB 4KROC 2HJFB 4TSAH 3IKCB 4PGBB 2E27H 1J1XL 1T21A 3BYYA 5BS0B 1QR4A 4K8RL 3ZKND 4PTUA 1JHLH 5TDOB 1JPGB 4ODXB 4R26H 3PJSA 4EOWL 1KJVA 3OJDA 2E7LA 3FMGL 4M5ZH 3CDYA 1D6VH 2AV7A 5D72H 2CJUH 4HUXA 4JHZA 3RWJA 2NR6C 1J8HA 4HXAH 1EA9C 1VEPA 3MO1B 4ELMF 3HCVA 1LK3H 3WN5B 1OTTC 2MHAB 3O9WA 3QO0A 4U6XB 5GIRA 5KSBE 5JOFA 1U8JB 2VL5B 2WW8A 5E1HB 4DFIA 1XGPB 5I6XB 1T0NA 5JPMB 1ZGLM 1T7XA 2KZWA 2CK0H 2Q76B 5FO8A 1B88A 1R3HB 5DEZA 5HGAA 1UKTA 2IANA 3QSKB 5EULV 5DJ0B 5JHDB 3BPCA 4XC3L 1N6QL 3MRBA 4XPBL 2F9BT 1MF2H 1JK8A 4ODVL 4GKOA 4U6YA 2HWZL 1QHPA 3EDDA 3RVXD 4HT1L 4HH9A 5T1KA 3EYSH 2Y36H 1KBGL 2AS5M 5IOPB 3FQNB 4QRUB 4ERSL 3JWNC 4YBQC 3DX9B 4OGXH 4HLJA 2KBGA 2LAAA 2VE6A 3MJ7B 1ZLWK 4DTGH 2VDOH 1H8NA 3HUJE 5CEZE 1SYVB 2X4RB 4J8RA 1HSBB 4LLMB 1EEQA 3SKNA 4N0UA 4FTVD 2BZDA 4J4PD 3D9AH 2GY5A 1NAMA 1JF6A 3SDYL 3RRQA 2VLRB 3ALPA 2P24B 2WBJC 4LPCA 4QRQA 1AQDB 5T3ZH 4U3XA 4NFCA 4DGIL 3P73B 2XA8L 2Y6SD 3FQXA 4MA1C 1KEML 4PJHB 5CLWA 4QWWD 1WC7A 5ESAB 4DKFH 3O3UN 5C0CE 3U9PL 3ULUC 3O3AA 2ZUXA 4CL7A 1LEIA 5JPNB 5DUMH 1LDPL 3Q2CA 4ZTPL 4DZ8A 1V7NH 2JCCE 5D72L 4OI7A 3HAEA 4XBGB 4NNXA 1JZ5A 3ES6B 4OCYH 2FX8L 1KPUA 1XGRA 4HUKB 1HIMH 1XF5B 3NPSB 2FIKB 4GAJH 4HIJB 2RR3A 2V7NA 2CDGA 1GOHA 1MAJA 1DQDL 1QFUH 4Y0GA 1OB1A 4KJPD 2WBKA 1FNAA 1NCCL 5J8OA 3DUSA 4JY6A 1N6UA 4AQOA 4HSQA 4JRYD 2ZG3A 3V4VH 1XAUA 1DBKH 2EKSA 1QSFB 1ZT7B 4C56E 1AKJB 2VZUA 3SDAD 3MRLA 4QRRD 5ITBL 2YD5A 2CUHA 1JI1A 1QFWM 1UCBL 4Q9QH 4PRPB 2R1XA 3K1DA 2ED7A 4OB5L 5ESVA 3GJFB 5IVXA 1U3HD 4UT6H 1TQCC 5D1ZB 3QIUA 5F1NA 1MFEL 2EDKA 5J3HD 4ZAKB 3BVNB 4MXVE 1DBBL 3RU8H 1JGUH 4FA8A 4OLUL 1MCSA 3ULUH 2P7TB 4LPYA 3SDDC 4LSTL 4BH7B 4HBQA 5I1LB 2AK1L 1QVOB 1A1NA 3BIKA 3MA9H 1K5NB 2Z4QB 3GMNA 1ZAGA 2IAMA 2WUCH 4LL9A 4PRAA 5E1AB 4XC1H 3CSYA 3GJEB 3HR5A 2HN7B 2HG5B 1G6RH 4M6NL 1VKXA 4KMLB 1QSEB 2PCPA 2HKHL 1IC5L 3GO1H 4DGYL 3OAUL 1RZGA 1BZ7B 3ARSA 4AIXA 1A0QH 4NPYA 1RZ7L 1XF3A 3IAQA 3D3VB 3ZDXE 2CXGA 3DRQB 4HKXA 4H25B 4RMRA 5B8CB 3MGOA 3C60A 4Y2DA 3REWB 5L7XH 3E6FA 3JV6B 2DS4A 4JPIB 2GYSA 1FZMA 2FLBT 4JRXA 3D2UA 3TZVD 1X3DA 4LRNH 1AXIB 2MKWA 4JFFA 5FYJH 3VWKC 4AK1A 5E8EB 4ELKB 5IVXB 3GSOB 1BIIA 4G9FA 3SKJL 2ATKA 4WUUB 4AL8L 2XRAH 4QHMB 1I4FA 4MA7L 1OSZA 3WNMA 1P4LB 2OJEB 3ULVD 15C8H 1HQ4B 1B0GA 3CLEL 3DLQR 4R6UA 1IEHA 2AK4E 1K4DB 1CR9H 1RULL 3QHZL 1DBBH 4JO4H 4OF6A 4OD3H 4BZ2L 4OM0L 1I8LA 1I1YB 4Z8FH 2FL5B 4BKLA 4NQEA 4OJFH 1Q9LB 1ITCA 4X7SL 2Y07L 4PYGA 3MA9L 4JDZA 5CBAA 1T04A 3VFUB 2NX5E 1JRHL 2K7QA 5F9OL 5AAWA 4M00A 1RUPL 5BV7C 3TYFA 3ILPB 5E2TL 4Z0XB 5IBTL 1F90H 1YQVH 4C83B 3NN8B 3KXFD 4DN3H 3AMLA 3QDJE 5DR5L 4HH9B 3LEVL 3M1BB 2F53E 3MLWL 5D2LB 2YA1A 4S1RH 2PXYB 5TDNB 2W60A 1NC4A 4YLQT 4YHZH 4XT1C 4KJYB 3WFCL 5ICYB 2NY5L 5ACZA 3HRZA 2EIEA 2Q76A 3KJ6H 3T0WA 1B4JH 2EH7H 5FO8B 1J0JA 3ULUE 3L3IA 4NSKA 4R7NB 4X4XB 1R5VB 1FNHA 1I3GL 3TNNB 3QUZD 3MNVA 3QUYA 3O81A 3HPLB 3MXVH 4G3YH 1CFQB 3OR7B 1GCFA 2UVFA 4YDJA 1OD7A 5EDXA 3E6HB 5C71A 2GY7B 5TF0A 3SDXE 4X6DB 1O7SA 2A83A 2DLFL 3ME0A 2BVPA 2G60L 3MOBH 4IRSA 5F1IB 5J13C 3N85L 5DJDA 4ZQKB 2L7JA 2R9HD 3HMXH 5LGKA 2VIRA 1G7IA 3VFOA 5EORH 4ZODA 4WI6A 1TFHA 4QYOA 1PZ5B 4P48A 4JREB 1MI5B 5EIVA 2O5ZL 1K6QH 2FATL 2GJ6B 2WV3A 3MLYH 4WIQA 4OZGB 3ZZ1A 1Z3GH 3P73A 1MVFA 1UWEH 1IEBB 4L8BB 1TVBB 1EBAA 1RJLA 2F8OA 4NQDE 2BNRD 1WFUA 2ZOKA 3QH3B 2R69L 5J1AB 2H2SC 4PB0H 4LMQI 3TT1H 4ZNEA 5ERWB 4R2GB 5GJTL 5LGJB 2BHZA 1RMFH 4J3WA 5E2TH 1MJ7H 4DZ8B 3GSWB 1OAZL 4HFUH 4JFOA 4LRNL 5D6CA 3HUJB 2F8XC 2X4OA 3WFEH 5DR5H 1J1PL 3WFBH 5TQ2H 3AREC 5ESVB 3SKJH 1LP9B 1EMTL 4WI5A 4JHBA 1BM3L 2DJ4A 2W07A 5DK2A 1KOAA 3KPPB 5IMOA 4QY8B 5IHUL 1OTUD 1ETZB 2WSKA 5I1LA 1IAKB 1C1EH 2NMSA 1MCEA 1E4KC 3S97C 4OD3L 2J8UE 2VLME 4UDTA 2GKIA 1K3IA 1U95A 1LE9A 1OGTA 3VXTB 2BY1A 3PWPE 5I1EH 3TNMA 4PJ8B 3VXNB 1JF1B 4WY7H 1OTSC 1X4YA 4JKKA 1ZANL 1IGIH 3GMNB 2FIRT 2X4TB 2IFGA 4D2NA 3FO9A 1OCWH 1XGQA 5DRXB 1I9IL 3BPOC 2X4NA 4LBEA 4OSUL 3RWFA 2DOCA 4Q58C 4Z95H 5HDOA 1YY8B 4OV5A 4APQD 4RFEB 5L2JA 5A2LH 1MRFH 2OR8A 4NGHL 2IPUG 1N6VA 4NKOA 2AJVL 1NC2D 4I9WE 1RUQH 4M7KL 1RPQA 1YY9C 4UOW1 4XVJL 3X3FH 5B8CA 5J6HB 3C6LD 4GBXB 1WISA 4XCNA 3TPUA 4L8DB 3C2AL 4LDLB 3VXSA 3WDJA 5ENWB 1QP1A 4YDKH 1OTSD 4PS4H 1GGBH 1LE5A 5HPOA 5IFHH 4WO4D 2Q86A 2YPKA 4YHIB 4ISVA 3JV4A 5FHAH 1MIEH 3L6FB 3TBVB 1SYSA 2YBRA 1U92A 1MNUL 5C07A 4GQ9H 4BZ2H 3RNQB 1P7HL 5DFVD 3R1GL 3QO1B 4I2XE 3HZVB 3RWHB 3RL1B 1IAII 4MXQD 1Q0XL 5BRZD 3KPOB 5KZCD 3GUTB 5ICZB 4GSDL 4NO0A 3ZO0A 2P5WB 3DTXB 5I1GL 5H35B 1M71A 3U30B 2GAZA 3TIEB 1NLDH 3T0EB 4KDTC 5D4QA 2F58L 4N0YL 4RISL 5DFVC 2VMFA 5E8EA 5JIKA 3BDXA 1QLRA 1ZA6B 4Y8DC 1MREL 1CFTA 4HIIA 2XICA 5HHQA 5IFJB 5DD0H 3MCKB 3A6OA 3TYFB 2FX8H 3QFJE 2YD6A 3BW9A 4AY0A 3VRIB 2CKBH 3WFCH 2O61A 3Q6FB 1SM3H 2Q87A 1FFPA 4S1QH 4D9LL 1LDPH 4RNRB 3S9DB 3HPJB 3OXRB 2NR6D 4EUPA 3EDKA 1IC7L 1Q94A 1DQMH 4QWWC 3RKDD 2VKXA 1A4JA 3BZ4A 4DVBA 4OZGF 3EYSL 4U1NB 2XTJD 1EO5A 4JY4B 3WUWA 4G80B 4M1DL 5KOVC 2A74B 1KTDA 4XMPL 2GSGA 1WTLA 2C3WA 5C0NC 2MOVA 1RZKL 4JG0H 2DKMA 2HLFC 3S96B 1RU9L 4FNLH 3TM6A 1ERNA 3WSQH 3DARA 4Z76A 3ULSB 4Z7QF 3D25B 4PJDE 4GKSB 1ZEAL 5D7IB 1F6AA 4LEOB 1F97A 4Z7OE 1V7NL 2CXKA 4XMLL 2Y5EA 4JFEA 2XWJA 4DGIH 3TA3A 5DMJB 4YQXL 1QFWH 2Y06H 1DN2A 4G9FE 2YPLB 4P0DA 3CPLB 4NN7C 3WNLA 4JZOA 2AI0L 4K3DH 1QQDA 3EFDL 1RZJC 1KJMB 3QEQD 2VDRH 1MI5E 1M05B 2VDKL 4PRIB 1CLCA 1KCUH 4JM4L 4OKVB 5CD5C 3QIBD 2NQCA 1YC8A 4RISH 1JPGA 5C07E 3JTTB 3O6FA 1U3HC 1CZ8H 1I1RA 2AKRA 5A3ID 4ZPTB 4OZGA 2MSPA 4PP1D 5DLML 2DQDL 3D9AL 4NQEE 3ZSSA 3BRDA 5A43C 5L8KB 4F58L 3KPSE 4PR5A 5ACLA 5D6CB 1TCRA 4R0LB 1V8HA 1MCOL 3H9SD 3QI9C 3V4VL 7FABL 1YN6B 5DZOA 4PRBB 1YC7A 1NMBL 1BMGA 5KSAA 4DZBA 4QCIB 1MWAL 2FR4B 4P5TB 4LMQE 2DQJH 4HK0B 1J5OH 1PKQE 1S9XA 4LVOB 2RAMA 4HDIB 1A6TA 4XNXH 4WI2A 1K3ZA 4PJ5B 4DEPC 2APBA 5SWZD 4NWTH 4P2RA 1X5ZA 3FONB 2M2DA 2VABB 4F7TB 5ESAA 2R2HA 4LFHG 1P7KA 4OZ4B 2WUCL 3ZKSD 4MQXD 3VXPA 2W0KA 1ZLSL 4YHNA 2PYED 4MX7A 3HG1E 3QI9D 5E5MB 2AK1H 3IDNA 3SKNB 3KYOA 4ONGH 5HYJA 4WHTA 1NANH 3CDGB 1HSAA 1VFBA 4DK3A 3RHWF 3W11D 1CLZH 4OLZL 2QBWA 4Z7UE 2BMKA 15C8L 3JUZA 1JUFA 2NY3B 4EN3C 3TN0D 1MIEL 4PD4J 2GITB 3AREA 5EUOB 4C4KO 4UILH 5I75B 2P45B 5GHWL 5ISZA 1OAYH 5J6HA 3ROOB 4GW1B 5DMGD 3S5LA 2VKWA 4X9HA 2E8ZA 3O6FD 3MCLL 1I7UB 3BAEH 1MWAB 1T6VN 1N8ZB 3MJ8A 3TCLB 5JMOC 2DMCA 1RZFL 1SYSB 2OI9B 3HLAA 5GS0L 4ZFOA 4KQ4L 2YPKB 5CAYB 1Q72L 3O4LB 3P4MB 2V7HB 3RZCB 1HKLH 5ESQA 1YYMH 5DEFB 4XNZB 4C56A 3H9SE 5C2BH 4RX4D 3AB0B 1QRKA 4MMZC 2R0WH 1U58B 1IT9H 3A6BH 5IW6A 1NMAH 3F12B 3L5XH 3H7BB 3D3VE 3KYMB 1UEYA 5TE7H 4B7IA 2I5YL 1AR1C 1TZGL 5CINL 1IGMH 1KC5L 2BP3A 5DHYA 4U6TA 3EUUA 1F02I 1IGJA 4P2OA 2APTA 2NXZC 5B8CC 2GJJA 3QUKB 1IC5H 4ODSH 4HV8A 5GSVB 4JDTH 3NH7L 3MRQB 5EUKB 2VJXA 4HWBH 4EBQH 1GH7A 1IEAB 4PGEB 4HS6B 5F97E 5EO9A 2R8SH 4HIIB 5E99H 1IAOB 1UXSB 3WKMH 1FFPB 3EJYD 4JHWL 4PJIB 1AHWC 5C0IA 3RGHA 5HVFB 4X7FC 1ZTXL 3ALXA 3VWJC 1EV2E 1L9MA 2DL2A 3TEUA 4IRJD 4U1HA 3L3GB 2IQ9L 5DYOA 3P4NB 4LU5L 5KSVB 1VKXB 5F7YC 3KJ6L 1YMMD 2BXZA 4ZD3L 2Y23A 3Q48A 3FB8B 3O8XD 2AJXH 4K9EC 5T1KD 5IEHB 4XP6H 2FWOA 4YUEL 4E9LA 2O5XH 3P9LB 2VC2H 3DBXB 3WUWB 5IIEA 5DJ6A 2D7TH 4H20H 2FBOJ 5BO1H 3OKMA 5C0EA 1L7IH 2NNAA 2VISA 1S7RA 4BSWB 1WF5A 2NY5H 32C2A 1CF8L 1E4WL 4C58B 4C56D 1AY1L 3MV7D 4ZOAA 1S7UB 2V2WB 2CLVA 1BM3H 5D7SH 2AW2A 2P1YA 3FQUA 4Z7UA 3E6FB 3JV6A 3VWKA 4XNQB 2VZ3A 4UDUB 2GSIB 4TVPH 5HHOE 1FORL 3ZKXB 2FL5A 1YJDL 1IGYB 2EYRA 4JY4A 3V7AE 5EORL 2E7CA 2RCSH 2RJMA 2GK0A 5MEND 4BSVA 2E7BA 4F7EB 5A40E 2VUYA 4RMQA 4Z7WB 4OKVA 2DLFH 3EGSA 1F11B 1UM4L 4TVSa 2I07A 4QHMA 4QEGA 2CSPA 3WN5C 5C0CB 4WI3A 5E7FA 4JFDD 2ZUQC 4HWBL 3CFJA 3IF1B 3JVGA 4PJBB 4FQIH 3BJLA 4ZPTA 1JGVH 2VQTA 1I3GH 1SJHA 4O00A 3WL9B 4FFZH 3ESUF 4K9EH 2EH8L 4ODTL 3GMOA 4P4KD 3QDMB 4O4YH 5T5NF 3WFHB 2X1WL 4Q0XL 3P4OB 1TVHA 4OGZA 4XAKD 2KPNA 3I6LD 4XBGA 1MCIA 4P2OC 2CD0A 3BPOB 4H8WL 5K9OB 1F58H 3DETC 1JWSA 1KJMA 3C6SA 2CRZA 4LSVH 1J0ZA 3BOVA 3EO1A 5C0DA 3RWGB 4L4VB 4KZEL 4DW2H 3LOWA 1MEXL 5EC2A 4X4YB 5HHVH 4J4PC 2MPAL 1BQHA 5MEQA 2F53D 4JREC 4ELMB 3WEXB 3AAZA 4F7TA 4H20L 3IETA 5K9JH 3DVIA 4G6KH 1INQB 1OLZA 1BZ9A 3W9DB 1HZHH 3S34L 3QDJD 2Y6SC 3LKOB 4RAUB 5FOJA 1OARH 4L3ED 2G60H 3MOBL 4W68A 3T1FB 5IVZA 2MQ0A 3BWAA 2WK2A 3I02A 3EZ8A 5IBTH 3ULUD 3QPXH 2DM4A 2F74B 5GGSB 3ARED 1KTRL 5BQ7B 5MP6H 5C8JA 4U1SB 1FCGA 2XPGB 5ISZD 3B2UC 4JFZL 4EBQL 5M94B 1DEDA 3I6GA 4MD5B 3QQ9C 1ND0A 2CQVA 3T0EE 3TC9A 2E9BA 3CH1A 2OTWB 3RVVD 4ZAKA 4J1UA 5MEPB 3WKML 5DJXB 1KCVH 4QRPE 5ID1A 4Z7VB 5IKCA 1RHHA 1RJLB 3UBXB 3RUGA 3TVMA 3O2WL 4IRSB 1Q9KA 1AD9B 2DF3A 1KCRH 5E56A 1BREA 2WMPA 3HLAB 2I25N 1FYTD 2NX5D 3SE9H 1TITA 5CEZL 1QLFA 4POUB 4KI5F 3KLAB 3ZE1E 4CN4A 1DE4B 4O9HL 4LDEB 5FXCH 1K9TA 4NQDD 3DX6A 4Y88A 4P57B 5FF6A 1UCBH 4Q9QL 5GGUA 5JO5B 1IAKA 4W4OC 5BZDB 2R39A 4PJCB 1YY9D 1DQTA 1G7QB 2F54E 3WHXA 4RBPH 2JB6B 1RFDL 2OLDA 5DDHA 1X5AA 3BQUA 4QRTA 3MRMB 2F58H 4PJFF 1U36A 1UCTA 1SVZA 4P46A 2L4OA 3VXRD 3V9FA 4KJQC 4XVUC 1X5KA 3OTTA 5DWUH 3RWIA 3PL6B 5F71A 1HSBA 4NQUA 5FCSH 5CZVL 3C08L 1DQDH 5DJZA 1EX0A 5D7LA 3SE8L 5JA9A 5KVEL 2H8PB 4G9FB 4J3SA 4QRQB 1KNOA 1G6RL 4LOUD 5IBUG 4PJIA 1LO0H 3LS4L 4FQXB 1G7LB 4NKIH 1UGNA 4DN4H 2HTKD 2CO6B 1UZ8A 4R96B 5IMLB 3BO8A 2EE3A 4TUOA 3IU4L 1U95B 5K9QI 2VUOA 1S9WA 3UZEA 4I0CC 1IM9D 5I1GH 2VDKH 5A2KH 1KJ2B 3K3QA 1AGCA 3QXUA 3M45A 4QRSB 1Q0XH 2OL3L 3CFKB 5GGUB 4A6YA 4O2CA 4IBLT 5D2NC 1O0VA 3MRGA 4JVPA 3SCMB 1SJVA 3NACH 3T4AB 3RPIB 4YHPA 3WHE1 3OXSB 1CGYA 2OL3B 4K3JH 3X17A 1XR9A 3D69A 4QXTB 2XXCB 3G5ZB 4IDJH 3Q0HA 4HK3N 4LARL 5ICXB 3ZT7A 1S78C 4TULH 1FNGA 1OAXH 3L9RB 1KENL 4I0PB 5HDQH 3ARDA 4M3JA 4YC2B 1S7SB 4ZUTA 2A73B 2LVCA 2NY6D 2P8PB 2R0KH 1SM3L 3S88H 3J8F7 3LEYL 2FGWH 2AV7B 3X3GH 5DMIL 1BJ1H 5LQBH 4NUGL 3ULVL 1M6OB 12E8H 1GGYA 1C12A 3GRWH 5GGVH 3JBG7 4XNQA 3ETBF 1XF2A 1SEBB 4F7CA 1E6JL 1YPZE 3RNKA 5HHXL 2GAZB 3TIEA 1INEL 1X5GA 4W6YB 4C59B 4F37F 1MF2L 2BY3A 3N0PB 2JF1A 2Y1VA 3C8KB 1N64H 1YNLL 5AYQA 3AS0A 1I8MB 3WFHA 2BNUB 4NC2B 3TBSA 3BH9B 4EDWH 5EU4A 1DUZA 4HZLA 1J1XH 4F7MB 3H9HA 4IOIA 3OG4B 1JPSH 5FYKL 1H3GA 1PYWB 4YBLB 5HI5C 4S1DD 3BESR 2ZCHH 4UTAH 1JHTB 3VGGA 1FFOA 4JPKL 3PP3H 2OL3H 5CKAA 3UAJD 5L2KD 1MHEB 3QIWC 5GRYA 1MFDH 1ZV5A 1L7TL 2GK2A 1INQA 2P5EA 4RX4A 4X5LA 4LIQE 1DCLA 4DVRL 1HKLL 4HIXL 4G8GA 1RUAL 1HDMB 4NQCE 5CINH 2IQAB 3UX9B 3SDCA 4PJCE 2NLJB 3IS0X 1FNSH 4Y2DD 1KT2A 3G6DH 3S36H 5HHMD 4N1HB 1P7QA 1CYGA 1NBYB 1CZ8L 4EQ3A 1FP5A 2BNQD 4HLZG 4MZ2A 1KB9J 2VDML 3MLSH 1S9YA 4WI4A 5GGQH 4P5TC 4U1JB 2QSVA 2BVYA 1DL7L 1I1YA 1T03H 3AU1A 3PNWB 1XT5A 3LEYH 1D5IH 5E8NA 3OKKB 1H5BC 1MCWM 4JZOB 3LPGA 5F7UA 1HYSD 2QSCL 1XF5A 3LKSA 4KJPC 1KN4L 5I18L 4HIHA 2IGFL 1ZEAH 5DD1H 1CL7L 4WFEE 1HHGA 2DLTA 2DQUL 2I26N 2ZSVA 3T65B 2QR0B 3QCUH 1C5BH 3GIZH 3BGMB 4G6JH 1X7QB 4GKZA 4NQED 5L9DH 3CAFA 4RFEA 4PJHA 4DUXA 1FIGH 5TE7L 3ZTNH 2A38A 4LLDB 4O58L 3RUGB 4K3JL 1GRWA 1B3JA 3MGTB 3JXAA 2OK0L 4XCYB 4DGVH 4PJGB 1GYAA 4NIKB 3EHBD 5I75C 3LQZB 4QHNB 1ZHLA 1DANT 2XT1B 1NMAL 4TYUA 1BP3B 4HWNA 1X44A 3KLAA 4K94C 2GTWB 2O5XL 4NZJA 4KK5D 1G0YR 3L6FA 1NGWB 3TBVA 2UZIL 1TZGH 5TGBB 3MCLH 4FFVC 4EI5D 5CP7B 1A7QH 3WXWH 2V9QA 1RZJH 1MFDL 3TO4D 1OSPH 1CFVL 3L5HA 4I18B 1ZANH 4ODHL 3BKJL 4ONHB 4Y16D 4OQTA 4KGJA 3IDYB 4U6VL 4OFDA 3S4SB 3OJVC 4F33A 5GS0H 7FABH 2O26U 2H26B 1ZTXH 4XNZC 5BJTB 5HHOB 3WDHA 1ZHKB 4QHKJ 1IM9A 3H0TA 3VD7A 5MENA 1BD2B 4GG8A 4HKJA 4PJAF 3DRTA 4O02H 3T08A 5DQJB 3HG1B 4XNXL 1I7TB 3CSPA 3V52H 3ARFA 1NLBL 4FS0A 3T0EA 1LNUB 4YIQA 1TENA 4WW1B 5D1XC 1IC4L 4X98B 4QRPA 1MI5A 3QA3B 1AGCB 4I3SL 2DQEL 3ARGA 1TVBA 4MAYC 5EU6B 2OR9H 2EXWC 1RJYA 2ZCKL 3B9KC 2G9HA 3P9MB 1CXFA 1FFRA 3V4PL 3BISA 2QLVB 1U8QB 5DZNA 3U0WL 3NGBC 3RWDA 2UV3A 4EUPB 3I2CH 5E1AA 3GSXA 3WIFB 2MPAH 4JO1H 2A6JA 4KK8D 4P2OB 1R3KB 1T22B 3H8NA 3SO3C 3ZKQD 5CP7A 1B9ZA 5IEKB 4LVNC 1EUTA 2XKUA 4M6NH 1RZGB 2YK1L 4OLXH 2VLKD 4PJDF 4Y4KC 2NW3A 5FECB 2R0LL 4HX1B 3BH8B 4NNPL 3AS1A 4L3EA 1DEEB 1FNLA 5BJTA 1S7SA 3CXHK 4WWID 4JO3H 5D71H 1A7PH 2VOTA 1CDIA 1MSPA 4H25A 4JR9L 4NP4H 1JGVL 3SE4C 5C09E 4HKBB 5E2VH 1W0WA 5D7IA 5DT1L 3WCYA 4Q0XH 1VA9A 3HG1A 1JI2A 4OZHF 1ZGLP 4H8WH 1WIOA 4LHJB 1S3KH 1TJHH 4F57L 1NGPL 3MLUH 4HUUA 4OF8A 4E41A 3VH8A 2W0FA 1DDHA 3KJ4C 2BSSA 4ETYA 1H3VA 5I1HH 2V9RA 5F7FA 3B3IA 5B3JE 3SGDH 3OAZK 4CNIA 3MLWH 4ACPA 4QXUL 5D5MF 4ZUWB 2IBZX 3DURA 2JJUA 3SKUD 4R9HA 2WBJD 1ACZA 1LO5B 3N1FC 1F4AA 2EYTB 5HHVL 5J9PB 3GBLA 2XWBA 3IVKB 3HB3C 1YJDC 4HHAB 1EJOL 4LCUB 1QZ1A 1X5HA 2EIBA 5ACZB 1T66C 3KNBA 2DDQH 4QXWA 1NC2A 5IR1B 1RZ7H 1ODAA 3DETD 2MCPL 4LLYA 5LCVH 1JTPA 2P8MA 1DUZB 1KELH 3GMMA 4HZLB 5I9QB 4P3DB 1P9MA 1WBYA 2FR4A 1CGUA 1JRHH 4P49A 5DRZB 3FN3A 4X6BB 5ETUB 1KCLA 4L4VE 5D6DC 4FQLL 1SQ2N 2N4IA 3DYPA 1C8PA 4NHUA 1MAKA 3GHEH 3EYFA 4WU7B 1I7ZA 2UZYB 1JNHB 3NIDF 2ICES 2NY2B 3RVTD 1HH6B 3LS4H 1NLBH 5A2JH 4N5EC 4XWGH 3KPQB 2XRAL 3ZTNL 5KVEH 5SX5K 4PRDB 4XRCA 2JJTC 4GJTB 3NCYP 3WUWG 3ARTA 3CFEB 4TSAL 4XNYL 2H6PA 3CLEH 1A6ZB 4RBPK 1HQRA 4NKIL 5A2IH 1UWXK 3L5WA 2OR9L 3QG6A 4FXGA 3MFFA 5F7DA 4R4BA 3OX8A 3MGAA 5J1AA 3DROA 5ITFB 1A6VH 2DLHA 1OSPL 4XNUH 3NZHH 2IC2A 3ET9F 3AU1B 4LLDA 1ZKAA 4N5ED 4PJBA 5FGCE 2L0DA 3TO2B 3P4OA 4DVBB 4XVTH 3QULA 3FO2B 3T0AA 3I3DA 2BERA 4HCRA 2Z92A 4ALAL 3SE8H 1UENA 2EDQA 4DQOL 4U0RC 2JB5L 2EDRA 5JUEH 5HI3C 3G5YA 2CK2A 4WJ5A 2NY4B 3SJVE 3SE9L 3VFVB 4QRRB 3WEXA 3T0BA 3O0RH 2QQKL 3QRGL 4KY1H 4P2CG 1QO3A 4TRPH 1BBDL 1QSVA 4K7PY 1XF1A 1PEWA 1DLFL 1EXUB 1VSCA 5E9DE 2Q8AH 1REIA 3UPAA 5KSUA 4E42B 3KHQA 2BVTA 4F15B 3EJZC 4UILL 3T0DA 5IVZB 1WFOA 3HE6D 4OI8A 4WGVB 2R23B 3CFCL 5E8DL 1AP2A 1GZQB 1XGTA 4U1MB 4IRZH 3X3FL 3FO9B 1EGJH 1CGSL 2WAHA 1S78D 1T7VA 2D0GA 4HPYH 4K3GA 1YA5A 2HKFL 4JFED 4L4TE 2UWEB 3P77B 3EYOA 2ZNXA 4XTRC 4NKOB 5CJ8A 5F96H 3IJSA 1UQSB 2FB4H 2GJZB 4MMXC 2VDOL 4EZMA 1C1EL 2XNAA 3IDJB 5E6ID 1ZLSH 3G6JE 4PG9A 3MRJB 2B1HL 4PRHA 1UM5H 4R90H 1XH3B 3LIZH 5DQJA 1CLYH 3FO2A 1KCVL 1NFDE 2VLKA 2DMKA 5T3XD 3HZYA 4GMSH 5ENWA 1BHGA 4M1GL 2CLZB 5C08A 1DSFL 4Y5VC 1NFDB 3DX6B 4YHZL 1XIWB 5AUMA 3NCYS 2ATPB 1I9IH 5DC4B 5DK0A 3CVIL 5I8EA 3GSRA 3VFSB 3ARFC 4UTAL 4M1CC 4Y8AA 4JCLA 3N1GC 4YBLC 5D7JA 4ZSOA 5JXEA 4KKBC 4UQ3A 5J57B 2EDOA 2OZ4A 4E41D 3MBED 4OI9A 5J1TC 3MOQA 3QIWB 2EKSB 1LO4L 3DUHA 1CGTA 4F9PA 1YNKL 4QXUH 4RMTA 2XXMB 3G5VA 3MBXL 1NDMA 3GJEA 3HR5B 2R29H 1WT5C 5F3HB 5BS0E 5I8KH 1BVZA 4D8PB 3U4EB 25C8H 1H3PH 3GSQA 1E6JH 3LZFH 4PREB 3KYKL 4HWBA 4QRSA 2E5EA 3M17A 5ANMA 3L3DB 1D9KB 2EDTA 4KMQA 3GIVB 1TETH 3PDDA 4OLUH 4ZUWA 4MNHA 1T20A 3LN5B 4KUCF 4ZOBA 2DLGA 3UC0H 3QIUD 1IKNC 1JPTH 2YUZA 4OBSA 1BGXL 1GL4B 2FBJH 5CD3B 1J8HB 1JTTA 4KFZC 4DVRH 3MOAL 4HIXH 5CWSB 4UV4H 1YNTB 3AGVA 1U8NB 3BP7A 4LHUA 4WW2F 3QJHA 5FCUH 1A3LL 3QO0B 5FIEA 1QA9A 1KENH 3KPSD 4ODVH 3BP4A 2OTUB 2QKIB 1B4RA 4N8PA 3C9NB 1E6OL 2G2RA 1GSMA 2DBJA 1KBGH 1DANU 4MB3A 5FV2A 4WHYG 4JQXA 5I1CL 4RWYL 1SMAA 1J1OL 5D93C 4M6AA 1JNHA 4NJ9H 4EDWL 4ELMA 4HWUA 1JRHI 4MD0A 2IQ9H 5B22A 5M7QA 1FZMB 4KTEL 1NCUA 1O5DT 2GIYA 1DQML 1KN2H 4WNQA 3IFLL 1WLHA 3ZE1F 2H2SD 5KAQF 1HCVA 4XX1G 1FNGB 1M7IA 3CX5J 5F1OB 3LKQB 1JWMA 3FO0L 4ODWB 2VZSA 5E4EB 3I3BA 2X05A 1BIIB 4LLQA 4ZNCD 4LRIC 3CCHB 1J11A 1U8KB 2MQCA 2Y7QA 3MYZA 1LWRA 3MFFB 3ARWA 4IOIB 4JRXD 5DO2D 4OUUA 2AQ1A 5MEOA 2DWDB 4Y4FB 1GGCL 5GGSY 3OAYK 2B1HH 1CTNA 2ESVD 4N0YH 4WU5A 4XH2A 4OAWA 2YMXL 4WW2B 1MI5D 2YWYA 4UZGA 2EC8A 3F7QA 5GQBA 2XZQH 1OT1A 5CJQH 3HZKA 1U8IB 4YGVA 4I4WB 5GGQL 4XWOD 3KPMA 4TRPL 5FYLE 1K8DA 2Z91A 5CIPB 5F3BB 1CFVH 1TJIL 4S10A 1D6EB 1VGKB 2CDGB 4Z0XA 4X4XA 2WZPD 2NY0B 3UROR 5DO2C 3FB6B 4MQXC 2HT3D 3HN3A 2PW2A 3D48R 3QUYB 5F72S 1HOCA 3RTQD 1G0XA 1YQVL 4BH8A 3OPZL 5B21A 2F15A 5H2BB 3KPTA 5D2LA 2VNCA 3H7LA 1OAQH 4S0SD 2EXWD 1G9EA 4LCWA 4LGPB 3IXTA 1HH9B 1RUPH 4NO5B 1JCKA 1SJXA 2ZCHL 3SO3B 2HH0L 3S3PA 4BUGA 5IJKC 3W9EB 4KK8C 4KHTL 2HT4C 5IM7B 2BMKB 4AENB 3GDBA 3WFDL 5DHVA 5CEYA 2X70A 3DHJA 3K2UH 1NAKH 3MNZA 1PKQA 4BSJA 3OV6A 2Y06L 4V2BA 1MCFA 1QKZL 5LJYH 5HGGS 4JFHD 1SJHB 3V0AC 3WL9A 1JF5A 4YDJB 5GZND 2FO4A 1L9NA 3QQ3B 1CVRA 3MROA 1YPZA 4FQ1H 4N8CL 2R0ZL 4HBCH 4OGAC 4AQ1B 3HUJF 3MLSL 3DO7B 4APQB 5GSRB 4JFDA 1XIWA 2VIRB 1N5YH 1P1ZA 5C08B 3C6LB 2IANB 2HJLB 4PJBF 3RZCA 4MSWA 3QCVH 4YWGL 3O11B 4LSPH 2V5SA 4MAYD 2X4SB 1FO0L 5DA0B 1WWAX 3KYNA 4H5SA 5HHPB 3KPRD 3L7EA 5AD0B 5IW6B 1MWAA 2JK5B 3HR6A 1UWXH 4PB0L 4JM2A 2X5PA 4XCYA 4YXHH 3QUXD 1G7HB 2P5EE 3ARQA 3L7FB 4J7RA 2BX5A 1Q8MA 5BRZB 1HI6B 1J5OL 3CFBB 3OAZH 3NCJL 4Z5RB 3QUMA 4CMMA 3GMPB 3NGBB 5JOEA 1CE6A 2V7HA 5I1HL 3T09A 1MPAL 5C9KA 3EJYC 4M93B 2Q20A 1CLOH 1IAMA 4OCSL 1DVFA 4GQPH 5GJTH 4CKVX 5CEZD 3UZVB 3MA7A 1IGFH 4IEFB 3ARGB 3DVNB 2J8OA 5IHUH 3V8CA 3GGWA 3MXVL 2ED8A 5INCA 4XI5C 1G1YA 3L3KB 1I9RH 3O6MH 3QHFL 3SE3C 5D1XD 4N0RA 3U4BH 2NY2C 1T80A 4Q2ZB 1RUKH 1IGJB 3EOBB 1CVSC 4P5KB 2VDNL 3C5JB 2MCG1 2BNRE 3EDFA 5DK3A 1ZA3A 4FQHA 4LRIA 1CS6A 3GFUA 5AZ2H 5BV7L 4FQ2H 2LTQB 5TE6H 4GRLA 4JDTL 2Z8SA 1FG9C 4G5ZH 5EBWA 2EDFA 4TVPL 4X5XB 5JIIA 1KLUB 2NX5A 3PWLB 4JN2B 1OWWA 2CLVB 5LCVL 4N1CA 4XZUB 4G8FA 2X89A 1LP9E 4KTYA 5TQ2L 4MAYA 3VJ6B 3MRLB 3QNXA 3QIBC 1BQLH 1MHEA 4M5YH 3VCLB 1S3KL 2VLJD 3SGEI 3GSXB 5SWQB 2YD8A 2EC9U 3P9WB 1MRFL 4MWFB 3CVHA 4I2XA 2JLLA 5JW4M 2EDYA 2AJXL 3SDCB 4L5FL 4GQ9L 1CFTB 3BQUD 1IVLA 5FUZL 4CVZA 1PFCA 1YEKL 2E6QA 4P4KC 5MERB 2B4CH 2I27N 2YPLD 3FQUB 4Z7UB 1IGIL 2R2BA 1VERA 4XVSH 4ZXBB 4KDVA 35C8L 3S37H 1OF2B 5IB5B 1BFOA 4GG6B 6FABL 3DNKA 5DUBB 1CDGA 1JGEA 3MV9B 3TV3L 3AFLA 1DDHB 5DD3H 5LVEA 2IH1A 4MJ4A 1EGJL 4JR9H 2R8SL 4FABL 2MHAA 3IKCA 4Y4HC 5I2IA 3RTQA 2Z91B 5CIPA 2R1WA 4X6CF 3VDBA 2NCMA 1NDGB 2F5AL 1JK8B 1VESA 3B43A 2QHRL 3O6LL 4ALAH 4Z7WF 3ULVF 5IB4B 1GGBL 3D39E 1NCDL 4QOKB 4DKDC 4GRLD 1ZT4B 4PBVC 5I1DB 3CVIH 5E94B 2X9YA 1QBMH 5DSCB 2ADJB 4HS8H 5FUOL 3D69B 1F2QA 1MHHA 3O9WB 1T83A 3GBNL 3MJ9A 2FD6L 3QQ9D 1DFBH 2IAMC 4Y19B 1DBJL 5CJOL 3LDBB 3JWDL 3HUJA 5CGYC 3MJ7A 3DUUA 4PLKC 2YD2A 2ZJSH 3C6SB 4I0PA 4J8RB 4PJ5D 1BBJA 3QXDB 3LB6C 5D1QC 1S7XB 1HYSC 4LSSL 4TTDD 2XPGA 3OZ9H 4WI8A 5TDPB 1FL5B 1MCPH 5E8DH 5B39G 4N1EA 1A6UL 3MNZB 2IGFH 3B5GA 2DKSA 3K8MA 1KPVA 4U0RB 3T2NH 2V2XB 4NBYB 1CGSH 2OSLB 1LQSR 4WY7L 4MDIB 1TTFA 4I48A 3QCUL 2BFVL 2HTKC 4JHWH 4GG6F 5IKCB 4NRYB 4QRPD 3MQIA 4U7SA 3WNKA 4HQQL 1OP3H 4DOHB 1LE9B 4I77L 1XF4A 1F5WA 1QD0A 5C0JA 5KSBB 4FXKB 3DXAA 3FRUB 3ZTJG 2XWJB 2NY3D 2X42A 4DJMA 1J88A 3L3HB 2AXJA 4Y5XA 4FFWD 1T7ZA 1ORSA 2ZPKH 3TA3D 3L3JB 4MXWL 1Y6MR 3VGFA 2EXYC 4XWGL 4H88L 4FQCL 1A6ZA 4FFVD 2KZ1B 4EI5C 1FFQA 5E8PB 3UTZA 3O8XA 4UIMA 1JNLH 5F9WB 3UYRL 1RZJL 1UB5A 1GGTA 1S7TB 4HKZA 4NC1C 2WIMA 4J3VA 3KPSA 4ZO6A 1MHHB 3F7PC 1UVQA 3TH2T 1KIRA 4LSVL 5SWSD 2JB6A 3E0GA 2ICEA 1G7PA 1BPVA 4K7FB 1BEYH 1IM3B 2HRPH 5F93C 5KTEL 3QULB 1AKJA 2B0SL 4KZEH 4ZYKA 3B5HA 1K4CB 1RU9H 2Q7YB 2DQUH 3IFPB 4IRJC 1E27B 2IF7A 4NOFA 3T2QA 5CEXA 4ZO9A 4XBEL 4DWHA 3FFCD 1F4YL 5FO7A 3MUZ1 3DI3B 4F58H 4HX1A 4OZIE 1L0QA 2AV1A 1CD1B 5T1MA 4XPFH 1PSKL 3QDGD 3VFGL 3FCTB 1QFOA 2VR9A 4YFDB 1YEEH 4PJAA 2Q6WA 2SEBB 5EZIH 5IVOA 4X6DA 4RGOL 1DP0A 4S2SB 2YSSB 1P7QD 1A3LH 2GT9A 4OM0H 3RX5A 2PTVA 2BNQA 3NFNB 1HHHB 1MVUB 4FFZL 3HE7D 4YQXH 5LXGL 1WTGT 5KVGH 1RUML 3VGAC 3PWPB 4P5KA 2HFEB 3KWWB 5I6XC 1Y18A 3B9KB 4OCMC 1BZ7A 1T5XB 5EOTB 4P4KA 3X11A 2C7UB 2AJYL 1QSEA 2PCPB 1QLEH 1A1MA 3ZDZF 3B3IB 1KB5A 2A2QT 2R29L 4BYHA 2J8UF 3ZT6A 2F19L 3G6AA 2D7NA 4UQ3B 4O2CB 1MEXH 3LSOB 1YEGL 2DICA 2XNAB 3H7BA 3IDJA 3PUCA 4LCYA 5IW3A 4XXDB 5DLMH 3B8SA 5EOQH 5IGXH 1IM3A 3MBXH 1Q94B 1J1OH 2AXFB 4XMPH 3MV8B 1S5IL 4WTZG 1OAUH 3FL7A 4OUOA 1TJGH 4C56B 1JPTL 4NKMB 3F7YB 3GSRB 5IR1A 3S37L 4K7PH 3GRWL 1KIPA 3BGAA 3UJTL 2XZAL 1O7VA 5K9QG 2B1AH 3DV4B 4ZUVB 1HXYB 4QKXB 3X12B 1Z0NA 3D3VA 2BVEA 4JB9L 3HC0A 4R3SA 1U8PB 5IF0A 1RIUL 1GGUA 4HXAL 2Q6WB 2FBJL 3SDYH 1MCCA 4C55A 3PHOB 3TO4A 4I77H 3RAJL 3JZ7A 1DLHA 5DJYA 1TTGA 3UTTB 3MLVH 2WQRA 5DD5H 2IWGA 5C0AD 1U9KA 3RL2A 4RQQA 1U8HB 3C8KA 1UZ6F 3TBYA 3G5VB 2DJUA 2OS7A 1Z2KA 4OFPA 3TVMD 4Y5YC 5TH2A 3IRZA 4Y1AD 1NEZB 3G9VA 1LO3L 4NQVB 3WXVH 3W0WB 4PJFB 2FECL 3CX5K 2BNRB 5HGHA 1A7BA 1LO2H 1MHCA 1ZVYA 3CFEA 1GZPA 2D7OA 4R8WH 1P4BL 3TWCL 5MHSD 5FA3B 1AGEA 2Y9RT 3ILPA 5E8OA 1DZBA 3RVVC 2A6IB 3O4OC 4DTGL 1FO0H 4WVRA 3ZL4H 1LE5B 4PV8A 2H3NB 3ILQC 3O3BA 2DYPA 4WWKA 4XWOC 4NZRH 1U92B 3VXSD 4P3WA 3PGDB 3UYOD 4FQQB 4OIBA 1VGEH 1YYML 3NCEB 5IIEB 5DJ6B 3QEUA 3VXRA 5GJSH 1BBJB 2D0FA 1F11A 2HH0H 2WNGA 5DHVH 4ZSOE 4JM2D 5E08L 4Y16C 2B20A 5JXAH 2ADIA 3OKYA 3IDMA 1I1CA 2EE9A 5BXFA 3SGKA 3V4UL 2VXTH 1TLKA 4NKDB 4WCYL 3LAFA 1FIEA 4YK4B 3RJDA 3ILQD 3V6OA 1NAKL 4E42A 3IJYA 2BHUA 2DLIA 2DLEA 3QDMA 3IRPX 4KRPD 4NQXB 2V5MA 4K7PX 5BS0A 1KLGB 1N5AA 2ARJB 2E6PA 4PFEA 3RWCB 3GNML 3UPRA 4RZCB 2VR4A 1XCTB 4YO0B 1XMWA 2NYYD 3RIFF 2FEEI 3LMJL 5D96C 1X5JA 1NMCB 2XWTB 5GGRA 2JELH 3JTSB 2QR0A 3WKNA 1GAFL 3GHEL 4XHJC 1WWWX 4H1LG 2JB5H 3VFWB 3WJJC 4WO4B 1X9QA 4W4OA 4UT9L 3LRHA 4JPWL 4Y7MA 2A6IA 1A7QL 3WXWL 1M1SA 2FJHA 3MRNA 3VXOB 3FN9A 1VB9A 1IL1B 3JV5A 4DK6A 4HUNB 4F7PB 1R3JB 4WDIB 2E7MA 5FGSA 2Q8AL 1JZ4A 3MMEB 2IH3B 1L0YA 4G5ZL 3SDXF 3UJTH 4X4YA 1CDYA 1OAKH 3OSKA 3MLTB 4L8SC 1VFAB 5E00B 5CJQL 2D7TL 3VFSA 1ETZA 3HFML 2P24A 3MRDB 1MFBL 4XPTH 4Y4KA 3GIZL 4NJAH 1CQKA 1I8IA 4LVHC 3UDWC 2XN9E 3RA7L 3S4SA 3GSUB 3KYMA 1TNNA 1FNEA 1CK0H 1E4XH 1U0QA 1JHKL 4TPRH 4N8CH 4MNQD 4BELD 1HHJB 3HI5H 3BRGC 1Z6JT 4V1DD 1I9JH 4HMDA 4FHBD 4UUJA 1FZKB 3D87B 1RUKL 4D8PA 3STLA 5F7HA 1OAQL 4KQ3H 3STZB 4PGDB 4G9DA 4YAQB 4X99B 1IMHC 3FOLA 4F33B 3VA6A 4B41A 4EVNA 5HSFA 3R06A 2EH8H 3RUGE 1BJ1J 2D2OA 1GOGA 5J0BA 5C0IB 1MRCL 4OCSH 2XTJB 4Z9KB 3CFIC 1BD2A 1XIWC 2CDFB 1FG2A 4QOKE 3DMMB 1YDPA 5I1AB 3RWEA 3GK8H 4P99A 1Z9LA 2AQ2A 3O41B 5E95B 2ZZUT 1L7TH 3SCMD 4Y4HB 3GI9H 2Z8WC 3UPCA 1FVEA 4NP4L 1WFTA 1RUAH 2YBRB 4Z0BL 5K9JL 1N26A 5C0ND 1FYTA 2ZKHL 3MRDA 3BN9D 1BECA 3BIAX 4JG0L 4ONOA 1LP9F 1RJYB 4HUWA 4XP4L 5T3XL 4UTBH 3DV4A 1VACB 1LO3H 2BRRH 2XIDA 1D5MA 4HJ0C 4I3RL 3FQWB 4ZO7A 2VAAA 4I0PD 2PO6D 4OT1H 5GS3A 4MAUL 1R3IL 5IFAL 2APWA 1OQOA 4UOJA 3MUHL 4X7SH 4H1LB 3QEQB 2NY6B 5DJYB 1UM4H 1BVLB 3PGFL 3PHSA 5CP3H 5AZ2L 1ED3A 1FPTH 3QI9A 3GMRA 4YX2H 3LMJH 2OYPA 1CIUA 2YRZA 3RWHA 4Q6IC 3NCMA 3HC4L 4K3EL 2D7MA 4ZUVA 3QISA 4WEMB 1F90L 2GITA 3ZDYE 4FOMA 4LGRB 1KJVB 5FOBB 1K8IB 3D85D 3FFDB 3LKPB 2G75B 3HB3D 4LAQL 4L5FH 1QUNA 1P4IL 1S8DB 4O5LL 4Q9CA 2DQIL 2CDFA 4PV9A 5CZVH 4CMHC 4MA7H 1I1FB 2AEPH 1MLCA 5IBLD 4XGZB 3BZ4B 1FE8H 5JXAL 3ARBB 1IFHH 3MR9A 5ID0B 3HNVL 1Y6KR 2DYPB 4WWKB 4ORGB 1OOAA 3IDUA 3LHPL 3X14A 4ETQA 2HRPL 2B5IC 4KHXL 4X6BA 4GKNA 4JFQA 3BW9B 1KTDB 3FB6A 4G8FB 3RA7H 1LGVA 3QEUB 3BKJH 2OL3A 1AQKH 4XPHL 1T1ZA 4L3EE 4L29A 2EEBA 2EICA 4HQQH 2ADIB 1AFVL 3HI1B 2F5AH 2VDPL 2VDQL 3MJ9H 4S0TD 2B0SH 3D2UB 1CWVA 2JTDA 3H3BC 1CG9A 5HHMB 1GAFH 4F7CB 1T7YA 3BWAB 5DJ8B 2VAJA 4JPIA 1NEUA 2YPLE 4JRYB 5EZOL 5C0FA 1EHXA 5ICXA 2D03L 3FTGB 4QHUA 5INDB 1NFKA 5T1LA 4PYHA 1N0XH 4ZOCA 4M7JH 3W0WE 4Y4FC 1UXWB 3VU2A 3EHBC 1RI8A 3QDGA 2ARJA 3DX7B 3C08H 1MLBB 1PAMA 3GSVB 2IPKA 2AEIT 1NCDH 4HS3A 3JTTA 3O6FB 5CJOH 2VLRA 4ZUTB 4NO2A 1K8IA 3O45A 1WBXA 2AEWA 3G9AB 4JKLA 3QG6B 2ZPKL 5D1ZD 1G9ML 4MVBD 4UI2A 2E6JA 4KTEH 5MHSE 3SOBL 3FAWA 2D7PA 1H3WM 1HWGB 2NXZB 1Q9LA 2WWKO 3GHBL 5C9JB 3RZCD 5C3LD 4GXVH 4P4RB 3PWNB 3P3YA 2DIBA 3OGCB 3CFDB 1YPZB 1YEKH 5HVGB 1JIBA 3BEVA 1HE7A 1FZOB 1NGXB 3P11L 4G8GB 2IANE 1FGNL 2IH1B 4OIIH 3T1WA 4PGCA 3O2VH 2QQNL 3Q6GH 3ZTJH 3S3JA 4P9HH 1S9XB 4FXGB 2OQJB 4GAFB 5IVXF 4YH6A 3BKML 2A77H 4TQEH 3R1GH 5AYUH 5IGXL 1S9KC 2YMXH 3CDCA 4EI5B 3TO2A 5FK9A 2R2HB 1TCRB 3B9DA 4R0LA 1KIQB 2F54A 2XQBL 1DBAH 4LF3A 5INDA 4U7KA 5FYKH 4Y19A 3HZMB 2QQQA 4PJEB 2ZUTA 3JUYA 2EO1A 3LKQA 4HS8L 3O6KL 3HC4H 2FO1A 2ADFH 4CJ0A 5HGBB 3RY6C 3K1KC 1ORSB 1XGTB 3P30H 2V2TB 1HIML 1QFPA 5K59E 4NRZB 3DGGB 4N90E 1NANI 1QO3B 5HHXH 1S9VB 3LS5H 4ZFFA 1TMCB 4PJ9A 4LPTA 4O5LH 4WUUD 2R9HC 3OR7A 1YMMB 5C0JB 3PQYE 4EUPG 1TZHB 3RJQB 2C1PB 3BO8B 4NRYA 4NCC1 4FQJH 3HZKB 3UDWA 1UFUA 4IIQC 5FFLA 1CXHA 1FG2B 3BEVB 4PJEF 2MNUA 5CSZA 4UB0H 3FT4B 3O8XC 4MYWB 2VWEE 2BOCB 1NGYA 1X5IA 3QUXC 4JFYB 4BFEA 1KJ2A 2ESVA 3TLRA 2DQFA 1HHGB 1IEBA 3BPCB 2X1OA 5J56B 3Q5OA 1OAUL 5DEFA 1RIUH 4WTXA 3IJSB 3NZ8B 4K7PL 2H26A 4P2OD 2FJFA 3B6SA 1EO8L 4XZUA 5DUML 5F7EH 4Z7UF 1P5VA 2VXSH 1J9CT 3ORJA 4M61B 5HPMB 5GXBB 5JR1H 4YEEA 2EE2A 3MJ8B 2EC9T 5LGJA 2DL9A 1QRNE 2VLKB 1Z0MA 1CI5A 1CCZA 3KXFB 1V3KA 5I76B 1KB5L 2ICEB 2FSEA 3MUGB 5EBMB 1TETL 3W81A 2PYEE 2VLKE 2RBLA 1K4CA 1A2YB 2C3VB 3MV7E 3EJJX 5EOQL 3B9KA 4HF5H 4E5XA 4HG4K 4JQVA 4X6DE 4M6ML 1C16B 1AD0A 1MJJA 3MNWB 1WGOA 2CLRA 1U58A 3OKOB 3MOAH 2F19H 4UNTA 1KXQE 3RDTB 5I8CB 3E2HB 3MV01 5EU6A 3BP5A 1J10A 5TE6L 2ADFL 4MD4A 4UV7L 5E24E 1KCUL 4JM4H 4JRXE 4PJAB 2XG5A 1N64L 1Q9KB 1Z5LB 4FN0A 2X4TA 4BZYA 3LS5L 2QADB 4U1HB 1FH5H 3F7VA 4U6VH 4R0LC 2W9EH 4AEIH 1G6RA 3D0VB 4ZFGH 4ETQB 4M62H 4NKMA 1MFEH 1IGTB 4OGYL 4NJ9L 1U3ZA 3ROLB 3MRFB 1R24A 3GEWB 1NMCC 5EU4B 4OB5H 1IEAA 1KEGH 1NBVL 2J4WL 4Y19E 3V7MA 3QDJB 3RX7A 5FOBA 3EO0B 4LVOC 4RGNB 3PHQA 4XXDA 4QOKA 1N7MH 2OX5A 3L7EB 1CXEA 5AD0A 3UBXG 1EEYA 3LSOA 3WIFA 1U6AL 1BQSA 1T1XA 1JMZA 2RFXB 4PJGF 1H3TA 3DSNA 4O2EA 5GRWA 4P3CH 4CN6A 5I1IH 3PV7A 1H15B 5EUOF 2D4FA 5F88A 3OKEA 3EW3B 2C4XA 1EJ6A 2HJFA 3A67H 2YA0A 5F9OH 1UXWA 4X9FA 4KKAC 2NY1B 3SDXB 3FKUS 5D1ZA 3FTGA 5FM5M 4LLQB 1CD0A 1ZLUK 1RSFA 5DTFB 5C0AE 1BOGA 3QO1A 4U1LA 3MA7B 4ONGL 3OF6D 4Y89A 2OJZL 4YPJA 2BY2A 2ESVE 2O61B 1FL6A 4N0UE 1I3RB 5I73B 5K9KA 4J3OC 3RGVC 1FNFA 2A6KA 1FSKC 3IF1A 5CJBA 1FLRL 4UOW0 3PL6C 3MREB 5DFWH 5E70A 1Z9OA 2A83B 4GLRI 5C9JA 3S4SG 1VEOA 5F3BA 1G9NH 2OI9C 3FZUC 1UYWH 2ILLA 1A7PL 4I4WA 1JPFA 1D6EA 4LLWA 4RA0C 1UH4A 4JY5H 2K9UA 3FO0H 3DJ9A 4L3CA 1ZXQA 2GSGB 1DBJH 4NPYB 4NO2B 5DHXB 3QDJA 1PG7H 2FYYB 1C5DB 1C08A 5MEQB 2DWDA 4Y4FA 2X4PB 1MCBA 4QRUA 3CFJB 2A1WH 5BXFB 4OAWB 3VE0A 1BFTA 4NM4L 3UCRA 1HH9A 3IETB 3VXRE 1KG0A 1P4BH 3WBDA 1K2DA 5KVMC 4UTBL 5J6GB 1IKFH 4RGMC 1WSST 3NMEA 5E6IC 1Q9OA 2AJZA 2BSTB 4RWYH 3BGFC 4Y16A 4D9QD 4UQ2A 1SJEB 5CMAA 2X40A 3NIDE 4NN6B 3ALWA 1EGJA 4AG4L 1SYVA 2X4RA 4X6DF 1TNMA 1JZ2A 4UB0L 2YD7A 4JG1L 3TA3C 3ARDD 3TT3H 4JZJA 3FN0L 3U0TA 3LEVH 3LKNB 3KLSA 4WV1C 2UUDH 3ARFD 4ZFFB 5HI4D 3VWJB 3H9YA 1JZ3A 2NY6C 1J1PH 3JWDH 3TESA 4G8EB 4KV5F 1I1AB 4LLUA 4OZFG 3BHBB 2CR3A 2F74A 1F6FB 3UEZA 1MHPH 3NFNA 4X7CC 1GOFA 4YC2C 5CBAB 1JPFB 1KLGA 4K3EH 4WCYH 1U2HA 1T4KB 1DR9A 5I1KH 1KUMA 1U8OA 4HMEA 3WJJA 2IH3A 1GGCH 4RCAA 5HJ3A 4CW1A 5J89A 5H37H 3OX8B 3BJ91 1DE4A 3SKMA 4HULB 1VFAA 4WO4A 1A1MB 3SKOB 3W39A 3CU1A 2ZUSA 4UU9A 2X4PA 4NFDA 4FZ8L 1JGLL 1YUHB 5C07D 1CXLA 1IGML 2ZKHH 3GZKA 1YQ2A 1R3JA 1DQJB 4G7VL 2VXVH 3HMXL 4OCWL 3MRRB 4LHUG 2VO5A 2W1NA 4ONFH 1GXEA 4U4BA 1IE5A 4DZBB 3IDNB 5I71B 3KXFA 4TTGA 2I9TB 4P46B 1RJZB 5EOCL 5E00A 3CFBA 3QIWD 5ADOH 1JZ7A 3GK8L 4P57A 3NFPA 4OCRH 3VI3F 2IBGA 4U1JA 2R0KL 4MNQE 2WWKT 3MLYL 4LSPL 3HC0B 3NAAL 4R3SB 4M62L 4OD1H 1A9EB 4QNPF 2AJYH 1F4XL 4S11A 3BX7C 3W11C 5INCB 1A47A 2EDJA 2OCFD 3QG7H 5FYJE 5C0RL 3BDBA 3RWEB 1D5XB 2J88L 1W0YT 4AH2A 1D5ZA 4EIZC 5J06A 1IGTA 2X6MA 3EFFB 3O4LA 1EEZA 1F4YH 2HG5A 3VFTB 1AD0B 1MPAH 3QZWB 2YEZB 3O6FC 1CF8H 1E4WH 1CDHA 3OMZA 1KTKE 5A2FA 2GFBA 1EFXA 3QPQC 3C60C 3AXLA 1A7OL 4LKXA 2R4RL 4KJWD 4P9HL 3VMPA 3D39D 2VLJE 2YA2A 3WLBB 5IBUB 4TQEL 1AQKL 4XPHH 4OIIL 5DJCB 3P4MA 3BT2H 3EZJB 4Z7VF 3QFJA 2VDNH 3S3SA 1GGIL 4LASH 3Q6GL 5DD0L 3O3DA 4QXGL 1EPFA 4ZSOB 2E9WA 4NN7B 3H9SB 4AMKL 1H3UA 4ZD3H 3GKZA 2H9GA 3PWJA 2E7LC 4EN3D 2XN9A 4PRPD 4P2QB 4HUWB 4P5TD 2VC2L 1UJ3C 4ZTOL 2AEPL 3QNXB 1W0VB 1B0GB 3QXTA 2HT3C 4O2EB 4XP9H 2EDXA 3WO3B 2E3VA 2YHGA 3B5TA 2UWEF 1PG7L 3WYRA 3QUKA 1FGNH 1A22B 3B9EA 3FAXA 3ZYJA 1L0XA 3GI8L 4YIQB 5KS9E 4MJ2A 4I18C 4HBCL 1HYRC 1QHOA 4NQEB 4UINH 4ELKA 2MTPA 4LBEB 4Y4FD 3U2SB 1ED3B 2XY2A 3QI9B 4EEEA 2A9ML 3ZHDA 5C0GA 5L8LB 3VXMA 1CICA 3EOAB 4NOBA 1F4WL 2EYSB 2XKNA 2X44D 5MERA 1HQ4A 4XVTL 4XPGL 1INDL 4MQSB 5CZKA 2J6EA 2HVKB 3BYTA 3ZMRA 4L29B 2VDQH 1KIUA 2A0LD 1KB9K 1S8DA 2OK0H 2XQBH 3QQ4A 3LB6D 5D1QD 5E2WH 4D0BA 2ADJA 1AR1D 2VITA 4Q97A 1AXSA 4NQDA 3LIZL 3EKCA 3VI4E 4JRYA 5JHDE 4LAJH 4LIQH 3HC3L 4N9OB 4NQCA 1EHLL 1T04B 3VFUA 5D5MB 4DFHA 5JW4N 1NCWH 3DUUB 1BBDH 5HHOD 2DD8H 32C2B 3MNVB 1HK6A 3PWUA 2VB5A 4PJDA 4BFIB 3CSBA 3AC0A 4M5YL 1F58L 3ECBB 5BVJA 1NBZA 1P5UA 4JE4B 3PHOA 3SOBH 5DSCA 1FBIH 5EH1A 5ABDE 5FB8B 1EEUA 4KHXH 4DOHE 2JELL 1W2KT 4OZHB 3OB0H 1A4KB 2CR6A 4CGTA 3LN4B 4KK6D 4HK3J 5E9DA 1CIDA 2XZCL 4Q9RH 1XF4B 1KN2L 3W5NA 2BVQA 2NLJA 4KAQH <