2I29A

Crystal structure of nad kinase 1 from listeria monocytogenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
263
structure length
255
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transferase
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
total genus 66
structure length 255
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 2i29A02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 2i29A01
5EJFA 5DHSA 3V8PA 2I2AA 3VZDA 4V24A 3VZBA 5DHPA 2JGRA 3T5PA 1U0TA 3V8MA 3V7UA 3V80A 1SUWA 4WERA 2QV7A 4DY6A 1Z0UA 1YT5A 2I2DA 3V8QA 2I1WA 1Z0ZA 2P1RA 5DHUA 5EJHA 1Y3IA 2I2CA 3V7YA 2I2BA 1Y3HA 2QVLA 3S40A 1U0RA 3AFOA 5EJIA 4WRRA 3VZCA 2I29A 5DHQA 3V8RA 3PFNA 5EJGA 2I2FA 5DHTA 4L02A 1Z0SA 2Q5FA 3V8NA 5DHRA 4HAOA 2AN1A 3V7WA 2BONA
chains in the Genus database with same CATH superfamily
1RBYA 3MNFA 1PG2A 3WWPA 1MVNA 3M34A 1VB3A 1KAGA 3RVLA 3GJ8A 3MGKA 2QM0A 1UEJA 1OILA 2ODWA 3IKVA 2X8BA 1DFHA 1WXHA 4BWYA 3AB8A 5U1PA 1NW4A 2W8BA 4Y7CA 3AJEA 3TPZA 2PH5A 2PL9A 1NM5C 4O4JF 5CT9A 4EKNB 3LKBA 3KXPA 1R4MB 2JCYA 4MJLA 1R8SA 5DRTA 3OEYA 4LYDA 4U39A 3RFTA 3JARB 3BE8A 3NRCA 2VUSA 1E9SA 3GRVA 1EFPB 4AZ3B 1Q1QA 2XXSA 5IBCA 2KS6A 4X6YA 5ARBA 1WB4A 1U80A 5P21A 3R7SA 2DY0A 3ILYA 4KPGA 4FINA 3DMTC 4HAOA 4CKCB 4JP8A 3JWIA 4AYXA 4DHEA 1GTZA 1D7AA 1YK1A 4I55F 5JBQA 5CEEA 3PD0A 4XPIA 3A9UA 4YQYA 1BS2A 1PZMA 1P3JA 1QHGA 5AOBA 3P9QA 4EAQA 3UMZA 2DR0A 1MJGM 1GGKA 3UJ8A 3F73A 2OFPA 4MARA 2EX4A 4PRKA 5EMMA 1YMUA 2GWHA 2VP0A 3FDJA 2VN8A 1IQ0A 2AGVA 2D1QA 1U7DA 2EEZA 1DBPA 4JJEA 5M29A 3U3RA 4AJKA 4EHIA 3EB9A 1P4AA 5PNTA 4C9BA 1AJEA 5IJ9A 2ILVA 3MCAA 4FSXA 2XHEA 1XPRA 4JP5A 1MR3F 3AW8A 4UNPA 3UWOA 4B31A 4CF5A 4UUNA 3KUXA 2Z9BA 1BQ4A 1UP6A 2F00A 3CUTA 2OQIA 2X7XA 3E84A 3G6KA 3DZHA 3BZWA 3BJRA 3A6HA 4JT9A 4A0FA 2RHCA 5JEKA 5BSEA 3P4XA 1V6AA 1NZJA 1RWBA 2Y9MB 4MUYA 2DBRA 3JZFA 1VJCA 2QSUA 4JI4B 3AF1A 1JEYB 3UC5A 1N0VC 4NFLA 5E6RB 3TD9A 4OFXA 2C9ZA 1DEXA 3OCJA 4MJ3A 5HKOA 4GM1A 3SHFA 1CUEA 3OETA 2NTVA 2PPVA 4YXWD 1QUEA 1GSAA 4RIGA 3I6WA 2P27A 3JWEA 4NMMA 2FWPA 2P41A 2DKOA 1GIAA 2P90A 4PAOA 4RK5A 3WRXA 2MYNA 4UVIA 3GZNB 4W1RA 1XPOA 2CXXA 1OUMA 5BRNA 1RXIA 1IM8A 1XAHA 2IIBA 4O8ZA 1ZN7A 1K8XB 3ELSA 2EEPA 3ECAA 4X3CA 4XB6B 3BMCB 3O4JA 3TNYA 2PMWB 4C7OB 4CKBA 3DDUA 2Y93A 2YZNA 1USGA 2CMHA 1UBEA 2FDRA 5F1YA 4U2EA 3BL5A 5TDHA 4S1OA 3PUYA 1G7TA 1F2UB 4HN4B 3CLVA 3VSAA 1UC4B 4FDAA 3CNOA 3ICWA 1P45A 1X1EA 2DC1A 2OLKA 1Y37A 4HD8A 4I5GA 4PF1A 3TQHA 4M83A 1C0LA 4KK4A 2IHTA 2NZYA 1RPZA 4IH1A 4MQEB 1L7BA 2O8VA 2WF9A 3I1FA 1YCGA 2V0GA 4UMDA 1CE8B 1KZ6A 1H4VB 2JFBA 2RFLA 3RASA 3ZU4A 5I7FA 1DSSG 2AN4A 2EBUA 3FPCA 1DUSA 4O4LF 2B4QA 2Y27A 4URFA 4MIOA 3AIIA 1DJNA 4IM7A 3UT6A 4DV6B 2CLSA 4I1IA 4IDHA 4F4IA 4I2NA 4ALLA 3ESYA 2NU8A 3ZLJA 3SICE 1QF7A 2X5KO 4HR7A 1FYWA 1OGIA 3RIYA 5IHXA 4CU5A 5C80A 1HV8A 4R9PA 1BC5A 2MR5A 1NW5A 1N5OX 2ZS9A 2PEZA 1GSOA 2IC5A 2XMGA 4PLCA 2YJ6A 5FOWA 2JKYA 5DYNA 5F7OA 3S3TA 1NF9A 4ZXFA 1G41A 3M6IA 1I4DD 3S8YA 2QUHA 2P3SA 2AD5A 4LBVA 4M7WA 4TGLA 5C35A 1RHKA 1QQ6A 2XUFA 5KSPA 3KWMA 2LPMA 3ORFA 4ALIA 3ONDA 3OJCA 3O8LA 4MUXA 2HPZA 3QMWA 3BH0A 4FZ3A 2UZ4A 4UEWA 4B3CA 2H7YA 2OD9A 3C97A 1VJ5A 1I4TD 4PICA 3WK5A 1YOVB 3VU0A 1FXUA 4ZT3A 4XYLA 7GPBA 3P2IA 3IB6A 1HZZA 2WG1A 5ED0A 2D5AA 2G40A 5A62A 4RFSB 4FFSA 1GXSA 5AO9A 3SQWA 1TJYA 4MP8A 1U2DA 3M2TA 4UE6A 3ADBA 3GP8A 2IIPA 4AU1A 2BOVA 2REOA 1H9BA 3KE9A 2VDOB 4M53A 2KB3A 4GGPA 1XRMA 1P2FA 3FDZB 4D9JA 2PO7A 2I2XB 3HL4A 5K0GA 1P1HA 4HVLA 2RGNC 2YN4A 2WMDA 1YHYA 4CF6A 2QTVA 2B2CA 1VLMA 2JNWA 3DKIA 4QYTA 5HQTA 1KTIA 1K7SN 2ZRMA 4AY3A 5AKXA 1CNEA 3EGDA 1WETA 1SKMA 4B7UA 4D8VA 2K6GA 3RUCA 4D57A 3ZLBA 1T2DA 5BOVA 2Y66A 3C8MA 4HCJA 3UXEA 1G7RA 1UZAA 1WXEA 3WGJA 1RXEA 4EMTA 1S0UA 1M6VA 3FHCB 1Z0FA 3RC3A 2B98A 4EA9A 5AW1A 1L5MA 1N1DA 2AMFA 1NIJA 3QV1A 4L9AA 4TRJA 4BNTA 1E1NA 4B44A 4MQMA 3B7PA 4P08A 1VSQA 1XEXA 4R9UC 3G9XA 5J2UB 4ZGGA 1M3SA 2ZCVA 3R7AA 1K0FA 3CIFA 2ADFA 1M1YE 5CG1A 1JHRA 3LRPA 4RK7A 2ZJ8A 4CNQA 1ECGA 1X15A 2BE7A 2K2WA 2QN9A 2X5XA 3FZQA 2VQEB 3R76A 1ZA1A 5CPFA 4JUAA 3H9GA 4LXQA 5E3JA 1WAMA 5E7IA 2E21A 1A96A 1GPUA 3MT9A 4TKVA 5H7XA 1T25A 4YRAA 2IOQA 2ZROA 3FNGA 3QI7A 3PYXA 3W90A 1EA5A 1KQOA 1KMCA 3K5WA 3L1UA 1K6JA 3D9QX 3RAGA 4RD1A 3I05A 3AOEA 1GR0A 4LY6A 3L9WA 5EHZA 3EZXA 3EIFA 2P75A 4M99A 1EQAA 3MYRA 1OJLA 5L3SB 2JJ2A 5DHAA 3QUCA 4BQIA 1HDEA 3TSOA 1XRQA 1U0LA 2FPKA 2Y1LA 1L5LA 1Y1LA 2GK7A 4O02B 4B81A 2V1UA 2X1HA 2AEEA 2ZUEA 1C30A 2ZXUA 4KRGA 2YIJA 3DE7X 1NDQA 2ES4A 4KN5A 2ZZMA 1NMYA 4PYKA 2PANA 2JGLA 1P74A 2FZCA 3V80A 1YR9A 1ZKMA 2AVNA 2CGEA 3KPVA 1ETHA 3KZ1E 4TYMA 1QG2A 5H0IA 5H02A 4RLFA 4E30A 5C8YB 1KAOA 1N4AA 1X7ZA 2EKPA 2CB9A 3BXGA 4N0DA 3GCDA 5EXXA 4NH4A 1TKCA 1A9PA 1WHTB 1ZNZA 2CLHB 2GFQA 4O4JB 5CDSA 2B30A 4BMCA 4HS9A 2QZPA 4HFMA 4DR1B 2R62A 5DGIA 4Z0NA 5AW4A 5FBHA 4PZYA 5EKTA 1ANKA 3IMCA 4M37A 2A7XA 1A4XA 5CT6A 4YT5A 4HEJA 3SM9A 2DUWA 3CNQS 5IVDA 5AW8A 4DIDA 3IQWA 3V4RA 3NHLA 3GDGA 1E9RA 1H85A 4HLNA 3ZKWA 4RKEA 4C7BA 4F5YA 4L8FA 4X61A 3RG2A 3RCBA 1J0DA 3NHSA 1UQUA 4LOLA 4JVLA 4B7ZA 1PWXA 2BRUA 2Y1KA 2C57A 3VKUA 2QE6A 3AF6A 1EGHA 2CZCA 4Y9RA 3NAQA 1SXJD 3REFA 1LBEA 5A9RA 1J5PA 1ODCA 3IJ5A 3ZNPA 2C9OA 2UZ1A 3SZOA 1M1ZA 3WY9A 1I1OA 2YWJA 5ILQA 1KMIY 4DMMA 3N0RA 1RYNA 2JZNA 4PNZA 2XUPA 4C4RA 4IF6A 4XJSA 1NUQA 3GFPA 4IKEA 4JEMA 1SQ0A 5EMKA 5KNBD 2XDYA 3GLFA 4FFVA 2H0QA 3IP8A 1BQEA 3PQ8A 3U4DA 2ZGVA 3KFVA 3O3CA 2BSQA 1E94E 4TVBA 4V0OA 3D6UA 3SLGA 1DCFA 2OOSA 4FXPA 5AJZA 4DCUA 4EVQA 5BNWA 5KMGB 2J9FA 3GGOA 4FC7A 3ZQUA 4QT4A 1EEXB 2WVGA 5TMBA 1OLSA 2DU8A 5B1SA 2ZJ3A 3EXIA 4X93A 3JRXA 4ENTA 3UB4A 1IE3A 2HADA 2PNJA 3D02A 4EKIA 3KX2A 4IVRA 1YFLA 2KWIA 3GCGA 3EJ6A 4FZJA 5GTDA 1CUBA 1P60A 1J7JA 4DC0A 5ITWA 3EGOA 2AR7A 3T8YA 3U7FB 3GQBA 4R1SA 3QTLA 4O3FA 3O74A 2HA2A 1TC2A 1XP8A 1CJVC 1Y1SA 3A0UA 3NIWA 4WNYA 1FLAA 4BN4A 1X2BA 2WABA 5HZMA 1L1FA 2PWZA 1TYAE 4UCWA 4QL3A 4B6FA 3GT7A 1BOOA 5H81A 3QJ5A 3NIDB 5BMVA 3LT2A 2QHXA 1T6YA 5CIQA 2R5WA 4TT3D 5J43A 1FP6A 4PYIA 1PVOA 2MYUA 2JHCA 4P6VF 2HR1A 2OKCA 5EMHA 1E0DA 1E2NA 4H1UA 3RE1A 4EHNA 3EDOA 5GMOA 4TKUA 3RBAA 1WCV1 3NNNA 2HSEA 4F2WA 1UHTA 2F1JA 2H5EA 4JIVD 3DL7A 4I9FA 2QRUA 3C3BA 1JBEA 5JELA 2WJGA 3KJQA 1Z4OA 2H2HA 3WGVA 2ORIA 1D6MA 3CR8A 3J7TA 5JLJA 3AFMA 2Y1WA 1HOXA 1Z5VA 3JVEA 1NG9A 5DRYA 4J9VA 2I78A 3B70A 1JNYA 3HPQA 3VYTB 1YFZA 1FFWA 4M60A 1EVJA 5F5LA 2PWAA 3RV3A 4HMQA 4BVHA 2ECPA 1QQBA 1X70A 4ZYUA 2TS1A 4MUIA 5B4VA 3AFIA 2DWUA 1QP4A 4IH4A 4H1HA 3K92A 4QRIA 1SIUA 4V02A 4DBLC 3CLTD 3RS4A 2XUHA 5GVSA 2UUAB 4HGRA 3KZMA 5KSOA 1QWSA 3L6CA 3NIFB 2G67A 3QG1A 4EMBA 8MHTA 1VJ0A 4QBTA 2AQHA 1BCRA 4G0PA 5FI1B 5K0NA 3CNBA 1LDBA 3N2GA 4BATA 2FG6C 3BDIA 3JRWA 1Y6ZA 2C84A 2ZTMA 1CUYA 1J70A 1XVLA 3DFMA 1KO8A 4PZEA 5DP2A 5EGNA 5BPHA 1SCNE 3GGPA 4A26A 4ZRNA 4X71A 1GG8A 1WXFA 3LHFA 1WLNA 2IP2A 1RRKA 1EDZA 4MYUA 4FSDA 3VPHA 2QNIA 2Q1XA 3ULKA 2GN2A 2C98A 3H5OA 3U2QA 3VOAA 1LLCA 2UVPB 4G1UC 1QYIA 5F1KA 1NVAA 5DM60 2CN1A 4ISCA 4JX8A 4CKBB 1UDWA 4CI0B 1GYQA 1MJFA 1I2DA 4B6QA 1E3SA 3HY3A 4TTSA 1F51E 1E2LA 4IJMA 1N2CA 2JAWA 3ICQB 4YAWA 3TW8B 2C3PA 4V3BA 1URPA 1QH8A 4JITA 1RRGA 3BRCA 4U9IS 3TRHA 1FVFA 1D6NA 1W94A 2C4UA 2DMRA 1RWVA 1WMSA 1YZKA 1XD2A 2DTDA 2PSEA 4KO4S 5CCXA 3UK0A 4LOKA 3G9QA 4XA8A 1GQFA 1H5UA 1DKPA 4NJMB 1VMEA 3J81A 2BHLA 3BCHA 3LX8A 1TO6A 1VKRA 1T1RA 2FKAA 4QUDA 1Q14A 2A0FA 1V7ZA 4OHMA 5A03A 5JC8A 2NUBA 2KKLA 1W36C 1CUXA 1BA2A 4EPRA 5JH7B 5T64A 1RYFA 3WLEA 3U09A 3NAMA 3BFJA 3PP8A 5JQWA 1B1CA 3TLYA 1B7GO 2NWQA 3FRHA 4NENA 2Q1TA 3PQ6A 2B25A 16PKA 3LVRE 4JN6B 1YS7A 4MZDA 3TIGA 1SZCA 4Y1RB 4O63O 1R9JA 4MGHA 3CHYA 4LKOA 1RTTA 3M5WA 1ODKA 4GDMA 1JHMA 3TVTA 3AVTA 3ZTTA 1E4OA 4ER7A 3V42A 4F6LA 1WBJB 4L3VA 2PQ2A 3R5KA 1UDXA 1U8FO 1MAVA 1FMTA 3IO3A 1XXHB 2AZDA 2CNWA 3OFND 4L2IA 3VC3A 5BV0A 1FXWF 3NTUA 3MBIA 2O52A 3IQDB 1P7ZA 4OHCA 1Z4NA 4Y9DA 4F04A 3D59A 2J9GA 3GOHA 4AUEA 5KYWB 1VCNA 2SCUA 4WACA 1VIYA 2IZ5A 4F86A 1YOVA 4J3FA 1RU3A 1OIVA 2QDXA 4HDKA 2NV0A 1ZK0A 2B0JA 3C3CA 1HQKA 5HS6A 1XLWA 4BO1A 2N0SA 1PZXA 3K5HA 3PFHA 1R74A 5C46F 4G63A 4Y2HA 1LWNA 4RE5A 4DKJA 2PZEA 1IPEA 1ISFA 2ZT7A 4I50B 1VA4A 4GEKA 5DSXA 1ZJZA 2PA3A 2H0RA 2GD1O 1PBNA 3BWCA 1ISSA 1Y1TA 3G23A 4YFYA 3W5DA 2ZBVA 3VR2D 5BQOA 1VG0B 4BKPA 4ETIA 3DZBA 3KEOA 1EVIA 3QX3A 1SD5A 1EFRA 1DAMA 5MGNA 3MIIA 4H3VA 1YS4A 4BXOB 4HB4A 4HYEA 1WW3A 4HWOA 2G4CA 3FGOA 4WZBE 1E6MA 3W6OA 1X87A 3NC4A 4G1VA 5CFQA 4BQFA 4XVCA 1NW7A 4RYLA 2CE2X 3IMKA 3OUNA 2YJ5A 2V96A 4ZVQA 3ZV4A 5HR5A 2ZR7A 3GGGA 4CV3A 2DEUA 1YI8A 1BJRE 1FSZA 3A31A 3L6UA 2MCFA 4J4BA 5AICA 4WXRA 5KYVA 5C7YA 3GAFA 2IXGA 3W8EA 3QW4B 3TRIA 4J75A 3G2PA 2WP8J 3AFGA 3JQGB 4FBMA 4FWIB 1QB8A 4JB2A 2OG2A 4G01B 5KYGA 4G0UA 3OX4A 3EQ7A 3MSCA 1RCFA 1Z7WA 2VNHA 2EZ4A 3KR1A 4XSGA 1QIGA 1QRSA 3AESB 3IMFA 5AVQA 1MOZA 3ZHXA 3IE1A 2Q5CA 1XK7A 1P5RA 1ADCA 2X13A 4NDZA 1BHJA 2AUNA 3TLMA 3OU6A 5BWOA 3DNFA 2FSUA 1EFLA 4JB8A 4RX1A 1ULZA 2OCIA 4TVSA 2J5XA 2ZSUA 3O2JA 2ZRGA 5CTAA 4E94A 2J6CA 2R00C 4WKOA 4JC0A 3LO5A 4UE2A 5CYGA 1IVYA 5JASA 1XDGA 5HKKA 5KNCA 2JH8A 4IXWA 2VJYA 1QZZA 4RY2A 1MHTA 3MTIA 1RIIA 4RZIA 4KL8S 3QA3E 1T9ZA 1RLTA 4BEVA 2HSGA 5DGHA 3PGXA 5F5NA 1FNBA 1QBKC 3BXHA 3GLHE 5AI6A 5ALJA 4ADSG 4GM4A 1ULSA 1C14A 3IMEA 2E5LB 4AKIA 1D1TA 2DSNA 1K8ZB 2R44A 1ZD1A 1QYCA 3B51X 3OPYI 4HLUA 3DVSX 2B4KA 3PDUA 2JVIA 2QXUA 4ENRA 3O38A 4NC9A 2C5FA 4N6OA 3R7WB 3VNRA 3BMXA 1PL7A 2F6RA 5HF9A 3FYUB 1RM0A 4KI7A 1I32A 5MDHA 1UDAA 2ZKLA 3OWXA 2JAPA 1JKFA 1Y9EA 4FQ7A 1YQ9A 5SYMA 2W3OA 1ZM4A 3L0SA 2X0RA 1M0TA 3ZGNA 2LKCA 2AZMA 4FJ0A 3GMJA 3OZCA 3TQIA 4INJA 4L4UA 2NUTB 2P8SA 3S2FA 4DQVA 2WG0A 2IBMA 3PPVA 4H7EA 4B4DA 2WA1A 4QAQA 1IN7A 1TTHA 3ZGVA 4JA2A 1ZUHA 1FUYB 3WK9A 5F98A 2NO1A 1H2HA 3HNRA 4MPJA 4WXPA 1O5TA 4RDIA 2GK4A 3MA0A 3N5KA 3LDGA 1GCIA 4KYUA 4CETA 1WA5A 3R3XA 1VCMA 5JI2E 3E5MA 3B5EA 4KVFA 1Q1AA 1Q77A 3TOXA 2JF0A 2R5FA 5ERYA 4NMWA 5HX7A 2O3UA 3GLFB 3OC0A 1B41A 1JPUA 4CT0A 1PT7A 3C3MA 4D99A 1YE8A 4RTKA 3VH2A 4LRXA 5G2OA 3FOZA 4LMAA 4MQ5A 4AN1A 5H1YA 3FGNA 4V2IA 1MTOA 3PUJA 5AW9A 3X2EA 1O54A 1PRYA 3A70A 1JKIA 3PHBE 4LX0A 5JFGA 2J0UB 4DAEA 2XSZA 4QD3A 1SVKA 2VS1A 5KX5A 3DYBA 1OTYA 1YL6A 1PR5A 3L8FA 4D3DA 3ND8A 4PZDA 1KFKB 4GNRA 4L74A 4LGCA 3PNKA 2XUQA 4QBGB 4U2DA 3Q5DA 3WNZA 4EY7A 4BQQA 1HE4A 1C9EA 3QUBA 5EWLB 3ZWDA 2EH0A 1M2GA 3RODA 5DB4A 4LS3A 5I8WA 3CRRA 4GQBA 1ZL2A 4BGIA 1HR0B 4BP1A 3PXCX 1C9YA 1Y3HA 1K8RA 3VDMA 2DT8A 5HM6A 1Z4KA 1RXCA 5H4HA 1LNSA 3EPLA 5BRAA 2JD2A 4ICIA 4L0QA 1L5SA 1TUGA 5IFLA 3ZV6A 2P2SA 4OV6B 4BFZA 9ABPA 4ZQCB 3IVGA 3W2EA 3TTXA 1AGNA 2HN9A 2NO5A 1B93A 4GMKA 4OHZA 5D84A 5AUNB 1P2GA 1T2AA 4C0QC 1VL0A 4P3KA 3TG8A 4QM7A 2VQ6A 3FNBA 3RC1A 5CYPA 2AUMA 3R6GA 4WZAE 1L6RA 4MVWA 5JRJA 4MR8B 4WOKA 1LW7A 4JLAA 4M8SA 4YJFA 3GPBA 1I7DA 4RZSA 5GINE 1V25A 2Z6VA 2XB4A 4Q4DA 4YJDA 4RH1A 5IAGA 4QOIA 5IKPA 4FNOA 3GEEA 4QYXA 1PQWA 4NBVA 1DEAA 1X1AA 3VDXA 4E33A 3T5AA 2WJ3A 1AHHA 1SHJA 2BR4A 3GLGB 2C99A 3BC1A 3NVMB 2TMYA 5ALEA 4EZBA 1D03A 3HBFA 1SQGA 3QYAA 3UTCA 4R8LA 2O8FB 2DFDA 4GLOA 1FY2A 1FDOA 5KJ1A 5I7EA 1YDFA 3MRVA 5HKKD 4M9RA 4MS3B 4OGKA 4FM9A 1FDWA 3ZIAA 1GLVA 3GP3A 3OM1A 3L7OA 4TS1A 2OM2A 3W4KA 1Y6GA 2XDQB 4JSYA 4DIMA 4HEA6 1N5KA 3H5LA 2OZPA 5CURA 4ZYWA 1TRHA 3B38A 1JTFA 2XWPA 1N9GA 4M1SA 1QS0A 4TTRA 5EZ5A 1BN6A 1T3GA 4DQUA 1GFIA 1PS9A 2HPHA 2ID9A 2O2XA 4WY8A 1XYGA 1OXTA 2XMQA 3TQQA 4D4GA 4EVIA 4N7BA 1KYVA 4FYJA 2XDWA 3DBOB 1RLOA 4HLDA 1QKKA 2QENA 5LBUA 4D6PA 3ZWCA 3F8WA 4KXNA 2BD0A 4R8VA 4R0MA 5JCZA 2JJQA 4EO7A 3NATA 2GBGA 4DNOA 5J1TB 1I2MA 1W52X 3K0FB 2BHNA 4YAUA 5FLEX 3Q3EA 3STWA 3FMGA 3LQKA 4CN8A 3NHPA 1QVWA 1TGYA 3H2JA 4NZYA 4ZGBA 1X77A 3IH5A 2Z6UA 3PLNA 2AFIE 3M82A 2NO0A 3HM2A 2UUOA 4UZEA 3P2JA 4FB5A 2FKNA 5BY2A 3Q41A 4IVNA 3WV5A 2PJUA 5EUCA 1O5IA 3AVUA 1RQNA 4IOMA 5A05A 2QL6A 1G8GA 4N3BA 5EXPA 5TX7A 4ZDJA 4RHTA 5ESXA 3U17A 1YJBA 2P3LA 4NIMA 1P0PA 4OAOA 4RK6A 1PR3A 1JIQA 2XD4A 1NUAA 3VM6A 3WTBA 1CY7A 1KSHA 3FB1A 1QRAA 3OZDA 5LXTA 3U44B 2RGNA 1CRZA 1GPKA 3A9VA 5JNWA 3JWHA 4R1UA 4YV7A 3DEYX 3EWIA 3HHPA 4CWAA 1KOLA 2OG1A 1EESA 1ENPA 2GNOA 2JIZD 3A1DA 3KAJA 2RD2A 2JGDB 2R7AA 2TMGA 2IZ6A 3D31A 4Q3DA 4R0VA 4WW0A 4YP1A 5ITZA 5GP1A 1V16A 2I54A 4DRXB 1GGFA 3ZDEA 1ELOA 1NXQA 2AI2A 3GN2A 2KPOA 1N3BA 2X8LA 2JRCA 2QJTA 3KEGA 4G4IA 2WM8A 4RQUA 3HDGA 1VI6A 1R7RA 1JECA 3R40A 4FCCA 4YUYA 4Y2YA 2F1HA 4JJKA 1T36B 4B2IA 5JEMA 2RONA 1OROA 1PSWA 1SHUX 1VPDA 2ZB2A 4H7HA 1DFGA 2ZZKA 5FNZA 2IXAA 2CFCA 2FN3A 3WMFA 5JHGB 3KR0A 1G98A 4Q3KA 1XXHA 3HCPA 5B57C 4RGVA 2X7JA 3BIJA 4J1NA 3W0LB 2J3EA 4JZYA 1DKOA 1QCDA 3R24A 5HUQA 4C87A 4BY9E 1JI0A 1B6SA 2BYTA 1Z0DA 2CE7A 2HL6A 1T5IA 2Y1FA 1RKXA 3TJMA 4MW2A 2MIIA 4HGOA 4YPFA 3HYTA 4CQNA 4MYDA 4AMZA 1SKYE 1XD8A 3MWEA 2FG7C 4NARA 5G0SA 5BOSA 1KK2A 1Z83A 2H11A 2J3DA 4TMFA 1XXLA 1CWUA 1UJNA 3N70A 4H1WA 2I66A 1NG1A 2XQIA 3BQ9A 5B4TA 3KCQA 2WJPA 2WHYA 4OA5A 3D0OA 3C48A 3GFQA 3VVLA 3QVGA 2DHQA 2PKQO 3LMKA 1TZMA 2V6BA 3IVAA 1TYZA 1VA5A 4BKQA 2QGFA 1UBSB 2VSOA 2DKFA 1QJ4A 2VXBA 3W34A 3VJKA 2O8BA 1JVSA 2JATA 2PV0A 2HQOA 2EV9A 5CW2A 2J3KA 1US8B 4A0HA 5IEJA 4UHFA 4O1MA 1W1IA 3DAYA 3ZWVA 1B4DA 1U0HC 4FN4A 3U9TA 2G3YA 3RU3A 5B7QA 2UYCA 3GOQA 3E7PA 3SR0A 3HWSA 9GPBA 1EFHA 3OJEA 3FGPA 4JC4A 3CQ9A 3ZWMA 4CLRB 2CT8A 5CLHA 4N47A 1MQSA 1A8PA 3CC8A 3DUFA 4TXNA 5K0EA 4OA8A 4QUJA 2AYYA 2QT1A 1ILWA 1KQGA 3SQXA 4GBMA 1Y5IA 2R1TB 2BEUA 1X38A 3GD5A 1JF8A 3EXHA 4RV9A 2AEMA 5TV2A 4GPD1 5LIRA 3GRYA 2HJHA 2GFHA 1LK7A 3TOZA 3EC7A 4JUCA 4BO0A 5I48A 3GEMA 3RS2A 3R8FA 5FEUA 1ZUD1 5FB3A 1QK5A 3H5TA 2CNNA 4B6SA 1PD1A 1W25A 2K4MA 1HX7A 4GOMD 1VJTA 1P81A 5REQA 3FWHA 2Q50A 2FYTA 4HN2A 4BP9A 2PWYA 3NHMA 4P5DA 4GO1A 5CJJA 3RUAA 3HSSA 1P1IA 2IDKA 1YS1X 3RT1A 2B78A 2NUAB 3FSGD 5M34A 2C29D 3AZOA 2B99A 1M1NB 3HUUA 1EVKA 1MC8A 1N7IA 3EMDA 3EVBA 4IWNA 3C87A 3NBQA 4XVRA 4BFTA 2GM5A 2GCOB 3EE6A 4IZIA 4YUZA 1PR4A 1X1CA 2ZUUA 1NL3A 2JD1A 4RPLA 4IIJF 3NYRA 3WRYA 5IYZB 4HWSA 1C1YA 1M75A 4NOJA 1G16A 3JD2A 3QNWA 4URUR 3DVRX 4IQ0A 4MV7A 1X1SA 2GLXA 3AEYA 1K2MA 1W73A 3H0KA 2FRDC 4K9SA 2IYWA 3HDVA 2P11A 2W6OA 2QY9A 4LJ5A 5SICE 3PWZA 5E1OA 1GRNA 1GKKA 5IUKC 1LFDB 3BWEA 3KVNA 2Y71A 1Y3BE 2W6QA 4HG2A 2KE5A 1CQXA 4IEIA 2GDZA 5AH0A 5I7SA 1QO0A 2ORWA 1FFXB 1YMVA 4H15A 3IDSA 3FYCA 2B7CA 2FI1A 4CV2A 1PJ4A 3UCEA 2JI8A 6GPBA 4IGEA 1PUJA 4HV4A 2R7MA 3ZS8A 1PSDA 3GDWA 4J0JA 1UWVA 2ZJ2A 1KBQA 2W8BB 5FYDA 4B71A 1N92A 2B8EA 1DTEA 2Q3FA 1X42A 2WTNA 5IJZA 1GD1O 5FUBA 2FMUA 1U1DA 3OZIA 5D3MA 4CDGA 1NKTA 3QX7A 5HIMA 4ZPXA 4HDQB 2EGUA 2WQZA 2Q2OA 4W6QA 4GOLD 1BFKA 5SY6A 4YPOA 4ZVPA 2XRFA 4QGHA 3OURA 5CH3A 2HEIA 1KJIA 2FH5B 4UHHA 5C53B 2IP1A 3E8MA 3PXGA 5IC6A 2PRZA 5E2IA 4JROA 3TDMA 1FZTA 3GUCA 3LNCA 3I1IA 5ALDA 2ASVA 4ZMSA 3SBOA 1Q17A 1MBZA 3UV3A 3ORQA 3ZHUA 3BFVA 5JZOA 4HHEA 1U99A 4R2WA 2GHRA 1J42A 3LM8A 1W85A 1L5VA 2A5LA 2I3AA 1E8NA 1F2DA 3S2IA 1H5QA 1XQYA 2B6HA 3CZ5A 4PLFA 4QTZA 5HBRA 4X41A 5KNDH 4JUBA 2AFIA 3HDYA 4D9HA 4OHXA 1ESDA 4OMCA 4W7IA 4CIDA 2VUUA 1TDJA 1Q12A 2JKDA 1R50A 4CG2A 3B1XA 4NYMQ 5BRJA 4CF7A 2Q07A 4GG1A 3QY9A 4C21A 1DKUA 2R87A 3EZLA 1J20A 2H85A 2LUOA 1Z0UA 1YE5A 3NC1C 4GLJA 5EWLA 1BE8A 1NLFA 3E9RA 4KDFA 5ALPA 3REGA 5EZSA 3WIOA 4C7JA 2Q1WA 1YQUA 1JSCA 2IX9A 2V54A 3UW3A 3WYFA 5AM2A 3UFBA 5L7TA 2AFHB 3MS7A 5JCOA 1FTWA 5AI4A 1YGYA 2R60A 5J4YA 5LQRA 1W34A 3UPUA 4ARCA 1GKLA 4KDRA 4L9SA 3RVPA 2O5RA 4EY3A 1KWGA 3TIFA 3VR1A 1XSEA 1ZH4A 4LJRA 2XR1A 2VNIA 3QVXA 1W47A 3LC0A 2GZ3A 1N6IA 1NWHA 2JAQA 1RFLA 3FLEA 3UYLA 1FSPA 5E7MA 2BM1A 5J58A 1JKMA 3QG5A 1XAIA 3M6FA 4FE3A 4YVFA 3PJGA 2CLDX 4AIIA 3ZY6A 1AQNA 1RC8A 1ARZA 4REQA 4PGFA 3KOYA 1THGA 4BNKA 4MR8A 2IS4A 3ZLUA 3PNVA 1GNVA 5GJBA 1KH2A 3EEIA 3T95A 4R8MA 1SKBA 2VTDA 2H9YA 3L4KA 3AUXA 5FIUA 4UAVA 1IHOA 2HSDA 4N5NA 3GQVA 3DL0A 2SNIE 4LXYA 4XLTA 2FXIA 5K8TA 2I4NA 1GZ3A 1JHPA 1B0AA 3K2EA 5K7SA 3EGXB 3JQCA 2NQTA 4JOCA 4GX2A 4C4ZA 4J3NA 1REQA 1HDGO 4LY9A 4REOA 5EE5B 1M83A 2O8FA 1Z17A 2AOUA 4DVJA 4BAGA 1UZUA 1UXHA 1JHAA 4R8SA 2WFAA 4TOIA 3STUA 3CO5A 4G0OA 1H6DA 2Z4TA 1RQRA 4I4NA 4XCXA 5BO5A 5ADVA 4MUGA 1Z4PX 1BGVA 3KDAA 4LE2A 1MPXA 4V1CB 4J0GA 5L4NA 4K9PA 1N9GB 1X80B 3VR4D 4ZICA 3GP5A 4NLLA 1JHXA 1GFWA 3ESAA 4BB5A 5ALIA 3ZWBA 4CKZA 4M8LA 2C88A 3HACA 1UMDB 2ZUSA 2A5GA 3DBIA 3QKRA 4DLWA 1NVXQ 1R6XA 2JFQA 2QLMA 4J16C 4IZ6A 3W9UA 4U1RA 4E0BA 5LUAA 1TFRA 2C5EA 5L53A 2J0SA 1XZMA 4K9DA 1KKMA 3FOEC 1IN5A 3SJBA 2IF2A 5CAEA 3THXA 2XVXA 2EGGA 2CMFA 2X6RA 1AQ6A 5EJFA 2FRVA 3JR7A 2XNHA 1MFZA 2Y1CA 5HIIA 1BHQ1 2X58A 3PGLA 3W78A 3K70C 2IDZA 3GLHB 1U3WA 2QPLA 3KTDA 7REQA 4DV5B 1GZSA 1A2OA 2H07A 2Q41A 3I8XA 4HAVA 1O9GA 4D8YA 3ABOB 3USZA 1RKBA 3KVVA 1TVMA 2F43B 3UNNA 1N75A 1O57A 4R98A 4YUVA 3UJDA 4LNAA 4ETMA 2XA2A 3E22A 3QE9Y 2HW8A 3JVDA 1T8SA 2BM9A 3EZNA 3FA2A 1IMOA 9ATCA 2PSDA 4MUNA 4OH7A 4JQOA 4OQPA 4D1YA 5CA1A 3CW2A 2BISA 2DQ4A 2PLRA 2PRYA 3OZBA 3WLQA 4E03A 1L7DA 2WIDA 2AXQA 1VKHA 3PPIA 2R7KA 3TB6A 4E12A 1U81A 1TYDE 2VXCA 4DBLE 4ZZIA 2Q8PA 3AR3A 1UBTS 1Z26A 1DJQA 2ECQA 2WNIA 3FDZA 4LZOA 4U00A 4AX8A 2VDWB 3DC7A 4Q05A 4B09A 4BNZA 4MITA 5FL3A 4EF6A 4PHGA 3UATA 5JCJD 2W2XA 1AUXA 1ZGJA 4I4IA 3RSQA 2XEDA 2OCBA 3O3NB 3CS3A 2ERCA 1EK2A 2G7ZA 1RPTA 2PRSA 3G2QA 4FMCF 5JAQA 2ZYTX 2EBFX 5CMLA 3VZQA 4A6EA 1I94B 1ZOLA 5IS2A 1IM2A 1W1WA 3AF2A 2RH5A 1M2HA 4EI9A 5D5PA 4E2YA 4KQFA 5JJCA 4MRNA 4HX9A 1FFBA 4RY8A 1B26A 4HGZA 4HX5A 4ND7A 3B2NA 3ZXYA 2W2KA 2Y0PA 2QAGA 1UQRA 1K4YA 3GU3A 4Y2PA 4RXMA 2J48A 1TQ2A 4JJ4A 1OWNA 3FI9A 3MCWA 4RKYA 3S7ZA 4YAGA 1LXCA 4Z3DA 4D96A 3CZRA 3DVQX 1GXSB 3I32A 2VZ8A 3O4RA 5E1BA 4QWMA 4H6XA 2AIRA 5J2UA 1E4EB 2H1CA 3MOSA 4KIFA 2E55A 2FJUA 5LZ8A 3C5CA 3JQ6A 1KZ1A 3EVAA 1YC5A 5GOZA 3SNHA 3S1LA 3RKRA 2UYQA 1OH7A 2NT3A 4P4NA 3HH8A 1NYTA 1ICEA 2V7WA 1YZTA 1ECLA 1C2TA 1VGVA 2YV5A 2FN8A 3WDKA 3KVYA 2RHWA 1Y89A 3T4EA 3AVOA 3IIMA 3HYSA 2P0YA 4J9UE 5F4BA 1CYEA 4CN9A 1FZQA 3HYLA 4TKVB 3QVGB 1GNRA 3DLCA 2JFHA 2RAPA 3WNDA 5F7JA 1RCTE 3NFRA 4NBUA 5JDIA 2VYNA 3VTKA 2BFDB 4ZPJA 5ENZA 3RS5A 3AI2A 4RF5A 1XVIA 3ZDDA 1RLUA 1GYRA 1QIHA 9LDBA 5JEEA 1F6BA 4KBYA 1QX3A 4RHYA 1EFRD 1NSTA 1E1QA 1Y63A 4PLHA 2DLCX 3PEWA 1U2GC 4C76A 4HQFA 2Q5JA 4DHWA 4WESA 4KI0A 5ARDA 2Z1NA 4JHXA 3IP1A 3WGGA 1C0KA 2VJCA 2HGZA 4IDFA 3CJRA 3PTZA 5TJHA 3H2IA 4TLMB 3CLTC 4EW3A 2R751 1NNI1 1GTL1 4GZ3A 1XD9A 3IL2A 1QLWA 1DRUA 2X1LA 4B32A 3FKSA 4YRRA 1TFUA 1IZ9A 1OI2A 1YUMA 4I8XA 4QWWA 4FLMA 4GSYA 4M0PA 1H6CA 2Q4BA 3DWGA 4NZZA 1KHXA 3R09A 4L9RA 4P53A 3OAAD 3HCNA 1L5NA 1IZ8A 5K0FA 3PL1A 5SZJA 1M34A 4I36A 4UTZA 3WBJA 3KR9A 5LZ9A 5TLSA 2I6GA 2XNJA 4QEDA 1XZFA 1YZGA 3SF8B 1P4HA 3D7SA 3BE6A 2PU7A 1J0CA 1GT91 1KFEB 4Z4HA 2IXEA 2XVZA 4XRRA 1FW8A 4ZKDA 1YFJA 1X7GA 3D8UA 2FWMX 3R9IA 2HHCA 2PUVA 4PW0A 4C0LA 1XCPA 1MC5A 1QOZA 1V11B 4HH4A 4O29A 4AAYA 3NH6A 1C30B 4HKTA 3AUUA 3UAXA 1SXJA 2JDIA 2WJIA 2VBIA 3UQYS 1GA1A 4L4YA 1JR2A 5GADl 4M0MA 3T3GA 1WZEA 5TQ0B 2CXHA 3DOIA 4X62B 3H8VA 1QB7A 1KS9A 4EB6B 1MEOA 5CCDA 4JJZA 2RB5A 3DMHA 4QOHA 1Z5PA 3KFLA 3NPMA 2WJYA 4RMNA 4UVDA 5IBQA 4KPYA 1RWNA 3HRKA 3SOPA 2MSCB 3HVUA 4C01A 2W6ID 3PHHA 5H3LA 5DO9A 1CQPA 3BXFA 4AJJA 1MOPA 5AQ1A 2JLUA 5A5FA 1RI4A 2A0WA 2EG5A 2H17A 2A4KA 2PVSA 1L7MA 3MM4A 4L7QA 1QV6A 1C4OA 2PRKA 5FFMA 1SCBA 3B1FA 2WE7A 3U4QB 4ZP1A 2PMEA 1U3FA 2QVBA 1ZH0A 3QZUA 2BKVA 1ACJA 1WDTA 2SHKA 1LCIA 4H3KB 1FUIA 3T15A 1JLSA 3MLEA 2EGHA 3LFUA 4PFQA 3PFCA 5JNUA 2ZYGA 3FFWA 3GPDG 3COZA 5LDGA 3QX9A 3C41J 3E9CA 1G0NA 4I3FA 4BKUA 1LLDA 4QZVA 5A0TA 4Q9HA 1PWYE 3QEMB 3UKDA 1PP4A 3L8MA 1JDSA 2JCBA 2EYQA 2Y1OA 4FGWA 5HFJA 4I5DA 5FCDA 2RKWA 1K92A 3RUDA 3RROA 2VWPA 3D5EA 1VJRA 3E9DA 1UFRA 3AJ8A 3PX7A 4NXMB 1TJNA 3AOGA 1VP9A 4MV4A 5EJHA 4LZNA 2GYWA 4TMWA 4P98A 4PGHA 1XRPA 3AHEA 3ZHZA 3N6XA 2VNKA 4AXBA 1JG7A 4UUPA 2H00A 4Z7NB 2YZ7A 4QECA 3C8DA 2BBWA 4EQ6B 2YN0A 2IBSA 4YRSA 3GL9A 1P0FA 2FP4B 1SPXA 2L2QA 2JFUA 3P0IA 2ACEA 4HQKA 4IFTA 1RRVA 4MQUA 3TD6A 4G0QA 5LPNA 1PGJA 2AKEA 3KXLA 4MMZB 3FMFA 4UOEA 3SXUB 4BJ5A 4LZWA 3GQBB 5CFPA 1H2ZA 1DBIA 4IEEA 4BP3A 4BB9A 3GJSA 1YASA 3JQ8B 2BGWA 4IJQA 2VCEA 5B2EA 1GPAA 1LBIA 3HDHA 3ODGA 4RJTA 1U7UA 3UMVA 4LDRA 2NXJA 2E3JA 1K68A 2IPLA 2ZK7A 3IA2A 1XDDA 2CXPA 2P65A 3A37A 1E1YA 3GA0A 3IOYA 4K0RA 4F5EA 3I28A 3GJ5A 1T5TA 4FR2A 2B37A 2OAGA 4W5TA 4ABTA 1Y34E 2FW0A 2ZQYA 4NNJA 3WLSA 4Q7QA 4G2SA 3MWDB 4DA0A 3LCVB 2OLEA 3T1TA 4PS1A 4X84A 2VZEA 3Q3HA 1MNQA 1QFJA 2C2XA 5AESA 2V8BA 1N25A 3BSYA 5LVAA 2QR2A 2R8PA 3QE2A 3PUXA 5KYYA 4PPGA 1HETA 4ZYXA 4N6GA 2OFXA 2OVFA 2VKTA 3IVMA 4XQCA 4BRSA 1RJEA 4Q4JB 3G0BA 2G08A 4R2XA 1X6VA 5KAPA 3RFFA 1ADGA 2NW6A 3EYWA 3NKFA 2HBYA 5F3RA 3RIEA 4F1WA 5JXIA 4PVDA 3ZWQA 2QJOA 3OT1A 3QBVA 1T6BY 2HMTA 3F6RA 1Q22A 3SCZA 4F46A 1I6WA 1S02A 2ONCA 1T5HX 5AKHA 8OHMA 3Q8MA 1JLLB 3E9EA 4RLSA 3TMAA 4DCTA 1FUEA 3MJDA 4CEJB 4UOZA 1KHTA 4B4UA 1L7EA 3EQ2A 3LQFA 1K3TA 2GZ1A 3ZZMA 3A1WA 3B60A 4M9UA 3B85A 3HQ4O 1TVEA 4G5SA 4JWTA 4EZEA 3DO5A 4O4LB 1Y1PA 1M0WA 3L0ZA 4HTFB 1QAQA 2AI1A 2GBIA 4OVKA 2PSSA 4ZJPA 2NZXA 1XEFA 1KI2A 2HLHA 1XEWX 2A57A 1K1EA 4KX5A 5A0VA 4IKOA 2QRNA 5IJXA 2I2DA 3VU3A 2Y0CA 3SR3A 2CJXA 3WHIA 3T3EA 3A9SA 1SCKA 2UVPA 3STHA 2R4QA 4BRZA 3OEEA 5FUQA 3D4IA 5E4FA 3B3JA 3QKRB 4RVGA 3L46A 2ZTHA 2OV6A 2GZMA 2IYTA 2YMLA 3L92A 3DKKA 3H05A 3L7NA 3ZZTA 1XVAA 3MB5A 3I04A 3V8RA 5LMUB 1UUFA 4WBXC 2GK6A 4LSGA 4A27A 4B6RA 4BU1A 1P7PA 3H2SA 3AR8A 3UHFA 4DLVA 4CTNA 1EFVA 4GBJA 4M0FA 5L7YA 3ICCA 3N3BC 3TAHA 3W04A 1FFSA 2WTUA 3MTGA 1DPFA 3JQFC 3GAZA 1CVLA 3AU8A 1M33A 1B8OA 2H1OA 4BL5A 1GNLA 2PQ0A 1PG0A 3I42A 4UHEA 2XOKD 1ZINA 1H4TA 4RF3A 1Y81A 1A1VA 5B58T 1GNSA 3VPBA 1NP3A 3AILA 3QXSA 4RPHA 4BFYA 1X1RA 1E58A 1OPRA 2D5IA 4Q24A 2JD0A 2DGDA 5LP6F 3COWA 1JW9B 2QT0A 2JFXA 2Z6QA 2G63A 1G1MA 5LMZA 2A30A 4G2TA 4J0CA 3UMFA 2FF5A 2VT6A 5LLTA 4F5WA 4ZTZB 1E2BA 3HBAA 3N05A 2C9CA 5LQSA 1WE2A 2FUG6 2HHAA 4PAQA 3W2IA 2FDXA 4OU5A 3O0DA 3B7WA 3AINA 3DKVA 3OOWA 5KBYA 2I71A 2ZUCA 5LXTF 2H1SA 1UT8A 1FDRA 3I9NA 3NGLA 2G1PA 2HA4A 2Q0QA 3OU7A 4LF7B 3QFSA 4UXIA 2VO1A 2R8OA 5GWXA 1OE0A 4Y2SA 2YTZA 1R4ZA 1EUQA 1CR6A 1T26A 4LIPD 2A58A 3QLUA 2EZTA 1BDJA 4OCZA 1UBKS 4DMGA 4MRAA 1YZNA 1QR2A 2Y3IA 3OJFA 5KYWA 2BSAA 1DQSA 4GHWA 3PC4A 1GLGA 2I29A 1IJBA 4KQ6A 4GS5A 4N49A 2FEPA 1N2IA 2NO7A 3VH4A 1W4BA 1U9JA 4CCSA 1WXDA 4XQ9A 4JBXA 4D3YA 1PW7A 2C78A 3L3BA 4LJ4A 1TQ4A 4DM7A 5AW2A 2VC2B 4OJKA 1ZH2A 3TCXB 2BONA 2CLOB 3BRWD 1Q3HA 5CNKA 3VZDA 1X8KA 1Z4IA 4Y2RA 4M0UA 1SKYB 3THYA 3SC3A 4HBGA 3T5GA 1F9EA 1X39A 1FBNA 3X1ZA 3JQGA 2BRUC 1TT7A 4RJJA 3RKUA 2IQIA 4QDOA 3CH6A 1E9CA 3GGDA 3SDSA 1D3AA 1M7HA 3R7DA 4F60A 2OGWA 2YZKA 1UPUA 3D8RA 5BVHB 4FYXA 3HVKA 1NY6A 3BERA 3NALA 4FZ5A 1ZJ6A 2RGWA 1AF4A 3CRZA 4D97A 1GCOA 3FVVA 1VDZA 2E48A 4NR0A 2RHTA 1RQXA 1VE5A 2BHRA 1A50B 5FT9A 5E9AA 5YASA 5DF1A 5KB3A 4QARA 2B8JA 3KJIA 4R1PA 3FM8A 5BUSA 5BT9A 1VLQA 5AK3A 1Z8DA 3VA4A 2OAEA 2MTBA 2MWMA 4YCNA 3ODPA 1IQPA 3C6ZA 4KZPA 1XDSA 2GRJA 4UU7A 1Y6FA 1U28A 5DHPA 4RDHA 4DE5A 2A5YB 2Q28A 2W6NA 4CIYA 3VNVA 3AIMA 2XWSA 4OJMX 3UMCA 2BJWA 1EJBA 2P0EA 2YS6A 1P7YA 1RXYA 5AVWA 4JLOA 1MGPA 1IB6A 1RHUA 3OIWA 1B15A 2IZOA 1LJLA 2LE0A 2X3FA 1ZICA 5G0TA 1PGQA 3A25A 1EXVA 1HH4A 1U7TA 3GLUA 2W83A 4MR9B 4CYMA 5KCMA 1RJDA 1ZZGA 4XDGA 1AQJA 4MB2A 3ONWA 2N42A 3E81A 2H1WA 1Q2UA 2VNAA 3CLKA 2VYCA 5FO1A 2ZREA 4ZA2A 3TW4A 1KY4A 2AOTB 2HNKA 3DE5X 1PTJA 2ZWAA 1UINA 1W2HA 4L5BA 2XZOA 5JS1A 1GSIA 2L17A 1WB5A 2QQGA 3MD9A 3RHFA 5DMXA 3BDAA 4BX3A 3CLHA 3JWJA 1IBKB 2Q4EA 1Z75A 1QYDA 2PQMA 3WSWA 3OCWA 2FE4A 1MDBA 1U0GA 1DNPA 2ETXA 2J7PD 2RAFA 3A8TA 1JQ3A 1UIRA 3AP3A 4G09A 1TEXA 3PLRA 4AQ7A 3ENNA 4N03A 1MV8A 3S6JA 5KVVA 3AEKB 3QYFA 4ZANA 3K53A 1DO2A 4JXXA 4KKVA 4QRHA 2WWWA 2HIHA 1R5JA 2BEJA 3NONA 3QF4A 4XQGA 1UMKA 1QP8A 2R5NA 2PN1A 4ER5A 1O8CA 4LRYA 4MDEA 4K6GA 4R3NA 3R44A 1NBMD 3IDFA 3KALA 3NWPA 1F3LA 1XTVA 3AERB 1OTXA 3TRDA 3W6UA 3AW9A 4JGBA 1ESEA 5ARCA 3QEBZ 2GI4A 2GYVA 1T1SA 5F2EA 1TL7C 3BD7A 4RW0A 1W44A 3UIEA 1WF6A 4Z51A 3VYVA 4PYJA 3GPIA 2GFIA 1QRUA 3U4QA 1J07A 5E9JA 1O89A 3OPQA 1GTVA 4TTPA 4H77A 1E59A 2HDWA 1O6CA 1E61A 3QHAA 2J8ZA 1Q83A 2TYSB 3C3KA 1HK7A 1HFKA 3B9QA 1T1JA 1SCJA 2WVAA 2O54A 2AN3A 3T7DA 1NSYA 4BBAA 2JZOA 2YY7A 3M6WA 4XGQA 2B35A 2ODPA 4ZOAA 4DLKA 1XC7A 4OJQA 4V0LA 3N58A 4XQ0A 4XPIB 1IJFA 2WZQA 1JXMA 4EPXA 1MO4A 1AX9A 3OPVA 4H9GA 3DMPA 3OKPA 1NVKA 3F90A 3O4VA 4HATA 3IEIA 2QP3A 3CEPB 1O9BA 2FPWA 3WYDA 3SOZA 1ONBA 3KQPA 1Z6PA 5KOJB 4L28A 1NHGA 5JC1A 4TLLB 3A4IA 4ZU3A 3E58A 1VPEA 3ER8A 2OFFA 1ZK1A 3HKEB 1DOHA 1X7XB 3UGQA 1IN1A 1N2BA 3A3PA 1MENA 1NJ1A 3EOZA 3LXRA 1MAHA 1QORA 4HXEB 4GC5A 5F12A 1J2FA 2WUFA 1Y82A 4G1EB 2BFBB 4Q3CA 1R0KA 4FUTA 5JXGA 2G0NA 2C31A 3VR5H 1KEEB 3I9V6 1RABA 1L1EA 2VTKA 3BGSA 3TQRA 1ZNWA 3UFXA 3JQ8A 4D5EA 5C7IO 2XT9B 1BE6A 1SBZA 2D3WA 2ZPAA 1USIA 3DOCA 3K2BA 4NMHA 2I1WA 1N3YA 3SBXA 3THWB 3GFVA 1QANA 5D1HA 1ZNQO 1TTPB 2ATVA 3E48A 3L7CA 4NAHA 4WK6A 1BDIA 5D6NA 2CUZA 1J24A 1KETA 2V1XA 1JPVA 3MFQA 4JR2A 2IWRA 1F12A 3SXPA 5C4IA 2W4QA 1DJPA 3LP5A 5IZCC 2BGKA 1MJNA 3GRKA 2B7BA 3H2BA 3MJTA 4QO7A 5B37A 3UWKA 4A82A 3QVUA 4GGOA 1KI4A 5KTTA 2P9JA 1T1EA 3ROXA 4CW7A 1CB0A 1J2UA 3OE1A 4KXFB 4B87A 4IMRA 1BGWA 1GUZA 4HNTA 1OH5A 4GPBA 1GPYA 4GPAA 3H84A 4LTNA 5IZ4A 4B76A 1YUNA 5DBHX 3H1PA 3BMQB 1A5SB 1Y3CE 1XB2A 3DM9B 4JQZA 1RM4A 4KQKA 4TSKA 1KZ4A 4JH0A 3WLMA 1INLA 2KW5A 4NV1A 1ZI8A 3KKEA 4C4PA 4OHYA 2EF0A 3MPUA 1B14A 1JKJA 4R81A 3VA1A 1QLJA 2QVXX 5JDCC 2XXAB 1JLLA 4G24A 2FMTA 4JDUA 3KYDB 4JJIA 4JSTA 3S28A 2O7NA 5TVKA 1EGMB 2FWNA 3D8TA 1M8GA 3G6WA 1H23A 5E8JA 4PE5B 1LGYA 3G8BA 3OY7A 4JUFA 4EPVA 3H5IA 5J5AA 4ZEVA 1ZP6A 2D8MA 1CS0A 3GELA 3LRXA 4ZVRA 4YDQA 1Y6RA 5DCYA 4H0CA 4DNFA 1YS2X 3AKZA 3V33A 3SSNA 2YINC 2JAUA 3T35A 1EAYA 1GPWB 4WCVA 1S8OA 4ZYYA 2EIXA 4H3SA 1TAGA 5NULA 5IFKA 3TAXA 3I45A 4F72A 3C5HA 4B85A 1GPDG 2VR1A 2WQ7A 3DGFC 3DR3A 1KI8A 3TQFA 1BW9A 2DQKA 3CKLA 1LFAA 1UBGA 3B1YA 4WXYB 3VO2A 1NUPA 3CVVA 3BTVA 3S1SA 1NVFA 2GXSA 3HCDA 2W2VA 1K3FA 3H6KA 3Q7PA 5HVNA 1MJSA 1UK7A 2XMBA 1V5EA 2YHIB 1RWWA 4P35A 3DKPA 1KU6A 4GM0A 3S1AA 1U11A 1RS0A 3GUUA 3ZHTA 4UBKA 4WEOA 4XYBA 3LJKA 1OXVA 1V1MA 5DGDA 4DSOA 3N8HA 3BSSA 5M5BA 3J81k 1OX6A 1N34B 1RWPA 4P4LA 2ZLBA 4CE6A 2IGBA 1CHNA 5LZ4A 4XCVA 1IAQA 3U56A 3CT6A 3PNQA 4Y6QA 2N1BA 4BO2A 4BPBA 2ZSHA 1JR3A 2FAXA 2Q8NA 1FDUA 1PJSA 3FF4A 3FKSD 1I7SB 4W82A 2Z2XA 2DT5A 2R97A 3HSKA 3CEAA 1VC2A 1QVRA 3K0EA 1O6BA 4DA7A 3VOSA 4AN0A 2H5LA 3UHJA 1QRTA 3EUFA 1KDOA 3FVQA 2RARA 5T5QA 3CEHA 2R6ZA 2PMCA 3DDCA 4KQCA 2V7EA 4ARZB 4NSNA 3V7NA 1NTOA 4QFBA 5AVZA 2FRXA 1AS2A 1GCAA 1AS0A 3AV0B 1CJBA 1P5ZB 2VJMA 3EQ9A 2MSDB 4H7PA 3WIBA 4BTEA 5DVZA 4CXMA 5K51A 3PSAA 4F84A 3GLIB 3EGDB 3A4LA 3HKDA 1CXZA 1FQJA 1KY3A 3VR6H 3I12A 5EZQA 2A5JA 1FRZA 1SUWA 4G2NA 4MQ4A 2JI4A 3CNLA 1W9HA 3JWGA 1FMCA 4M2LA 2IPOA 3PX3A 4OAPA 1NJ6A 4PZPA 2CD9A 2FR0A 3ITKA 1U90A 1WW2A 2IEDA 1WCXA 2PS1A 4YRFA 2JASA 3DZJA 4PPYA 1VBNA 1RAEA 1KFCB 3KJHA 4CM6A 1GXCA 1FNDA 2A9RA 2ZYUX 3C6YA 2EX0A 10MHA 3L4JA 1IYZA 3W5AA 1FX0B 5E8RA 2ZWMA 3ZWYA 4BMVA 5JEOA 1MP0A 2H2FA 1NF8A 3I01M 5BNZA 5CFLA 4MHTA 4YMIA 3EOAI 1E3JA 1ZQ9A 2CMGA 2IIQA 3AM5A 1KIFA 4PSAA 5GV8A 5LZ2A 1R4NA 2AWOA 4QBKA 5CB4F 3KOMA 3RSOA 2ZAMA 3AR4A 1U0SY 5CXSA 5IAAA 2UXDB 4MRVA 2FW9A 1M8PA 1E2GA 1XMSA 3ZH9B 3NEPX 1S7CA 1C3JA 4W63A 1G8SA 4L5AA 4XX0B 2BMDA 3WTCA 1IXSB 1ESMA 1LC3A 4J4HA 4UUQA 4CMEA 1HG0A 3ON5A 3FPAA 1DJOA 4Z2YA 1SQFA 3FE2A 4OJNA 3WS7A 4MVJP 1DAHA 3EEOA 3ZNQA 3DM5A 4DG8A 4ZYVA 1V4VA 2R11A 2VFAA 1MH9A 3G2JA 3IBCA 4G41A 5WRFA 3DMYA 3VVCA 1G20B 4MPRA 2C1ZA 1V5IA 1VZ2A 4D26A 1SEVA 4D8TA 2QI9C 4RH3A 5CIYA 4V3CA 1ZD8A 1RYZA 3UMJA 4B4KA 4YV2A 1NXTA 1FS4A 4QT0A 1YVRA 4UBIA 3GEHA 3OX1A 4J0IA 4OU4A 1U63A 3A04A 2PMDA 3NTRA 3FCOA 5HRAA 2Q7XA 4KU4A 4ENPA 3R9XB 2Z8YM 5EIBD 5DWVA 1AKNA 5LYJF 3BICA 3O2NA 1H9CA 2RHLA 1I36A 1KJ8A 1S89A 1V8ZA 2O2EA 4HH3C 2XB2A 1CJSA 1FP4A 1G20E 1TUEA 4FFPA 4G8DA 3K1TA 4OHWA 4B6GA 4O3MA 2IYNA 2IUFA 4EG8A 5KSZA 3OQ1A 4HLUC 4Z9BA 5LKAA 4R54A 1R5NA 4EK9A 3ZJ5A 2QXYA 4RD2A 5LWHA 4EPYA 4I4TA 1EB8A 3BIXA 4FU0A 2PS9A 4OEHA 5DYTA 5LBTA 3ZBUA 1MO6A 2D2FA 1IONA 1T0HB 2ZVJA 1BXGB 1WKCA 1CP2A 2FZLA 3DBLA 1SCUA 3C85A 2VAMA 1LK5A 2Y0EA 3QTTA 2WWTA 1TW2A 2AOXA 3VZSA 4KFCA 3NHAA 5K3FA 4OIFA 2XCQA 3KJFA 4GI2A 3TAUA 1XTPA 1K0UA 3DO8A 3NDPA 4M1OA 1EUZA 4WXEA 4EGFA 5A5VA 3I9FA 4MCHA 1ORDA 3SDBA 1DRKA 1JHZA 1FTQA 2X22A 1NVWQ 4N5IX 3U49A 3QOXA 4MYTA 1G6KA 1P7WA 4NYIQ 1OFUX 2GCGA 4GI5A 4OIMA 1KJNA 1V3VA 2QTBA 1SUSA 1WJGA 4O6VA 3MINA 5BW5A 5B6PA 1WSDA 3IEKA 1EX9A 4GMDA 3E5RA 3GY0A 3WWOA 5KQMA 2AW5A 3A26A 3L06A 4EKEA 3DDNA 3KE8A 1A82A 3LKVA 3WP0A 5C32A 3K70D 2PSFA 4FYHA 4K28A 1T8YA 4J7AA 3AUAA 2CVQA 2H51A 1JT9A 3DAOA 1G8JA 5EE1A 3EIQA 4A1OA 3RAFC 1VXRA 2IYEA 1DC4A 1T35A 1QPGA 2GX6A 2P91A 3KOOA 3LHSA 4R2IA 2V4MA 2QBYB 4MRPA 2GXAA 4RDXA 2WYHA 4KPUA 4J2TA 1J2JA 3V48A 1XR3A 3KDSE 3R9WA 5J2TB 5KEIA 3H19A 5LD2B 3E1GA 1GZ7A 2ADMA 5J23A 4KWIA 4KXXA 2FSIA 1K3UB 1SIBE 3ONNA 1RE1A 5ALTA 5DX0A 4DC1A 3L5KA 1OC4A 4EEZA 2BEWB 3H0CA 2QP9X 1R0LA 1DHTA 4GPTA 1JDZA 4NQRA 3W8DA 3OIYA 4R41A 2AFHA 5BWNA 1OLUB 4HZUA 1ORVA 2C1XA 3RYCB 1RI3A 4YJ2A 1UT5A 2D5BA 2JC3A 3Q7RA 1HZZC 5DSTA 3NTQA 4J8PA 2D5LA 3A6EA 3KSRA 4IDOA 2PKYX 4MWZA 1OYOA 1GJRA 2HGSA 3CB4A 3M1IA 4KAFA 1G5RA 2YVLA 3BK1A 1WZCA 1WU7A 1GP2A 1Y8RB 2V65A 2ONJA 2RSLA 3FBGA 5G0VA 2JGFA 3DC2A 4K87A 3HKEA 1OFUA 4H18A 1G9SA 1M7BA 3QHQA 4E07A 3AVWA 2GPBA 2VUTA 5FPYA 4TZ0A 3ELUA 4UASA 2O8NA 3O8NA 5EXDA 2P5UA 1JT2A 1A04A 1UC9A 2X76A 3L0YA 1PG5A 2X8JB 2C4TA 1SBCA 4L5IA 5K4GA 3HR8A 4J0KA 2ZSIA 3KHTA 2DHDA 3RS0A 1GGHA 2WWXA 3V00A 4E7PA 4OK5A 3G2NA 2XT9A 3AI3A 1R18A 5DTJA 1IVSA 2VPYA 4G0NA 4RUKA 1E18A 1UPFA 4M9SA 3DF7A 1QIKA 4H0NA 1KFBB 5BYBA 4RVNA 1T1IA 1XZJA 4IQ8A 1R5OA 4GP7A 3MZ0A 4UUMA 5CYOA 3T99A 1TJ5A 5EWJB 3TQOA 1QV9A 4OFZA 4WJZA 2AN5A 5TIIA 1PR2A 4XPZA 4ZEXA 1WCYA 3KYCB 1J8MF 3EWSA 3HUEA 1IBRA 1HI9A 5CA0F 1C8KA 3AGPA 4JXJA 4E5PA 3B9PA 4AP5A 3A4NA 4DS3A 4LF9B 1YZHA 4DRZA 1Y8CA 4AB1A 2JGRA 2CFTA 2SKDA 2FPSA 2JA2A 1K8QA 4FFOA 4GMHA 4HRAA 4UNQA 3AHDA 3EGXA 4K3UA 5KQRA 4EI8A 4LCBA 4QTTB 2J6BA 3E05A 4M0DA 1AY0A 4RANA 3TM5A 1CPYA 1MUUA 3WGTA 4BLSA 4QX6A 1YIDA 1UBMS 3E9YA 3MELA 4XJTA 3SR4A 2AOUB 4F4CA 1RXWA 3N6RA 4BNUA 5C5CA 3DITA 1G4HA 2D62A 3JX9A 4G5FA 4RETA 2E6KA 3PDHA 2ZSFA 3UB2A 4I1YA 4C6SA 3F3MA 4V1CA 2J9XB 1LJ8A 4MV0A 1TYCA 1X9IA 3D8BA 4ESVA 4KR6A 1GR1A 3ZWXA 2XKAA 1XE3A 4EJ0A 5KO2A 1DV1A 3CWQA 5HCUA 1O95C 3T5MA 1D09A 2ONZA 2AF3C 2BFOA 1IY8A 1YR6A 3AM4A 3WP1B 1JBQA 5ALVA 1QHIA 4C0WA 3WB2A 4YONB 3IDAA 1S2NA 1GKUB 1VSTA 2V5UA 5AK5A 4I3GA 1D8TA 1D4AA 1I3OA 2QN6A 2H48A 4TV8A 1LDEA 4CR6A 3O2SB 1KR5A 1QZUA 1JR6A 1XK6A 2O2CA 4UTPA 5ALRA 4OQNA 3ADCA 3W06A 1O96A 4KLNA 2RIPA 3PHIA 4L07A 3ZOZA 4FT4A 1HBJA 4HP8A 4FFWA 1QGAA 1PV1A 4TXJA 5I8PA 2HO4A 4MJXA 4N8EA 4EW2A 4E5YA 4YROA 4FE7A 3QK7A 1CEEA 3R6DA 1L4MA 5ILOA 2ROQA 1JFLA 2EFHB 1G38A 2O59A 1X7WA 4H2DA 3JAKB 2IYRA 2JEOA 4HAYA 4ZI7F 5BQ3A 3O8CA 3E70C 4JQCA 3R1IA 3RC9A 5L3QB 4ZIRA 1N78A 1UJXA 3K4PA 4C4XA 5TSDA 2NU7A 3C1TA 3C1UA 3DXYA 4OI0A 5JSUA 4X1KA 1E1CA 1YR2A 3C3AA 2QUIA 4HZIA 2EFEB 3VHQA 3X1MA 1NI3A 1Y4ZA 5I7AA 3VR0A 3C8HA 2QPAA 2J3IA 4EBBA 1UC8A 2P9ZA 5ED4A 3CVUA 1LDYA 1I8TA 3DQZA 3SVZA 3KDPA 3BYZA 3GLIA 1A8HA 4JSRA 1YO6A 3PV0A 3HKDB 4GZMA 2XCIA 4E6EA 1K5DA 1PV4A 2CL7X 2IUSA 2JLCA 4YJKA 4BNWA 2XYVA 4D9MA 4YCSA 3U5ZB 4I6JA 1WXGA 4QUGA 1TM2A 2FZGA 2XF8A 2CLCX 3BE4A 1CK4A 3LP6A 3QX8A 2W71A 4XSHA 4YCJA 1RZ3A 3NPAA 1WMEA 2PJZA 1OSNA 4FD2A 4KHPB 4BCDA 1OW3B 1HRKA 1E6UA 5BYKA 1VPWA 4D25A 4R0NA 3DBHB 4L72A 3JCZA 4MKZA 5CH5A 3TNDA 1L7PA 3P0EA 4BEBA 2QZ9A 5TC4A 1U7PA 1CDOA 4OLAA 3HCFA 3FTQA 2FN4A 4PZAA 4O2BF 4P3OA 1QE3A 2W4MA 2P4EA 1XJCA 3IYLW 1YAHA 2REQB 4DF3A 4YP0A 1TQ6A 4EHDA 2CSXA 3MRTA 1G4AE 2DTEA 3SFZA 2C4MA 2W2TA 5AVYA 2IYVA 2VBFA 3OCUA 3QELB 3RUPA 3SPXA 5TEWA 2BELA 2D5CA 3LY9A 1DBWA 3MS2A 1YACA 1W4RA 3CJQA 4ILKA 3WKAA 4ZI7A 1GM5A 3W79A 2G36A 4QUIA 4DA6A 1MABB 1WVIA 3KD2A 4JX9A 4XWTA 4DBZA 4CLOA 1ONPA 3DFIA 4Y1FA 5BXYA 1RPNA 1O3YA 3OIDA 4M1MA 1K4MA 1QFMA 3TZBA 1K3QA 4IV8A 1KGSA 3UJBA 3PT9A 3Q2OA 4PANA 3VXKA 3E9MA 3Q0TA 4YRLA 4HNGA 2R1ZA 4R9NA 1ZVQA 4FYYA 5J3JA 3PGKA 1LTHR 4PR0A 4OUDB 2OO5C 3E2IA 5TQ0A 4CKXA 8LDHA 3KZXA 5JZVA 2ZRFA 4B3DA 3I37X 1O0BA 1KYXA 1U2QA 1B74A 4OG2A 4Q6BA 4D9GA 4LC0A 5LA6F 4CM8A 2X2EA 1FP4B 3OICA 5H16A 2G9NA 3A3YA 1EWKA 3NYQA 2ORYA 1M34B 4H59A 5FPQA 1BSVA 5BNFA 4UCQA 2ANCA 2NU9B 4ZWNA 4DLBA 4OHFA 2UZ0A 3C45A 2XUAA 1HM5A 3EUWA 2EWWA 3DV0A 3ICPA 4H4EA 4L4ZA 2Q3MA 3LNTA 3M5CA 2OBXA 1C7QA 1SCUB 1U3UA 2ZJYA 4LCJA 4L5YA 4LV8B 1PTJC 1DZIA 4YUWA 3RJ5A 4S3MA 3PHLA 5EZ6B 3WWEA 2L19A 1Q3TA 2NYAA 1QDEA 3IS3A 4Q9JA 1T0UA 5EKUA 2KFUA 2XNDA 4D80A 3BD8A 4QPDA 2W7TA 1V8DA 4XWYA 4K81B 2B82A 2GCPA 3OE7A 3EDYA 4RVDA 1X14A 2JFGA 1W87A 1M1XB 3M1LA 3SHOA 1TCCA 3GJ0A 4ZD6A 4DADA 4ES6A 3VYWA 3I5MA 4XWKA 4Y2UA 5SZHB 4BBZA 2O7SA 3W7AA 4ACAA 2AQ8A 1DXOA 1N5DA 1QZ3A 2EF1A 2OSBA 4IXMA 4QQKA 1QZTA 1AK2A 3F5FA 2QUJA 3MXTA 3OU2A 1AHNA 1FFEA 1OBCA 1ZONA 2ZRBA 1GNQA 1GPMA 2OFOA 3H9JA 2EAUA 3OFSA 3WKBA 1YGPA 4NG5A 1ZPDA 1O97D 1FTYA 3I23A 3GIDA 3PDWA 5E6UB 3WIVA 2C7QA 4NATA 1SMKA 2RGRA 3ZE0B 2WM9B 3EODA 4IJVA 2JCSA 2ETVA 3K5IA 2J30A 4NTZA 2XGSA 5SY9A 3FKJA 1ZJWA 4NBWA 3UANA 4E4YA 4CEHA 2HY7A 5CR9A 2JQLA 1OPXA 1ZGCA 2HQ1A 1A72A 2WSYB 3AR5A 1XTQA 4CLEA 3ADDA 2QLBA 5DN6D 4OSOA 4E5MA 2WSMA 2ZJ4A 1E9DA 1PN3A 2F8MA 2DWCA 2H1HA 1Y7TA 1E2FA 4G8BA 4LXUA 1GGEA 3WOVA 1XZBA 3A11A 2ON6A 3KTFA 4GR9A 4BFCA 5G4LA 1PGNA 1I4EB 1K9VF 2YVUA 1DWUA 5HCIA 3OLQA 5HXAA 2ZWIA 4O4HF 4Q3NA 1GUFA 2G9VA 2WYIA 1UJ2A 2NU6B 4HWGA 2C7OA 3NORA 4V0NA 4HXYA 4RAQA 3KFXA 1LBTA 2O2GA 3G0CA 3UC9A 4V38A 4PZ9A 3MTJA 4XH9B 2B21A 3FOAA 3EIHA 2D06A 1XZEA 2RDMA 1VP3A 2CZGA 1RXUA 5EE3A 1K7YA 1RMTA 4YJFB 4EB0A 5A04A 5IT9A 5FWYB 3TZLA 3GMIA 3DW1X 5F1PA 4MUJA 1ZOIA 2B5VA 2NPIA 3VO9A 4FK8A 5K03A 3AUJB 4H6VA 2HMSA 1K6IA 2HTEA 2Q9CA 2VHCA 2YWXA 4MXDA 3CF2A 3OQIB 2I1VB 2ZS8A 4LWPA 4PSDA 4YJHA 3PEVA 4JCOA 2BM8A 4BJ6A 1Q0PA 4Y2JA 5LDHA 1JHOA 2WEKA 1X9GA 4C78A 1JR3D 4TS4A 4B0PA 4QTYA 3CKYA 4CQMD 5EE0A 1XZHA 1N0WA 4E3ZA 1F8FA 3IV9A 1EWRA 2BY4A 4KR9A 2IEIA 3CR3C 2D13A 3KQVA 4WXHA 3G5AA 3RO7A 4Y67A 1L4LA 5D01A 5F1OA 5H4GA 1MPTA 2PUDA 4P0TA 1LBQA 3D3WA 4BNMA 4CFSA 2ZSEA 4ESOA 2HF8A 2QORA 3OLZA 3D5QA 3DCIA 3P45A 1Z0AA 5CB8A 1ZAYA 1PL0A 1NE2A 2COUA 4TV9F 3V1YA 4RYDA 3U16A 3HDJA 4OLBA 4A36A 2NSHA 3M70A 1WCIA 3TH5A 4N39A 4PN3A 1GDDA 1IPFA 3ZV3A 4DYHA 2Z2ZA 3L7BA 4HNQA 3PI7A 4UVEA 4AFNA 1XCMA 1ZUNB 2CW5A 3N0TA 1Z08A 4GIBA 3S68A 4BQSA 4P0QB 1KYIA 2OGZA 3LCRA 4NMLA 3O47A 3Q15C 8GPBA 2CXTA 3D5TA 1YB1A 2YHAA 3ZWNA 5AXDA 3M9LA 5DX1A 3CZAA 2A94A 3QXCA 3EZFA 4GWLA 3CE6A 2FZ5A 4BYMA 3DPIA 2O1XA 1F60A 3EPKA 2QR3A 2Z2YA 4II3A 5THKA 1UZNA 3KKKA 4MVJI 4UARA 4ZT2A 4OK6A 1XA4A 5LMNB 3LHKA 1P9OA 2HCTA 2QVZX 1UFVA 1GPJA 4YH1A 1RJFA 2WB2A 4BQOA 1Z6QA 4LF4B 1NXPA 2HA0A 4F6RB 1G3GA 4I5FA 2QKYA 1NXSA 4KR3A 1CUIA 2IUTA 3RBXA 1KZHA 2HFKA 3QLJA 5DCUA 3T4XA 3LSTA 1ODIA 3FIJA 3BBLA 2QD3A 5JD4A 1A95A 1TLFA 2LD4A 3DPSA 3LA8A 3RNOA 4LJ9A 2V6FA 4PNPA 2X4IA 1M6WA 1AKMA 3B12A 3I72A 3MCUA 4EGJA 3SU8A 1G4UR 1NZDA 1SVUA 2G9RA 4KTTE 3RJZA 5CPBA 2BGGA 1MHPA 2H9IA 4R9SA 4XGKA 4OH1A 3SKVA 2OQRA 4NZNA 1U0OC 2O0HA 3IQHX 3I3OA 3RS7A 3L6DA 4BMSA 1HDCA 4IGIA 1TKAA 3GWGA 4FHCA 2ORED 1RJ9B 3BGDA 4Z1MD 3QFFA 4JUDX 3WA7A 4YRBA 4L8YA 2XUKA 3SI7A 1W46A 3EFOA 1P9RA 4WAUA 5DWQA 5JPIA 1DIOB 2AZ4A 3K05A 1JQDA 1QRRA 2PCJA 1ZDMA 3LBFA 3QLTA 4HGNA 4L1KA 4LGVA 4LYYA 1LW6E 2QJWA 3JQBA 3QLVA 4RHXA 4WFQA 3WDMA 3WGMA 3CURA 2PHZA 3DR5A 3ILSA 4Q02A 3OOSA 3FHJA 5TT0A 1IN8A 1RCUA 4EI7A 4P7BA 2B8TA 4ZIRB 2IU0A 1MOQA 2DUMA 2R9VA 1BN7A 1E6EA 3MC1A 4FZVA 1D2NA 4JQSA 2HIAA 3AT1A 2HWXA 4L4RA 4MVCA 1B8PA 2ZETA 3FCCA 2DPHA 3OQPA 4C6TB 1GPNA 5FXMA 2C2GA 3DAFA 1W88A 1POWA 3Q98A 3ETGA 3BFKA 2BWJA 2GVZC 3ADOA 3BE5A 3HR4A 3KB1A 4QHTA 4C14A 2W5UA 3DMTA 4Z54A 1DC6A 4XKJA 1M6HA 2JHPA 3EEFA 1KE1A 1E96A 1UJBA 1D5CA 2GPYA 3SJZA 3TLAA 5ELXA 1PT6A 3HKCA 4HWRA 3I53A 1E66A 2Z5GA 3O4HA 4H4CA 1N6RA 1EQUA 5JI3E 5LFAA 1OOEA 2ZR9A 4YN3A 1K5HA 1TK3A 3MGAA 4U02A 2JGMA 3LK6A 2ZBRA 4F1JA 1KJWA 1YR7A 4NOLA 1F9AA 1C4WA 1NBIA 3OPYA 3AKYA 4TM7A 4D42A 3CZCA 4BIMA 4LPSA 3Q3GE 5KZMB 4MAMA 1GZHB 4WK2B 3ZU3A 1CUWA 5CM2Z 1SBQA 3V4FA 3EXHB 2AJLI 5KAMA 2GOYA 2Y92A 4UMEA 3RIMA 2JCXA 4B4OA 4DDMA 1YBHA 3OPNA 2P2LA 1B2LA 1I6KA 1Q95A 4EJMA 5K3CA 3BK2A 3TE6A 3IPAA 1BFUA 2QTWB 2CYAA 3PITA 4EPTA 1G2QA 1W76A 1YS6A 4IVPA 4DMCA 1V95A 4E1AA 4K0KB 5BN3A 3IUEA 4JBHA 5D3KA 1OREA 2Q6VA 4NFHA 5D5HA 4RIFA 5EUMA 3ZS9A 1VPLA 3CX4A 3DSRA 5AHKA 5K0LA 4DY6A 2DPYA 2Q21A 4OD0A 4KJZA 2OCKA 4EI2A 1Y7LA 5B7PA 4K6HA 4RA6B 1KYYA 3K0BA 3RNLA 4MHSA 2IS6A 1ZC3A 1M1UA 1NXOA 3H4VA 4HDRB 1M1NA 2AXEA 2Q1SA 2VCYA 1AKYA 1WDLA 2XLBA 4R9VA 1Y5MA 5FI3A 2CBZA 1WW8A 1YNSA 2GLUA 5DM0A 4Y6OA 3KOZA 2VHTA 1KPIA 3HCAA 4GT1A 4YTEA 2HJWA 4B7XA 1MABA 4CLOB 4IIVA 2ZM6B 1V8PA 3O7MA 3DGEC 3ZWPA 3G8CA 4ZAGA 4LJKA 1U02A 1SA0A 1GGVA 2PLNA 4CQMA 3HJFA 1E2PA 4QG3A 1G60A 1G55A 5ABPA 1COWD 3JD1A 5BQFA 2FPOA 4FW8A 5HIAA 3WNVA 3NZEA 2O3TA 3NOQA 5I7OA 1RP1A 1ZO8A 2I7XA 2Q2WA 2B3DA 521PA 4UTRA 1HNWB 3STVA 3FSGA 1EBBA 1OFHA 3F6CA 1DRVA 1CIVA 5CDGA 5CGQB 4E5NA 1EGQA 5KC9A 5EJEA 2CUTA 2G1KA 2JBAB 1TIKA 4KXUA 1JH8A 1U8CB 4Y2QA 4CEIB 1RRFA 4G67A 2VP4A 4DZTA 4TWJA 1W0KD 5DTQA 3OJLA 3QWIA 3N39C 5ES4B 3VA7A 1N5IA 1FSSA 2HCRA 2J3LA 3AETA 3MERA 1WBDA 3Q85A 2OB1A 3UZUA 3E7XA 2XQFA 3ORRA 3P52A 3GARA 1KMNA 3ZK9A 2IX3A 4TKLA 4PAGA 4CL0A 1TZBA 4KGDA 5CFOA 5D3MB 1NXXA 3DVAA 5J4LA 2OQ2A 3GH3A 3L01A 5CNMA 5T4EA 5EVCA 2FUNB 4KH1A 3Q40A 2VT7A 4ND6A 2PT7A 3Q72A 2CKMA 2DWQA 4ZRDA 1E79D 2FR8C 3ETLA 3VU9B 4ENSA 2VLIA 4PLPA 4WLUA 5HDQA 2WDPA 1PZFA 1SURA 2O2JA 4MYHA 2PS0A 3D6NB 2HWYA 1G5FA 2FHSA 4ZHQF 3L7IA 5KPJA 1DIGA 4FUQA 1TZJA 4MWGA 3KO8A 1K6XA 5ER9A 3TWOA 3Q10A 1HLFA 2AK3A 2O23A 2Q62A 1F0YA 1OAKA 2XLCA 4RPGA 3DDWA 1F8XA 1E2DA 1WR8A 2O06A 3UJPA 3KUCA 3T41A 3SE0A 4I6EA 3COJA 4YCMA 3P32A 3L8GA 2E5WA 1NLUA 3F3YA 3W8RA 3FZYA 2D0PB 1ZGAA 5EINA 3K6SA 5FF9A 3C6BA 1QCZA 2WU3A 1E0KA 1F06A 5J2TF 4DSTA 4L57A 5BURA 2Q3BA 4LOAA 4UBLA 4FJ1A 4WBSA 3IB3A 1WD5A 1I2AA 3AR7A 2KI5A 4HJRA 3T9CA 1YUBA 2DWPA 2B92A 5GY7A 3TR6A 2JHAA 3V6MA 2FETA 2QP4A 3TZKA 3ZI7A 2P1DA 4DIOA 3UN1A 3TZHA 1E2KA 1NUUA 2LR0A 2DBZA 4LK3A 5EG5A 3L8EA 3IOCA 2YZGA 4POOA 1J2TA 1JDTA 2PZMA 4P34A 4MS4A 4PFKA 3W5JA 3NHUA 4QSMA 3OZXA 5A3RA 3RVOA 2C3YA 2A84A 1HFEL 1R6TA 3E5HA 1NU6A 2EL7A 3CRMA 3R6TA 3NMUF 1YR8A 2IY9A 3TLKA 4FB4A 1BVYF 1YCDA 4RENA 2VA9A 4O2AF 4CTKA 5JVDF 2HU8A 1MRZA 3P0RA 4PBTA 5K8IA 4IFEA 4O0LA 4ND5A 6REQA 3KHUA 4DUPA 5JEJA 1N0HA 3K9QO 1A7AA 2A1TR 5CDHA 4QPCA 1D4ZA 4BCCA 4Y2TA 1SXIA 2Q4TA 4GGMX 5KTPA 1YZFA 3W05A 4Q1CA 1QHEA 2X0DA 4Z4CA 4Y3UA 3CMCO 1SO8A 1A1SA 3DBRA 1CQIB 2IYLD 1Z0SA 1I3CA 4LXIA 2WVJA 3KYDA 1H1LA 4HMOA 3EQ6A 3VSBA 4ALMA 2AD1A 4IJ5A 2PUWA 4KB5A 1YA6A 2W2QA 2I2AA 3U4AA 4G5RA 2E4YA 3GLRA 1X1QA 4MYRA 2HPAA 3IXMA 4QXPA 4AECA 3MMNA 4F5ZA 4QQFA 5C52B 4ZARA 1BWSA 3N7UA 4AJHA 4EG1A 2E4UA 4QXAA 1DJLA 1OMOA 2VPXA 5AKZA 5DNEA 1D0SA 2XMSA 2OXFA 2ISQA 3TL3A 3FTNA 1M8FA 3O94A 1N2GA 1ZG3A 2OYSA 4OP1A 3N0VA 3T6KA 4JP2A 3JARA 4X65B 1XZCA 3GVXA 2PR2A 3IAS6 5FOVA 4N0PA 4UJ3A 1C0IA 1T0JB 2YYZA 3WA6A 4RL4A 5AVSA 2HQRA 2VCHA 2Z5FA 2FZ4A 1J09A 4N1AA 5TRTA 4ETWA 5KREA 3HWWA 4MPTA 3A6PC 4QGFA 4QDXA 2Y76A 1ADYA 2I7VA 1U7VA 2V9CA 3KLPX 3ISVA 4F85A 5A2QA 2YQ4A 2FEKA 4TTVA 2GBFA 3I8OA 4DLSA 4JONA 1C3OA 1U1CA 3V7FA 2P5YA 2E37A 1Z2AA 1OF1A 3MJHA 3CG4A 3FZEA 5KKAA 4XYGA 4TTTS 5E0KB 1SNYA 4OHBA 5I7HA 1ETUA 2C77A 2R2GA 3HZHA 4JYZA 4BMOB 4KN6A 4BV3A 1M0SA 3W1EA 1BVHA 4YP9A 3DONA 5FTWA 4RH0A 2JGIA 1DLJA 4LTMA 3ZHCA 2G76A 2B20A 2I76A 4MLCA 3OPMA 2A0TA 2O05A 3WMRA 4D4IA 1EXDA 1UJ4A 2C2ZA 3PDCA 3D3JA 4MP3A 4P81A 1DAKA 2LIVA 1XRSB 4GKVA 4US0R 4CQLB 4AL4A 3GEPA 4LK2A 4ZZ3A 1PR0A 1TRKA 5HOQA 4GVXA 1BW9B 3OZEA 3PA8A 3R7NA 4GR5A 4YO8A 1JEYA 5FAKA 1KMHB 5FWYA 3HMQA 4YRGA 1W581 4DR2B 4WWHA 1NKSA 2OFWA 1PYOA 2NM0A 4NBTA 3QUTA 3WYCA 4D8XA 1KDPA 3A32A 3OQNA 4GVLA 3DL2A 4DJJA 1CUHA 4EATA 1DC3A 2VYVA 5CK4A 1RP7A 3QWAA 3EOBI 5LQAA 4AZSA 4NESA 1Q7CA 1L6IA 2IODA 3D2CA 3VH1A 2YX1A 1UXJA 2G80A 2IZ0A 3K1AA 4ONEA 1KE2A 3CCBA 1AC5A 3M1YA 3T1NA 2GM3A 3QVTA 4OOFA 3C6XA 3LRTA 1XT6A 2CLFB 2PU5A 1WULS 5AUPB 5I9BA 3S5JA 3LUPA 1C8LA 1L5FA 2QLTA 3BMCA 1L9XA 3CTPA 1MOSA 1LLFA 5EHNA 3V2UA 3OFKA 1IH8A 4D44A 3ZVMA 2IITA 5HIJA 3STYA 1I3LA 3JZMA 4BVFA 1PU2A 5HZKA 1E6KA 2QUZA 5I7WA 5K6AA 3JAMA 3BWMA 2Q5IA 1IAVA 2ADOA 1EM6A 4YRZA 1F4VA 4UCFA 1ZGGA 1FU4A 1DWQA 2O2HA 1YBFA 2J9ZB 1FU7A 3C6MA 4Q19A 4B3HA 2NO4A 4MH0R 2IEAA 4HBZA 3FTFA 2HX1A 3G9ZA 4BO9A 1EDEA 1OZAA 4XFKA 4C6RA 4Q9AA 4PHHA 1TVKB 2AYXA 4Z8YA 2FQWA 3R7BA 1Y4DE 1UXIA 4RLHA 2VTBB 1E60A 1SZJG 3A0RB 3MK31 4MICA 3IQXA 4OB7A 1D07A 2VK4A 1DXHA 4QELA 5KTYA 1CUJA 2AN9A 5K45A 1SBNE 2A9JA 3W3AD 4IR7A 3ZW8A 2EFJA 3FJYA 3IQEA 4KC0A 4WPGA 1T6ZA