2I2FA

Crystal structure of lmnadk1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
264
structure length
262
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGNGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
total genus 69
structure length 262
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 2i2fA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 2i2fA01
2I1WA 3T5PA 2JGRA 3V8PA 1Y3HA 3V7UA 2I2AA 5EJFA 3V7WA 3V8QA 5DHTA 2BONA 2I29A 2I2DA 1SUWA 1YT5A 1Z0UA 5EJIA 3PFNA 4HAOA 5DHQA 1Z0ZA 1Z0SA 3VZDA 5EJHA 2I2FA 3V80A 4DY6A 4V24A 3VZBA 2I2BA 5EJGA 2QV7A 3V7YA 3V8RA 2AN1A 4WERA 3S40A 3AFOA 1U0TA 5DHUA 5DHSA 4L02A 4WRRA 3V8MA 2Q5FA 5DHRA 3V8NA 5DHPA 2P1RA 1U0RA 1Y3IA 2QVLA 2I2CA 3VZCA
chains in the Genus database with same CATH superfamily
2WD7A 5DBGA 1RYZA 4Y18A 1E3DA 3LU1A 2QXTA 4KE8A 1U65A 1SBNE 3CBQA 3JYOA 2OAEA 2OV8A 1EP2B 1P1IA 2JGLA 1A96A 2VDWB 4OKNA 5ARCA 2E4YA 5KTPA 1TPYA 2G3YA 3O8OB 1BO6A 1GV0A 4ZTBA 3RHTA 1P0FA 3EMVA 4BMXA 5KNDA 1NU8A 1Y3DE 3O4RA 3KNZA 3LZ6A 1ZVVA 1RKXA 3B1JA 3M6FA 4JKIA 4OM8A 3KBBA 1UAGA 1DJMA 1DBRA 2ZVQX 2RHMA 1L4LA 5L7YA 3OHPA 5EXPA 2WIBA 4YGXB 3B5IA 3FKJA 4V0QA 2Z83A 3QFSA 2CLEB 4M9XA 4P08A 1E4VA 5H81A 3V1KA 1NR5A 1NULA 1Y34E 2ATXA 4GMHA 5HDQA 3L9XA 4JNCA 2FNAA 4LV6A 1R0ZA 3O9VA 4NVRA 3U44A 4ER6A 2OO3A 1QGDA 2XZTA 5DOVA 1KOLA 1B8OA 3L8ZA 4P1ZA 3HABA 4A73A 5TB5A 1G21E 5DH9A 3CZ4A 3A3NA 2C7BA 2C8JA 4BWFB 4UUPA 2ZBQA 2W3OA 1XP8A 4CIXA 5EXDA 4Q05A 6GPBA 1MV5A 3RAGA 3RUCA 1DXHA 1LPSA 4DYDA 4ZI7A 5JVDB 4AS2A 1M2EA 3LXRA 1AT1A 3L92A 5BN1A 3AVXA 1O9GA 2A14A 3KZKA 2QZ4A 1K8YB 2G80A 2G67A 4BU0A 1Y9JA 3QF7A 4ESEA 4ZMSA 2YN2A 1M0TA 3T3NA 1BD4A 3CUVA 1M8GA 4KXXA 2J3JA 1YGPA 3S1LA 3ZD6A 1R0RE 1T15A 4ID9A 4BV2A 4DUGA 2GO1A 1DRVA 2Q46A 2QM3A 2RGYA 3CF6R 4D5EA 1L5FA 1X0VA 5DHAA 2FZEA 8OHMA 2W6CX 4QOEA 1DQSA 3BH7A 4MOWA 3PL5A 4B32A 3UZUA 5AVUA 2XUJA 1D5CA 3WIOA 1O58A 2JHCA 4ZQCB 1V8BA 4LYGA 4LGMA 2H48A 5EPOA 5L6MB 3ITKA 5B1EA 1JEAA 2XODA 3N0RA 2WKQA 2WKSA 2XLCA 5TQ0B 1IBLB 2C7GA 5EJAA 3DF7A 1QZTA 3LBIA 1KHXA 3UJCA 1GKKA 5JISA 5DHFA 4GEGA 4L0QA 5EIFA 3NBFA 3ZY6A 2WYWA 4CF5A 3E81A 4P2GA 3SJAA 5DNCA 2R97A 5KYKA 4LVNA 4G0PA 5BW8A 2JIZA 2QL6A 1Z7BA 3IGFA 5IC4A 3ANLA 4U5XA 3V7NA 4R8RA 4S12A 1E4OA 2QRJA 2QW1A 1ZA2A 3WJAA 4AJNA 1HWYA 1MO4A 2ZI9A 4WGFA 4WA8A 1P4RA 4OHCA 2HGSA 1JWLA 2ZSDA 1KS9A 3PX2A 5T3UA 3TLGB 4AS3A 1JJ7A 1L5VA 1V4NA 5LD2B 1GP2A 4KIFA 4OAQA 2IYFA 4RX1A 1TZBA 4W4TA 5HNKA 2XUKA 3Q3VA 5KYWB 3BQNB 1SCKA 2X2PA 3PPVA 1IQ0A 2BEVB 3AL2A 4IY1A 3SM3A 4EGJA 2B8WA 2P9QA 4GQBA 4NK4A 4RVOA 1Q74A 3PD7A 4YUWA 2W6ID 5MGBA 1DZ3A 1DINA 1FFAA 2YS7A 4HYTA 1U1CA 2RGCA 4QBTA 4J03A 2VF7A 5CYFA 1YHYA 1R3UA 2GBLC 3KR2A 2QF7A 1XJCA 4FHFA 2L0XA 3ZH2A 1YULA 3GNSA 5BV2P 2ZYAA 2PBZA 4XEHA 3TAUA 3WKAA 1CIVA 3EG5A 1D1QA 5CLLA 3MJEA 1UOOA 2VDPB 3LKVA 4MRVA 5CLQA 2AUTA 2BGTA 1P8JA 1XDGA 2PWBA 5CJ2A 5EJFA 2W37A 3K96A 3CX7A 4FI3F 2I7XA 1OF1A 2GHIA 1L4EA 3ZU3A 2F00A 3HJUA 1JTVA 1VYUA 4JLSA 2CLCX 3OOWA 2SKEA 1F60A 5CJPA 2GHTA 3GLHE 3ER8A 3Q10A 4X6LA 3OE5A 5FOTA 3VV2A 1E2PA 1SY7A 1X86B 4K46A 5JECA 4EMTA 1FNMA 2JFOA 1V8PA 1YVEI 3NHJA 4OX9Y 1NMQA 3VVCA 3NIDB 2QX6A 3U40A 3ZX5A 3GRKA 1EE9A 2FW8A 3HB4X 2C2XA 2BFMA 1TMGE 2DLDA 2ZB7A 3C3JA 5DHPA 1KDTA 2CWWA 4DA8A 4PQYA 2WUWE 4TX1A 2PNJA 1XO1A 2AF3C 3ENQA 1AB6A 1T4BA 5J63A 4GEKA 4D80A 1TPZA 3V32A 1U7VA 3FPKA 1O0SA 3AQIA 4RORA 5HKLA 4XTRA 4B6FA 3U0BA 1GGNA 2Y1WA 1VGQA 3LG2A 4QTZA 1PJAA 4CR8A 3DCNA 1TEZA 2KBFA 4EI7A 1PSWA 1ZMRA 4CMHA 1UBFA 5ENVA 3LM8A 3W5CA 4GSKA 5K8TA 3WGHA 1WETA 2FUCA 1NIJA 1DBIA 4S2EA 1GQ2A 3C8ZA 2FJ0A 3FWZA 3P97A 4G0NA 4HUQA 3IP5A 4RZHA 4Q9IA 1ORDA 3LYUA 3OT1B 5DGTA 2VA9A 3HJRA 5GV8A 1FK8A 5CB4F 2J3LA 2V58A 3QIVA 3G9UA 3EZFA 4QGBA 3SMVA 4NOLA 3EB9A 3GLKA 5DGHA 5H7XA 3IP3A 1YJMA 1QKJA 1OFHA 3BMCA 4H1HA 2HHAA 4NU6A 3UQZA 4UOEA 5A6VA 1NG1A 1V7CA 4GPBA 3SYRA 2W2PA 3LWBA 1RYHA 3HKCA 1FX1A 1Y1LA 4JXJA 2W0MA 4U9IS 1L5SA 2B5WA 1OLXB 3GVHA 3LV8A 9MHTA 2WB2A 3QUSA 3W9YA 4DCMA 4PG4A 4TTAA 1E9RA 1E3TA 3K2BA 3OLZA 3RRBA 4JYMA 3OECA 5AKJA 4PIMA 1EXWA 3M6LA 1SRQA 2IUTA 2AS0A 1P2TA 1NW3A 3ZHUA 2C4VA 2Q6OA 3VGJA 1DE0A 4U7WA 2BFBA 2QLMA 1TTHA 3SP1A 2ZTVA 1UF9A 1XA4A 1TCVA 4JLWA 4JT2A 4YPVA 1E7SA 4BP1A 5JSKA 5KTOA 1EUYA 4Y0VA 5DT2A 3DQQA 2AGVA 3PENA 4H7JA 1IYZA 2ZS8A 2V03A 4AWXA 3T7JA 5EHNA 3B6JA 3GBSA 3Q8XB 1M2WA 1W4CA 3OJLA 3BTSA 3K0SA 1QF6A 1HTBA 2C58A 3BJRA 5DLYA 3EZLA 5HF9A 4QDTA 3ICEA 2EV9A 2PGNA 2R1VB 4K9DA 5MFPA 1V0JA 2EX0A 4AZWA 4MS1B 1ZJ6A 2ZT8A 3WJ1A 1CW2B 4F9GA 1YJBA 4BTVA 2ZYTX 1JBEA 1SPXA 1PFUA 1SXHA 1ZOPA 5FWDA 1G1MA 2CHVA 5LP6C 3U3DA 5GWXA 4NF2A 4D9HA 821PA 3R8CA 4URXR 1DS6A 4CM1A 1TGYA 2XCIA 2YZGA 2BFDB 1W9MA 2NTYC 1I3NA 3VI4B 2C5HA 2VJBA 1KRHA 2HRZA 3AF2A 4J90A 5AH0A 1XPRA 2H92A 3ABOB 3G9TA 3IE2A 4LOAA 3FDZB 5FEMA 2NM0A 3O2QB 4WFQA 4TWRA 3NH6A 4YV7A 3CWQA 3UT5A 4AUMA 3DNMA 2O6HA 5CRIA 4WFIA 1E32A 1XMVA 2FOXA 1H2ZA 4BJ5A 3D6FA 4OGLA 2GPYA 1DAKA 2KE5A 3VPHA 5JEJA 4NL4H 4PZDA 4C3VA 4R81A 1XQ1A 3K6SA 3RAEC 3VKUA 5A04A 1NJ6A 1VE6A 4Q3AA 1RLMA 1GLNA 4GP6A 2X0DA 1Y1TA 3GEIA 2AFIE 3OURA 3SVLA 4MGYR 2HWUA 3R0XA 2XMDA 3OX3A 2ZQZA 1ODCA 2QR2A 4PLHA 4R8SA 3U16A 1VBFA 1JYSA 2ZUDA 4LX8A 4MS3B 5BSVA 1GT6A 3GP8A 1FRQA 2J9FA 3W2EA 3UMCA 3WWEA 5E2BA 4ARUA 4MK4A 3M5WA 4DJTA 3NJRA 2PX4A 3A3OA 4XZ3A 1ZD8A 2N42A 4MA5A 5GONA 1U2SA 2B4QA 4BIIA 5A9RA 1DQNA 5A02A 5A7HA 5I7SA 4BKPA 3ZZ1A 2YV2A 1OIWA 1XTVA 1XEWX 3KE8A 3JX9A 5IKPA 2N9UA 2ZBUA 5GOZA 3ZCUA 3DQPA 4QYXA 5KYNA 5FWAA 2R2GA 7MHTA 3U62A 1JR4A 2RH4A 4CTMA 1GN8A 1P91A 5FR2A 1OIXA 3ILHA 1CFZA 1XKQA 3CLSC 1K3JA 3R0IA 4JD5A 4BFWA 1NQXA 1TQ6A 3KQVA 3ZXSA 3LT5A 2JQJA 4MP3A 4Q4AA 4IQ0A 3R0QA 2BV3A 3AI2A 1AQNA 1QIGA 1ZSNA 5TDHA 4JP3A 3D6TB 3V9PA 16PKA 2QG9A 4RQTA 6ABPA 5COQA 1SD5A 2DPHA 3QI7A 4M1TA 5B58T 1L8XA 1B93A 3GMTA 4PGMA 4J7CA 4NATA 4ZAYA 2OZEA 2VT2A 3C3KA 3OUUA 3KD2A 4L15A 2P6PA 1J1ZA 4UEJA 3W7VA 5IK2D 2E5FA 3HP4A 3WMEA 4RA6A 5KAMA 1U2PA 3PNPA 5A71A 4HADA 1BS1A 3L8GA 1LXCA 1W29A 4PSAA 1J0BA 1TZ2A 2Y0DA 3QRWA 1TZJA 2IWRA 1YUBA 3TQRA 4DJAA 3FFAA 4J0IA 3V8NA 1V11B 2QL5A 3DL0A 3M9WA 1TMYA 2AZTA 3E35A 2IP2A 4YJGB 1MQ8B 1JG4A 3PIIA 4Q66C 2UVPB 1XVLA 3GLHA 2DJ5A 3WRYC 3M3PA 3IUNA 5CFOA 2OE2A 3JVEA 4TKUA 2J9YB 2P6UA 2ZRPA 1P0CA 5KVQA 2XT0A 1T1RA 4FZJA 4KPUA 3L7BA 2FZKA 2RIRA 1UJ6A 1LPOA 1GV1A 4LOJA 2WTNA 3LDHA 3MVEA 3E4DA 3N2IA 5CB6A 3GLGA 1SKMA 1VLJA 3WO0A 4Z7JA 2W48A 2QRZA 4AAYA 4O2BB 1T6YA 3LVFO 1B6GA 3CNQS 2W7TA 3DUWA 2CKMA 4AP5A 1GILA 1WX1A 3FCYA 3VJRA 1QOQB 2D8MA 1RI5A 2QHXA 1OI7A 4RVFA 3VISA 3WMXA 3DVAB 3LP5A 2Z2KA 1ZRHA 4OBWA 1GNRA 2ZUCA 1E18A 2ROQA 3IAHA 1QUFA 3IR6A 2CSXA 4XYGA 1JEQA 2NT3A 2QGFA 4Z9XA 5K0NA 1B6RA 2LW7A 4HFJA 4ODIA 4U2CA 2GYWA 1ML3A 3DEFA 4EUKA 4JI8B 3CF4A 1EEXB 1R37A 3F3KA 1NMEA 2DUUA 2IP4A 5ESWA 2YNMC 4H0FA 5SY6A 3RQSA 5ALGA 2C98A 4KB5A 3CVOA 2NXCA 2LXNA 5THQA 4QCJA 1KGSA 2AI3A 3QENA 1QVAA 4KLCA 3SBOA 4F91B 4G5GA 1IAQA 1TUBA 5D8DA 1BROA 1U04A 1U0LA 2CCGA 2ZSAA 5AM0A 4QYSA 3ZD7A 4P22A 1BRMA 3HB0A 3MDBA 3ZGYA 4CM7A 4B5LA 4EVIA 5F21A 5I48A 2Q6VA 1DUVG 4X1KA 1XK7A 1KJJA 5JEKA 3BX1A 3ET5A 1RYEA 4TMYA 4YRRA 1KF0A 5E95A 5BW6B 2VCHA 3OZXA 4P3YA 3R8XA 4C29A 9LDTA 2ECQA 1QHEA 2X5XA 5I9LA 1WLYA 4OMFG 4EVSA 5HS4A 4BATA 2OFOA 1NYTA 2Q1SA 3IHTA 3VQTA 4DIFA 3PE4A 3N9IA 5SY4A 1F17A 1XC7A 5A2GA 3U31A 2XUZA 1EH5A 1FDRA 4R6XA 3P2EA 4LISA 2WF5A 4LWOA 4RSGA 3VV3A 4PSCA 2HCRA 1QZZA 2A5GA 3CUKA 2Y77A 2GBIA 3K6RA 4CQNA 3N7UA 3FA2A 5E6RB 3HKDB 1QKIA 2WG0A 4MQEB 1UZUA 1FYEA 4OY3A 3S7TA 1EJ0A 2E4UA 4B73A 4HDKB 1YOBA 1XXHB 2DHRA 4LJ5A 2AWOA 4JBXA 4QUHA 4NENA 4UAJA 3D7KA 1W6UA 4HX9A 3PE3A 4IIUA 4NZMA 5GINE 1EVZA 4WJLA 3AG6A 2GX6A 3QWBA 4PCUA 4DSUA 4EHIA 1F5NA 2CFIA 3QK7A 3UAZA 3DMTC 2RAPA 1JX6A 1U99A 3STTA 1XZLA 5IWCA 2FWRA 2BSXA 1BQEA 2ES4A 3EJWA 1IBRA 3H2ZA 3HL0A 4TL8A 1RQXA 2F64A 3H84A 4P82A 4WUTA 5T3YA 2FP4B 5DNAA 2RAVA 4JEHA 2WTXA 4OXXA 4ZT2A 4DV0B 3FI0A 2C83A 1PT5A 3W1WA 3EN0A 3OZFA 3NCTA 3LKDA 3H2SA 4Z9AA 3ORYA 4L28A 3SMQA 2R0QC 1ULHA 3Q9UA 1OWNA 4YT2A 2V3CC 1NPTO 2GN0A 4KIWA 2AJLI 1KIMA 2FXVA 2ZLBA 2FU5C 1RJGA 1C3VA 3AYXB 4IOKA 4DWOA 1Z2AA 2D3WA 3FTDA 2XB9A 5JBIA 2EIHA 2VJNA 4IH4A 5CA1A 1AUVA 1QWSA 4B3DA 3ZZMA 2DFTA 1H0RA 3DO5A 3NASA 4FK8A 4QXOA 3FZQA 4ZYUA 4JDUA 2DLCX 1PX2A 1OQAA 2CXSA 5LLTA 2ODPA 3NYIA 3QBTA 3OEYA 4BBPA 5HOEA 1AHNA 1J25A 2Q3LA 1CLUA 1RJ9B 1U1EA 3B82A 4EY7A 3AM1A 4CM6A 2ATEA 4MI3A 2Q5LA 4R1TA 4B84A 3AVQA 3GFTA 5LBUA 4DQLA 1GN9A 1XYGA 1V6SA 2CNLA 1RLTA 2DECA 2I4TA 4GOXA 4Z2AA 2I55A 1Z4QA 1PHPA 2GCOB 5BXQC 3WAJA 4JNKA 1DHRA 2CY0A 3DMNA 4ZOLB 5BV0A 5I4IA 1HNNA 1U94A 3ABQB 5I47A 1WQ4A 5A3VA 1U0FA 2WV9A 2NYRA 1ES9A 2WOJA 3ZBUA 1Y4SA 2FW7A 4EA9A 1YCGA 2QQFA 5MHTA 1Y4DE 2R6JA 3BMNA 2ATIA 4FIZA 2PU7A 3SG0A 4JAVC 1BE8A 1KWGA 5H3CA 5F23A 2ZBVA 1RXCA 5IH3A 3PXGA 4QLOA 1CF9A 1HQDA 4KBFA 4BMVA 4ERXA 2Y3IA 5JWOA 2RI1A 2D59A 2C9OA 5C5CA 3KDAA 4IQ8A 2PEYA 2XGSA 3D64A 3ELYA 4NK5A 5F4ZA 3CXUA 1RHKA 1RXIA 4TZTA 5EQFA 4UDXX 4EHHA 2WMNB 4RL6A 4F3NA 4LDPA 2QAJA 1Z5VA 2GCIA 1BXRB 3N3BC 5D85A 4EJMA 4IZ6A 2UZ0A 5CLJA 1JL3A 3DTVD 4NENB 3ZWCA 1ZKMA 2ZVDA 3F5MA 2XCSB 1UQRA 3NC4A 4IIJF 4DMLA 4ZAXA 4HLQB 2JLWA 1T4GA 3GLVA 3BQMB 1UUFA 3EZ6A 4XB1A 5EYPA 4HSEA 2XTMA 4DLBA 4F4IA 2ENWA 4EKYA 5JY6A 3EGXA 1EFRA 3VR6H 3VSBA 4HVLA 3OM1A 1X92A 1YS9A 2FQ1A 3LQ2A 2FG6C 1L5GB 1YT5A 3P9XA 3H2IA 1W0CA 3V34A 1J7JA 1UP4A 2H4JA 3OSUA 4R54A 1XQ6A 1NNEA 5CLHA 1E7MA 1Z5PA 5JQWA 4HY3A 4JU8A 4Y6OA 3PR1A 3VH3A 2XD4A 3CB4A 4RK5A 1P2FA 3RBXA 1VB3A 3KCQA 5GIOE 2R86A 3C7AA 1U31A 4LRWA 1J23A 1J6UA 1E69A 3EARA 1FUIA 1NBHA 3BE6A 1ZS9A 2SHKA 4YYEA 3ESZA 1ELOA 3WO1A 3MHPA 2BHLA 2OWEA 3OLCX 4HDQB 4NYJR 1D7OA 3DVRX 2I9PA 3BRQA 1MEJA 4P83A 5JZBA 1N6HA 4YRCA 2IZ6A 1R6UA 5FPQA 3PS9A 4RVGA 4CKBA 1WXQA 2ZBPA 1P29A 4RJJA 1IBKB 2B0JA 4TRNA 1TW2A 3IMKA 4Q7JB 4OQYA 5BVGA 2CUNA 5BURA 1EE1A 1RMYA 1JDJA 1T9AA 1C4WA 3NLLA 3F5DA 4B76A 2FFJA 1OWLA 2F9FA 2P2SA 2PGOA 3IHWA 3IPYA 3LWZA 2UZ3A 3ODGA 1M8PA 1X7HA 3ZW9A 4ZO8A 2PSHA 1Y98A 2CSWA 3SSOA 1QDEA 2Q6IA 1ARZA 1PJCA 2EBFX 4GZ6A 3IO5A 4JMPA 5H9VA 1V48A 2XAAA 5DHUA 5C4MA 3P96A 4ZOCA 3RYFA 3I9JA 1IDOA 5ITVA 4X1IB 2VQ3A 4DQ0A 5IT0A 1EGVB 2FQQA 3LT0A 5T7BA 1GXSB 1H4SA 3DXYA 4P7GA 1KJZA 1R9GA 2CXPA 2Z08A 5FEUA 5JRJA 4KFRA 3FOBA 2Y67A 1ZISA 2XZOA 5DM60 4BMNA 2PX0A 3I2GA 1FW6A 3GFQA 1K0FA 1MF7A 2P9CA 2VJLA 3JAWA 3QH4A 4WLUA 3R3ZA 4D43A 5G41A 3REQB 3PEUA 3BWEA 3KU1A 3PQFA 4N9QA 3GLGB 3G9ZA 4UASA 4Y9UA 4AMUA 4BFVA 5BOSA 1AUPA 4R84A 2G1LA 3IJ5A 3PQDA 4KPUB 4R2JA 3O95A 1ZFNA 2Q07A 3DEAA 4UZEA 2FMTA 2XMSA 1N9KA 1UKEA 5EE9A 2VPQA 3MLBA 1QF9A 3L8HA 1SQSA 1AUOA 2XT9A 1CEQA 1GPLA 2GN1A 2VYVD 1N57A 4L27A 1W88B 2EVWX 2ZIGA 4D0NA 3SFZA 3WHIA 5ER6A 2X58A 2YUIA 1XVUA 1WBDA 5K1ZA 1N3LA 3DAFA 3S44A 3IUBA 3VHQA 3NO4A 5A1JA 1BJRE 4YP0A 3JQRA 5AM5A 4LC0A 4RPCA 3Q8WA 2ZI7A 1NYQA 4Y0NA 1KDVA 2HHCA 4E21A 2OGWA 4WXMA 3IAS1 1K8ZB 3JZAA 4BAUA 1NP3A 2VFAA 1TZMA 4J94A 3H4VA 4YEDA 7GPBA 5CVUA 2RHHA 4IPTA 3B9BA 3LCJA 4N03A 1GQOA 1SVNA 4UNPA 4MNTA 3RSCA 5A4DA 5JS2A 2BGNA 3ACDA 3EWIA 2I3GA 3CKMA 1GD1O 2VAVA 4YXWA 1FP4B 3G1TA 5FADA 4D6XA 3QE9Y 1QCDA 4J0DA 2FMUA 2Q5IA 4S2UA 2R7LA 2XWJI 1X0XA 1CUZA 1L1RA 1L2TA 2XH8A 3AI3A 3CUTA 1I6WA 2VYCA 4PPYA 5K8CA 1JJAA 4KRFA 3UAOA 3G13A 4QSHA 4LWPA 3I9LA 3MC1A 4HX2A 3DDNA 2PU5A 5CM9C 3IXMA 2YWGA 1UBOS 1Z36A 2QT1A 1FYFA 1RRPA 4NBWA 2J0VA 1PLJA 4HB3A 2AMFA 4ESVA 1K6XA 1Q0PA 3Q3CA 3RDPA 4AUKA 4G1UC 4BNDA 1OH6A 2I71A 1Y81A 3SEAA 5ALMA 2AC4A 3O92A 4ROSA 2F1JA 2EAUA 3C15C 4ENQA 2AN1A 4QNRA 3GMJA 3KLMX 1C3XA 1REQA 2G0TA 2PUJA 4Z8XA 3U7QA 1E1NA 3JYQA 3N53A 5AD1A 5FQOA 3O7WA 5DN6D 5JSUA 5LMNB 4BKRA 4F06A 4K6OA 2ZE7A 4RO0A 2EKZA 3E5MA 4W7IA 3IHLA 2RH9B 3ZN2A 4BNMA 4DY4A 3L1HA 1EEHA 2HBQA 1LPAB 1MC5A 4LZJA 1E3WB 2WJZB 3K9NA 3LT1A 1EFTA 2D0DA 1Y48E 1W88A 1RLUA 1VM6A 2K2WA 3V3TA 2CT8A 3TPZA 3TTSA 1WSDA 3NEYA 4OHXA 2WYOA 1O5TA 3GT0A 3WDLA 4JI0B 2HNAA 1QRAA 3ZE0B 1FYDA 5JNRA 2P90A 3PLRA 4FHCA 4LXHA 5JERA 1DKQA 1RYYA 2VO1A 1GCIA 1OYOA 3BMXA 1DFIA 3MGGA 1E2MA 2G77B 2XNDA 3X1XA 3S40A 1P18A 1NVBA 4J49A 1FDSA 1EI9A 2NTVA 2PANA 3UG6A 1YONA 2GOYA 2W6PA 2Y0CA 3L6UA 3U3XA 5KCMA 1GGVA 2GK7A 3GYBA 5AHXA 5DXAA 3A6EA 3W77A 3UK7A 2BRUC 3GXBA 4ZOLF 4ZJZA 4MUYA 5MN6A 1NBAA 3AKYA 1Y8ZA 3VKWA 2QM7A 1PT9A 3L7NA 2PYDA 1RW4A 4CJXA 3RADC 2ZIUB 1WU7A 1M83A 1A1VA 1E66A 3PA6A 2I5PO 3U80A 1EUDA 5JRDS 2ZPUA 2GK4A 5AKIA 3WWZA 1PP4A 1AQLA 1CX9B 1UPBA 1RRKA 3HMKA 3LLMA 1P7ZA 3BFVA 4WXYB 5AP9A 4AZ0B 4TYWA 4RHTA 4RKYA 3ZBQA 5EJ7A 4HNAB 4RMNA 4YCAA 3WS7A 1I4EB 1YSCA 3BIJA 4Y0AA 1B76A 4XLTA 3V7FA 2WSSD 4FT2A 4Y7DA 4KBGA 4BVKA 1YU9A 1OT3A 3P9KA 4JWTA 3U09A 3OC6A 4GW3A 4FXPA 4IILA 3K09C 4LDAA 2GZMA 2I34A 4QNMA 3WGMA 1CUJA 2VPPA 4LMPA 2F90A 4L76A 1P5HA 5TARA 3TBFA 2XHZA 4D8TA 4MYCA 1K7EB 2SCUA 4RF5A 1Z12A 2UVPA 3GLHB 5E6SA 5LP6B 1FNBA 1JR3E 1ONSA 1QAOA 1XXHA 3GGOA 1VPDA 4MWOA 3A4NA 5ALOA 2AG8A 4JJIA 4XIYA 1TO2E 3HKDA 1GVNB 2NZ2A 2C96A 2W90A 1XZQA 2X8LA 1LVUA 1MB2A 3OPQA 2P9FA 4JX9A 5CJJA 5AW7A 5F2KA 3KUCA 1A5ZA 4FMBB 1JPUA 3RWBA 2V5VA 4P5EA 1SG9A 3W2TA 2BR5A 1KWKA 3JRXA 5AESA 4Y30A 4OP1A 4F1KA 1K7YA 1SUBA 5DIFA 1L8QA 1RI3A 2HCTA 2QW8A 1Z06A 4BEWA 5HKBA 4DNOA 5CXUA 5CXQA 1N8KA 2HPZA 2ECKA 5EJ5A 5EYPB 4WNAA 2OHGA 1UH5A 3P32A 1JE1A 4HAYA 4RHEA 3UCFA 1ZLXA 3KUDA 4FZ3A 3TSOA 3DCJA 1C3EA 4BRWA 1QFXA 1C1XB 3NRBA 3GEDA 2H5EA 1NXTA 3ZPXA 2Q2OA 3CS3A 4RV9A 4US0R 2WTMA 2AA3A 4A36A 3CLVA 2HTEA 3DDOA 1M3SA 4E09A 1T6XA 4WN9A 4KR3A 1P0PA 3FM8A 3AEQA 2F6RA 2VLIA 2YIDA 5J4HA 4C4YA 4I66A 1BG6A 2O2JA 2C59A 2RGUA 2HA4A 4G6ZA 1MA0A 5DNVA 3E7WA 4AY6A 3ETEA 3NGMA 5D1HA 4KNVA 1I14A 3EVTA 1D4FA 2VHYA 1J8DA 2HWKA 2X40A 3CN7A 4QATA 3B6EA 3Q72A 1Z9BA 4FMDF 1OH7A 5E9JA 2GB4A 2ZDGA 4JJKA 4DUGD 4ZA2A 2NVUB 3NTOA 1RJFA 4B9EA 1A04A 1HFWA 1U8ZA 1LF0A 2VDKB 4MLZA 4BEVA 3IVCA 5IKEA 4RKFA 2HJVA 2PZ8A 4IF4A 1PKXA 3BVPA 3LPLA 1USWA 2J0EA 1TGVA 5M3BA 1QGAA 4U0JA 1UC9A 2OHFA 4RCVA 2GZ3A 2LIVA 5HFAA 5TMEA 1VG1A 3H65A 3KO8A 5CEFA 5L7WA 3H8WA 3AB7A 4K6FA 5CA0F 3G5MA 2EJWA 4KQ6A 1GFSA 4HDRA 1UBMS 3KB6A 4GKVA 4EB0A 1O94D 2B92A 2IZ0A 4QAQA 4GX5A 5FA5A 4CIBA 3L0DA 1Y5MA 4GE0A 4PSKA 4UTVA 3TLJA 4QEZA 4DMUB 3DWEX 1ZGHA 2IDJA 2RGAA 1ND6A 4BN5A 5IKMA 1NL3A 3OLWA 3FOZA 1YTUA 1T2NA 1OUMA 1A98A 1KI9A 1P2SA 3BOSA 1QV7A 1ULBA 2XDQB 1Z4KA 1QHGA 2OUKA 3S2YA 4ZZ2A 5DBOA 4QQKA 2E4ZA 5A3QA 1Z0SA 3DBOB 3FVRA 3R7SA 1KMNA 4QG3A 1WOMA 4BUZA 5HUQA 1E64A 4CM5A 3R7BA 3CZCA 3K30A 3MTBA 2VP6A 4RSHA 4NAVA 2C07A 4LYDA 5K3CA 5JMOA 3B2EA 1ZCAA 2IZ7A 4U7TB 3MWLA 4RIIA 1NW4A 2NYVA 2I6TA 3R6WA 4L2IA 2BGLA 2SBTA 1IATA 2V96A 3V4PB 2NXWA 4D4IA 5I3ZA 3WP1B 1H4TA 1UKBA 2V4MA 3ZY2A 1JI0A 1JFSA 4UDYX 5EP2A 1QHHB 3BPSA 3ICQB 4C06A 1UKCA 1XP5A 2XB2A 4BAGA 1BVHA 4IOJA 1ORWA 3DLAA 2AKYA 3MQ2A 5DTQA 1JQJC 3TYXA 2PL5A 4JLDA 5DCWA 3V1MA 4AJ2A 3ZWBA 4YMTA 2UXDB 3DE3X 3I2KA 5HEKA 4WV3A 3QNWA 5DKFA 4DJEC 3S68A 4MTCA 2R00A 1E1MA 3RRXA 5L45A 4JR1A 4FHZA 5IZ4A 1MT3A 5BVGB 2G04A 1P44A 5KJCA 4XGIA 5H3LA 3HFSA 4LJ8A 1UT6A 4YJHA 1BA3A 3LOUA 2J9ZB 1UANA 2NV2B 3WTBA 4PXAA 4C87A 1M6WA 5KKCA 5JS7A 3HA3A 3DZBA 1K5GA 3CKYA 2E89A 3LXXA 4L5BA 4MO9A 4M8KA 1NX9A 2CXHA 1E62A 5BQOA 4IJMA 1PJLA 4HP8A 3SYNA 1SAYA 4ALMA 4U2FA 4PONA 2J5QA 2P9HA 1YWGO 1GG9A 1W44A 5AK4A 3E0QA 4OAOA 2QR3A 4V0RA 3W6OA 4AXBA 5DVZA 1LBEA 3D6JA 3U4MA 1NR1A 4MS1A 1TEVA 5KSPA 2C2BA 4E2FA 1FFBA 3LDFA 1YZFA 5I4BA 1X7WB 3S81A 3N2KA 4PLWA 1NT4A 4BRZA 1DOZA 2OFXA 1Q95A 2RK3A 4WZAA 2IZ5A 4A2QA 3CT6A 3O03A 1UM9A 1FUEA 3P9SA 1DCMA 1HQKA 1X1BA 1XELA 2AT1A 4BNFA 4DKXA 5C7LO 1FMFA 3WISA 1NXXA 3I2YX 5KPDA 1RHQA 5CAEB 1VLVA 5JNVA 1YACA 3RGGA 1ADYA 4GOJA 4H31A 1KNXA 1FFHA 2VRWA 4MVJP 5C1BA 1K6IA 1JPJA 1UEIA 3AKEA 4L95C 4OJYA 1UXGA 1LV7A 2MIIA 4R2WA 3PC7A 5DCYA 4P4UA 3ZHSA 4Q1BA 5FLYA 4JQYA 1PTJC 1S96A 3VTZA 4PZEA 4AVYA 1TAGA 3B1ZA 2IYLD 2IPNA 4DM4A 4JB8A 3KLOA 3DZDA 4OLBA 1OLSA 2BR4A 1EG7A 5KIAA 1B16A 1DIRA 5TXGA 2GN9A 2BTQA 2PXAA 2MDTA 1JH8A 2FFHA 1SIBE 3FDJA 5BR1A 1HDGO 5EIEA 3NTUA 4NTZA 1BKDR 2MR6A 4AZ3B 1UXHA 4DF3A 1FVXA 1UBKS 2HHLA 3FFWA 4RPKA 1DUSA 3K05A 3PJEA 2OVFA 1G8JA 1DLJA 2YVKA 3N8KA 3Q7EA 1RHMA 4O3FA 2CMKA 4TTRA 3I62A 2WE8A 1MOQA 4KN6A 1FUKA 4ALKA 4NHOA 1IVNA 3BTVA 3WLRA 1G20B 4H17A 5D5HA 1AMUA 1GT91 1C3JA 1VJ5A 4P36A 4YMWA 4M0FA 1H6BA 2GI4A 3N0WA 4HQNA 2XJ4A 4DSZA 1G8PA 1SHUX 1W59A 5KYUB 1E59A 3NXSA 4YK7A 1UBTS 4E6PA 4FBLA 5A0TA 1W0KD 3LDGA 3PYMA 4OQPA 3WLNA 3COWA 1EBFA 2JLRA 3IQXA 5DTIA 5K0FA 3FUWA 1N7IA 1ZCFA 1L0BA 5AK3A 2W6JA 4M7WA 4LC9A 2YZ7A 2WV7A 521PA 5JO9A 3DFFA 1M2NA 1ZK2A 2VHVA 2I2CA 1KP2A 2QZ9A 3DZ8A 4I5IA 4RK4A 3UK1A 3G7SA 1YB7A 5CAEA 1WPXA 3P20A 3VU1A 5I7OA 4ENWA 5IDWA 4MWCA 1G0NA 3EW9A 4TZKA 5I7RA 3GBPA 3REOA 5DIZA 4KL8S 4YLYA 3ZUPA 3H05A 1Z0UA 1IEXA 2CMHA 3WWCA 3M6VA 1Y6JA 2IJGX 2ZRCA 1F06A 3LP8A 3QU5A 4BGIA 4YCMA 3ZC3A 2NTNA 4EH1A 2F1OA 2PWYA 3AERA 4EY4A 4QECA 5FI1B 3ER6A 1EHYA 1PQUA 2PZKA 1BIFA 2OK7A 3NQ41 4N6NA 1CJKC 3EGXB 1UDRA 2C3MA 3QUQA 3BWXA 5DNEA 5FFNA 2NUPB 3BFKA 2ZOSA 1QQ5A 4V2UA 5P8WA 1ADFA 3V42A 2ZFUA 3VHRA 1VYTA 1X80A 2B1IA 2F55A 3FCAA 3MILA 2YDXA 5TGDA 2GJKA 4JB3A 4BO6A 4EY5A 3INNA 4AO6A 1J4OA 1GFWA 4LHYA 1PUIA 1Z62A 2OPBA 1T4CB 2RJOA 4I50A 3EMKA 2GDJA 1V8ZA 3JD0A 1T10A 3M4YA 2CF6A 3OI7A 1CWUA 4LGYA 1TW3A 4RZQA 5J1SB 1K1EA 2BGUA 3M2PA 4YAOA 3G7NA 1AOXA 3I01M 2R79A 1NURA 4NKRA 2Q62A 3IXLA 5F5LA 5G0WA 2EFGA 3CM0A 3NORA 4YLEA 2G1PA 4OYHA 1NVWQ 1L4MA 1ULTA 3Q7RA 2PBFA 3AEKB 3R23A 2Q3FA 4IG9A 3U3RA 5M34A 2A5JA 4OOEA 4RVUA 4NNPA 3KTFA 1ZIDA 1AG9A 3AR5A 3ZLVA 5H80A 4MWBA 1XRPA 2HA6A 3MM4A 2W6ZA 4DPKA 3WIBA 1ISIA 3S2EA 1YRLA 3K0BA 5LXTA 3R9KA 2RHDA 3SLKA 3UHOA 5KWSA 3K2EA 2H31A 4GUDA 3F6SA 1C14A 2JLUA 2EXXA 2E21A 5B1HA 4O4LB 1DWOA 3HJGA 2PGIA 2R6AA 3CNLA 4ZI5A 1SA0A 3R7WB 1XDBA 1R5JA 1G1AA 1UBSB 4M1MA 4KHPB 3E1SA 2HK7A 1DL5A 2OD9A 2ZE8A 4MMXB 2OXIA 4J0QA 1C7QA 1ESZA 5E2IA 3ORHA 3KKMA 2H08A 3L01A 3TX2A 4H7HA 2LD4A 2KS6A 2WKPA 1SOWA 2QLJA 2NXJA 3KV3O 3N0VA 3OHSX 1PR9A 3A9RA 3MD9A 2P6NA 4HAWA 4JLJA 4U6NA 3VR2A 4XGQA 5JJ5A 3DOOA 3GUCA 1HE3A 1MX9A 1KI6A 3VA7A 2A9RA 4KVGA 4DCGA 5T4HA 3ZHTA 2QMYA 2OKCA 2H0AA 3W9UA 1N2CB 3V1UA 1RE0A 4WD3A 3AVOA 4OI2A 3OQ6A 1J56A 4OH7A 4YRNA 2BKEA 2P62A 1HTWA 2XVXA 3DWGA 1JTFA 3SXUB 1M73E 2DGDA 4OLAA 3EF0A 5JVDA 3DFZA 4YJDA 3OIGA 1D4AA 2JQIA 3HSSA 3ZDYB 1NI4A 1W46A 4C1NA 5BSHA 2CBGA 1CUCA 3K5HA 1VTKA 4HL6A 2VSQA 5HJ5A 1KPGA 2CVZA 2PSDA 1P2VA 4H60A 4KK4A 1S6YA 1T9ZA 2FWPA 1W34A 2PNFA 1NSFA 1BWRA 3HUEA 2HV8A 3C6ZA 3P9ZA 4FP9A 5SZKB 4B6PA 3AJ8A 1OWOA 5AK6A 3SQNA 5KTRA 3ZVMA 2QXUA 5AW0A 5JSZA 3WOHA 5AVJA 3GLFE 4X5OA 4BFYA 1NC3A 5IXYA 1VKNA 1NLMA 2RGGA 2QVCA 2C2WA 2QLNA 3ZU5A 1JB9A 2P30A 5ALXA 3K70B 3KTOA 2C82A 2JEOA 4EEXA 1RBZA 4N65A 1VI6A 3D3JA 3IDZA 2UYQA 1WKVA 4MPPA 3BWMA 4CI9A 1NXQA 4HMOA 4E5NA 3DQZA 2PR7A 1HI9A 4HMQA 3OKCA 3DNPA 3DZFA 3L8MA 3MQ4A 4DM3A 1ZN2A 4J75A 4GVLA 2QM8A 5EHZA 1Q0SA 2OHVA 1F4PA 2B4KA 2YJ6A 3TL6A 2ZRDA 3KWMA 2R8XA 1N6LA 1Q1BA 2QUAA 1YJ8A 4JHLA 1EB8A 2J08A 5H0IA 2J0UA 1FQOA 1W5AA 3KVNA 4KQ9A 1T8TA 1XDDA 2EZUA 4OHUA 2M6LA 1A9XB 3A4YA 3E70C 4C2TA 2O3JA 4Q1VA 5AUNB 4LOIA 1YASA 1IXKA 3FE2A 3TIFA 4AX4A 2F4VB 3TPFA 1E3JA 3SXUA 4D92A 1ZY2A 3WHLA 1VKZA 1FXSA 1PS8A 3AF6A 2EZTA 4EW6A 1NQWA 1ND5A 3DD1A 1KMIY 1J9ZA 3A37A 5J2TB 4N49A 4UU8A 2JATA 5LM3A 2FWMX 1C41A 2FK8A 2O3TA 2PT5A 3CJRA 4X61A 5LQUA 2UYYA 1SXJA 4FJ0A 1TVEA 3C6YA 5BSWA 5C35A 3FI9A 5EPUA 3O31A 4F93B 1C5KA 1H05A 2NUTB 4YDRA 1CUWA 4MZDA 4NU8X 2X0EA 3CVUA 5DTMA 1GUFA 2YW9A 3GGSA 3E22B 5DYGA 4Q5IA 3ZQJA 1WB5A 4DLUA 4HLDA 5ISMA 4M21A 4E6EA 2HSZA 1CY4A 2YNMA 5E6UA 1G21B 1QS0B 5SYMA 3WOVA 1QQAA 3EFHA 3K9FC 2CUZA 1BNCA 4YDQA 2O8CA 3W8NA 5AI4A 4LBVA 1E3WA 5C1IA 4EPVA 3CRNA 4L73A 4CNBA 5LNK1 2HQSA 4V0MA 4DA6A 4JCCA 3MTJA 4ZKDA 5AFSA 3IQHX 3KPYA 4U8GA 1OHHA 2YVAA 5GY7A 3T12A 3TGPA 3IV6A 5E9QA 2IYUA 1MZPA 4KPGA 3LC0A 5C9ZA 3IE1A 3WLKX 2J7PA 3B1KA 4YRKA 4QZVA 4KUGA 4N82A 4GICA 2IS6A 4A03A 2VN8A 2ZYVX 2HNKA 2REQB 3HKEA 3IC5A 3PVCA 2G83A 1K0UA 1WZUA 2P35A 4G26A 4Q47A 4L50A 3D6MA 1RIIA 1RM4A 2Q7DA 4BVHA 1DJNA 4C5AA 1ZU5A 1YR6A 1L5OA 1WD7A 3CUYA 3PUYA 4ND1A 1XN4A 2QTZA 4IJQA 4RA6B 5JQGA 4UBNA 1DIGA 4X3CA 3UF0A 1UODA 2O7VA 2P75A 2D62A 2IVZA 5D5PA 3JYNA 4OKIA 3RVRA 3HCNA 3IS3A 2O0MA 3D0KA 2FKNA 1MJ5A 4ZMRA 1FW8A 2WT8A 2ZJ2A 4IVPA 4KN9S 5JS8A 3EE6A 3FAZA 3FROA 1TCBA 3OFSA 3A4IA 4Y8VA 2P9BA 4C9BA 3PJRA 3JALA 4UPEA 3PTAA 3S29A 5A2QA 4H27A 2BDTA 1EWTA 4R2IA 2DBYA 4C2AA 3NBUA 1MABA 1XVVA 4LVCA 4E5MA 1RAFA 2JCGA 4JYZA 4J1TA 3VNVA 5ERXA 1PNTA 2XCTB 1J33A 1YDEA 4XOUA 1X7YA 3I37X 4QA9A 5J58A 5JNWA 2P27A 3ED1A 2B21A 2C42A 1NF3A 1ZXBA 3HCEA 3QBDA 3ZQKA 3GRPA 5BSKA 3JQAD 3RHSA 3HDYA 5AI5A 4BLRA 4CIWA 4FR5A 3FCEA 1DIHA 4BFZA 4W1QA 3T0FA 3I61A 3I1YA 4HQRA 2FZ5A 1SQGA 3BBPA 4KCGA 4E22A 1K7FB 3KYCB 2Q6KA 5B7NA 4WK6A 5M2QA 2QSZA 2XJ9A 3AVWA 3ONFA 1PL8A 1SCAA 3DE2X 1B14A 1E6EA 4G2NA 4WESB 1SCBA 5ALVA 1X1CA 3VMMA 1A5AB 4GPAA 3OZRA 4N3CA 3WBBA 4BGVA 4B3IA 4QTYA 5IUJC 4I1PA 2Z3VA 3OCJA 1A76A 2BBTA 3EH2A 4MDYA 4J3NA 3JAWB 1D0VA 3VR5H 1H2RS 2GYUA 1MVOA 5KU7A 4YXFA 3DXFA 1X80B 3OIFA 1R4MA 4J4BA 4CDMA 1B1AA 3WXBA 1NRJB 1X1EA 1F4VA 1U7TA 2PX2A 4FNOA 3UVEA 3IVXA 2X4IA 2Z5VA 2GK6A 2YIVX 3HADA 5KUTA 1I6KA 4MW4A 3MFQA 2ZIFA 1OJLA 3J7AC 1ACLA 1J9GA 1L7EA 1XZNA 3L6EA 2JFVA 2Y66A 1SH7A 4OP2A 4L78A 3KYBA 3GG2A 5CPFA 3KT0A 1PJ2A 1TX4B 2BGIA 4IXDA 4MV6A 4LSGA 3J81k 3BH6A 5FUXA 1HEIA 4JBGA 5H3HA 1CYEA 3TVDA 1HM5A 4ZARA 1G3IA 4IOMA 3OTIA 3KSZO 4EATA 1W2GA 1QR2A 1R4ZA 1P3Y1 1VMEA 3T7IA 2NU7A 1W1IA 4JY7A 4RQAA 3PQ6A 1NVEA 5M29A 1MENA 1DXQA 1OFUX 1T3SA 3DJYA 4D97A 5K3FA 4Q21A 4RETA 1FNSA 3G59A 5EMLA 3VPCA 4BVLA 5TE9A 4C4ZA 1H8HA 3HP1A 5LZ2A 2PT9A 2Q6TA 1TOAA 1W35A 3U3MA 4RGVA 1JDPA 4W1SA 4DIDA 3LVRE 4BNGA 2HXYA 1YQXA 2Z5FA 4GUAA 5AXAA 4WOPA 2Q7OE 3RU2A 3TQCA 3OTHA 4RHXA 4A23A 5LU8A 3A36A 1R1DA 1KEEB 3CRQA 3U9SA 1LBIA 3QEJA 4EJ6A 3E3MA 1Q17A 1D9XA 3R9WA 4IIDA 3EEFA 1DAGA 3UJ9A 3SXJA 4Q93A 3HUFA 1WCV1 4BZQA 2XYHA 4TMVA 1ICEA 1N2ZA 2W5UA 4O4LF 2HZ7A 3O7MA 5LYJA 1VGRA 4EUEA 5CFLA 1V7PC 2FEZA 3EEYA 2IT1A 3H5LA 3E7DA 2LNDA 4MWSA 1T2FA 3BRCA 2P5YA 4LSWA 5FNVA 4C89A 4RF4A 3LX6A 2QYSA 4FYIA 1DELA 1TO6A 2J31A 2IUEA 3K3PA 1Q20A 3OCYA 4RDIA 3VC3A 3ZHYA 2W2XA 2BRUA 4CV2A 3JQGA 3PX7A 2DHDA 4ZCMA 2PWZA 2EW8A 3GPDG 4EX6A 5CB4A 4HQLA 3EXHC 3GQBA 1TT7A 4QQFA 4R9NA 1GPBA 2FF4A 2HMTA 1K5PA 2XBUA 4UHFA 3VYVA 5KOYA 1N2EA 2Y1XA 2PH3A 4JA2A 5EWJB 1ZZEA 3DBHA 2BAGA 1LJLA 1OBVA 3SICE 1N1MA 3OA0A 5B3JA 1SCQA 1XAHA 5A9SA 4DNPA 5JATA 3W6UA 2H57A 4XW2A 4JLPA 4D98A 3OE4A 1F2TA 5EOVA 4DABA 4BQQA 3OP1A 1T3GA 2ALJA 1JG2A 4DILA 5CD9A 2CYAA 3P9CA 1DIAA 1TQ4A 4IFTA 4S24A 1L7PA 2GDZA 4X1OA 5TPZD 3ZCXA 1T29A 2GPNA 2FDCA 3OTWA 4CTOA 4FGJA 3NUQA 1IN6A 4Q7MB 3RT1A 4DWWA 4EG1A 3PHGA 5GPBA 1NV8A 3RSZA 4EI2A 4BNTA 1R4NA 2CFRA 5DHRA 3AHIA 6NULA 1ZSVA 1UPAA 1B0ZA 1OFIA 3B9RA 5C7IO 4YY3B 4ZO7A 2EKLA 1H6DA 1YBFA 1CS0A 1MJSA 1R0WA 3F0TA 2PZGA 3MINA 1ZINA 3GCZA 3VUEA 3O1IC 5JR3A 2G9VA 1MX1A 2AFIA 2PRYA 1GRVA 4RZIA 3DKKA 3KSUA 4RGBA 1P1JA 1K5HA 4BNUA 2QRQA 4KYTA 4TTJA 4ETMA 2JHFA 3JAMA 4LQCA 5LD2C 1SXJD 1UJ5A 3LOPA 7MDHA 5ARBA 1ZIYA 4D4GA 4LFAB 4AG6A 1S8OA 3OJWA 2H3EA 4GGOA 2EU8A 3AFGA 5FXMA 2B2XA 4ZVSA 5IT4A 2Z9CA 3IEXA 4YT8A 1A0OA 4AKHA 2Z2IA 2O8DA 1JLKA 2VF5X 3DMYA 3W5UA 1MW9X 4MUFA 4P3XA 2ZSFA 2HLHA 4IGIA 2GNPA 4LBZA 4L4XA 3V8MA 2H7XA 1AE1A 2RHCA 4K88A 5K03A 3QKSB 4QOHA 3RBZA 3UT6A 5L3QB 3G89A 1YFKA 4CCYA 5K6AC 3SBXA 5E3JA 1IMOA 1Q1AA 1PQYA 1U8FO 3E9QA 2V0CA 3QVTA 3HEBA 3QG1A 2R84A 5I7EA 5F5NA 3NWJA 1SCUA 2IOFK 1CQJA 1JAHA 3EIQA 4OGWA 2I54A 5E4YA 4H0NA 4BO4A 1A95A 4IFEA 4JGIA 4NBNA 5EMNA 2HCFA 4Z7NB 1K3UB 1XCBA 3QXSA 4PG8A 4KOAA 5G0TA 1SKQA 5JT1A 2Q1TA 2C7OA 2QYOA 4I1VA 2ILVA 2DQ4A 1U7WA 2YWXA 3TQHA 3D8UA 4B2IA 1OLUB 1YQEA 4M1EA 4CKZA 1VRVA 4XWWA 1WF6A 2XUHA 2Z95A 4MV4A 1O95C 2WWTA 3Q7IA 4TRJA 4TT3A 3DYBA 3MPUA 3ONWA 3OCZA 4N4AA 3I4FA 1HSOA 4HS9A 3KB2A 5JBNA 2BKAA 5ICEA 5LQCA 4I0WB 3P0IA 2ZYUX 1BHSA 3KJHA 4FFWA 4NRDA 3T5BA 3TKAA 3D8TA 5IHXA 4MKHA 2MWMA 3KT6A 3N8NA 4IRUB 4EB8A 1WPRA 3GRCA 2Q1UA 2FRXA 3ANXA 3E3LA 4ZJYA 5K3AA 5IBPA 1HO3A 4BYMA 2DTDA 3ER9A 3PR3A 4HAIA 1F3OA 1UQUA 3TW0A 1Q0QA 4GZ5A 4US1R 3WDKA 5I7VA 2OUIA 4E1VA 2R6ZA 4YVFA 2A9PA 1MVNA 3CLRD 3QV2A 4CVNA 1YH3A 1VSVA 1XCLA 2JIMA 3BEOA 4MV8A 4UEQA 1M8JA 4ALLA 1ONPA 5AUOB 1F0YA 4WNCA 3RTCA 1KMMA 1QVVA 1CUIA 2O2EA 2Z30A 3F9RA 1GRCA 1X38A 4N5LA 3FPAA 1J8QA 3P1JA 3CVVA 3I9V6 5THXA 4OA5A 3DLIA 1FTNA 3SNKA 4DLZA 1E3SA 2GF2A 3BWDD 3OZAA 2Y9PB 1EPUA 2HUNA 2IXBA 1KY3A 2VWPA 4IDCA 3JQ7B 4HH4A 3NP7A 4K9RA 3TRFA 2NXNA 5KTSA 2WSSA 4G97A 4RCYA 5AKKA 4KKXB 1Z0ZA 1E1YA 1ZLYA 4BV3A 1R9JA 4TVSA 4JZYA 3VOBA 1NNUA 1AH2A 2BH2A 3ICVA 1T3HA 1V1JA 4RVCA 4DR4B 3RRMA 2HSJA 5C7OO 1FS6A 2PN1A 2EERA 1UOEA 3DCYA 3HBNA 4V2IA 2VAPA 1Y9AA 5EJ4A 2VT6A 4I1OA 5KNDD 3R6LA 1RHRA 4PRZA 3G8AA 2F43A 2J6HA 4OXQA 3ZXIA 4GOND 3N0XA 1L5HB 1X14A 3QWAA 4IYJA 4QRDA 3COYA 4JLUA 2FFBA 1BVUA 3W5DA 1JU3A 4LF5B 4EL5A 3AEXA 1ECLA 3O38A 4ZGBA 3E7XA 4KMSA 1GPYA 1D9ZA 1SM4A 1WBJB 4G37A 4L5JA 2GNAA 1ZI9A 2IF0A 1UXJA 2YCBA 1XZKA 4B2LA 1PUJA 2A5YB 1ONBA 2ZJ4A 1DKNA 5EHGA 3UXYA 3DHEA 3BXPA 3WLEA 4BCBA 1N5KA 3UUEA 5CVEA 5ILGA 1V6AA 1EX9A 1JI3A 1XHEA 4Y2PA 2PGJA 5JAIA 1QG6A 3IUYA 3R2JA 2EW1A 4H15A 3WY9A 5CCBA 1RAEA 2GVNA 4Y2GA 1MO3A 3EH1A 1QANA 1UDCA 2QIOA 4JONA 1G6Q1 3GFVA 2XNJA 3D54D 1OU4A 3DEJA 9LDBA 4M6WA 4KFTA 3HVJA 3KZVA 1U2ZA 4TS4A 1J4LA 1BW9B 1CY8A 4M0CA 5IJ0B 4I5DA 3IUPA 4X64B 1RWPA 1ZGBA 2VHCA 2P3SA 4AG3A 3CFYA 3HACA 1K3TA 4HNUA 4FJ1A 1A9XA 2NU6B 2AFFA 1WZNA 4H4DA 4PPGA 2GBLA 2CKDA 2EJBA 1RBYA 4TVKA 5IWAB 1G41A 3IDQA 3DXZA 1VCIA 1H8ED 2H18A 3DVQX 1BA2A 4J0EA 5AWFC 4GG1A 5DI9A 5FA8A 3WRXA 1B73A 2I76A 1CRZA 1MABB 2HWWA 4IKEA 1QPZA 4HNSA 4C88A 1EP3B 4P92A 5E38A 2FZ4A 3EXHB 2C7QA 1RCFA 4K3UA 5DX0A 3NBKA 3HXLA 3RU9A 3KYCA 4LPKA 3KAKA 3LDAA 4LF9B 1OXXK 1QU5A 3N3AC 1CPYA 2AFHB 4EB3A 2PQMA 4R01A 4XUCA 1OWMA 2OV1A 3ND6A 1KI6B 1W0JA 4ZJPA 3MT7A 5IBRA 3O9MA 2K7ZA 1EK5A 1CUDA 1NAHA 1MPXA 4K1XA 3UWPA 3VSEA 3QLJA 3EDYA 1A97A 1F38A 4JOBA 1XDUA 4JUIA 3EYAA 4RHUA 2R8OA 2Y1KA 1P6XA 3E5HA 3QJYA 3W5VA 2RARA 1ZL2A 2A9FA 4FSHA 4QU8A 4RUKA 5CBPA 3ERCA 3W4KA 2DUJA 5HZHA 2ZKIA 3UJAA 1FLDA 5MFZA 1FSPA 1Q0LA 1Z07A 5FYQA 5IJWA 2HJGA 4KQMA 1LDGA 2BFEA 3NBXX 3VX3A 2YV1A 1NA5A 4RAOA 1WMFA 2A0WA 2HU8A 1Z63A 1Q12A 2WTEA 3IP9A 2E4XA 5FBWB 1ZH8A 1USIA 5AJTA 5BR7A 4KW7A 1BMFD 3P2YA 1NVFA 1QORA 3HU1A 2DKFA 2J9GA 4GGPA 4IIFA 5E4JA 2JB9A 5ICFA 4AYXA 1M6EX 1NN1A 1J8FA 4FMCB 4RY0A 5FV7A 4MVYA 2OTCA 3GBVA 1HFKA 3OPNA 4CV3A 1FL9A 1U4SA 4PIVA 5EUQB 3AR4A 3N87A 2DE0X 1T8YA 1I0ZA 3P71T 4NBVA 3K15A 1VKRA 5IHPA 4HNQA 3Q8LA 1A4XA 2JFGA 3D3KA 1UBHS 4TYQA 4URVR 5JVDF 4Z9YA 4ZQFA 1M54A 3D3EA 4YPOA 2Y27A 3DONA 1W87A 3KDPA 3R20A 2B36A 4LXIA 3POAA 4BTLA 2BBSA 5C8VA 3HHEA 4C2UA 3JWPA 2AYZA 1VHJA 1RD4A 1VLMA 1QK3A 5E9AA 5BYBA 3RIGA 3RAFC 4JUAA 4MRPA 1LQTA 1E1KA 2QVYX 1V37A 2ZT6A 2WYUA 2XMQA 3C16C 3PXCX 4BLVA 1NN0A 1RMTA 2ZJ5A 3GLSA 1FVFA 3FYSA 3OFND 1RZ3A 1X87A 2GN8A 2VK2A 3EODA 3EPPA 3E22A 1TJPB 2INGX 2QSUA 4LJRA 1N7JA 2P1ZA 5ICGA 2AW5A 3MUEA 2BKUA 4C4XA 4CQMD 3RKSA 3ZE2B 3CLTD 4HLCA 4JP1A 3MMNA 2XKJE 5GIPE 2IWHA 1ZX1A 1KJQA 3N28A 1L8AA 3NHAA 1UFRA 2KI5A 5K0BA 1NMXA 3FSRA 3STUA 2UU9B 1D2GA 1UKZA 2VDRB 1T0BA 3BA1A 3NT2A 4C0WA 2DFKB 4E30A 1C2YA 5J2TA 1G17A 3HDVA 1SNYA 3RFXA 2QPOA 3ZKAA 4F6RA 5ED0A 4YP6A 2PL9A 3O4HA 2YHAA 3ZCVA 1P5ZB 1QDLB 3THOA 5KNCA 3MK31 4OBBA 5CIQA 2FX2A 5C4IA 5K0LA 5K0SA 2B8TA 4YQZA 4UM7A 4Y1RA 2OZLA 1N1GA 4PR0A 1NJ1A 4G1CA 1IM8A 4G1BA 4BAZA 3T4XA 4OQ4A 3A7EA 2D0OB 4FGSA 1AY0A 4AN1A 3A1EA 3TLBA 2DVMA 2Z09A 4V0KA 4FDUA 1P0IA 3BMOB 4UVHA 3A27A 4Y9RA 3ZV6A 2NZVG 2NX2A 2R7AA 1W19A 4KE6A 3IILA 2QRUA 1TNDA 2BKVA 2YWBA 3ROTA 5A6SA 1ZONA 1UK6A 4O8CA 4XFDA 1MQ9A 2GTIA 1WQ3A 3RC8A 3HBFA 4UJ5A 3U60B 1AGRA 3HEMA 3LL4A 5LA6F 3RS9A 3H42B 3L4BA 4ZYVA 2PO5A 421PA 1E9CA 1AZLA 1JN0A 4WACA 4KLNA 2GXSA 3LYHA 1P1RA 1U2GA 3WNCA 1RBMA 4Q16A 4K81B 4ZWNA 2QUJA 3WRYA 1HRDA 4WN3A 2OZVA 4NOMA 4HPWA 4PTYA 1V9CA 4M76B 5IN5A 2HXSA 1ISHA 1N25A 4R68A 4X6UA 4DLTA 5DM70 3DUFB 4PFKA 621PA 3T5PA 1HY3A 3IIMA 4B80A 1CBUA 1LKZA 3AESB 1YZQA 4LCBA 1OROA 4P53A 3BHIA 4FDTA 4Z99A 5DWQA 1USGA 4EELA 5KDDA 5LUBA 4XD2A 1G63A 4OX9B 1R10A 3KQTA 1CR2A 1QVWA 3N8IA 1PG5A 5CDYA 1G4AE 5K3EA 2YY7A 4DCJA 1T8WA 2CMFA 4OHBA 4J4HA 2HB6A 2YIMA 3GJ5A 4M0DA 1PGOA 1OR8A 1V8FA 2BFOA 1JB1A 4LZNA 4RXUA 3ND7A 2O2DA 4LJ7A 4RYDA 4F46A 4MQ4A 3IDAA 5DASA 1HL3A 3GHYA 1A5BB 4OM7A 1Y5IA 3PE6A 3I76A 1U9JA 4X00A 1QLJA 4MVJG 5D00A 5KVVA 4WFKA 4KR7A 1XB2A 3PGMA 4ZJUA 2ZUWA 1YQDA 2Z2YA 2Z5LA 1MHPA 3AILA 1PX0A 1ZM2A 2O57A 4G5XA 5F33A 1IXZA 1J4KA 1KAOA 3NNNA 3WB0A 3D1VA 6AT1A 3WGZA 4Q4AB 1P31A 1IONA 3D31A 2VEDA 1XG5A 2BBOA 3HFGA 3UBMA 3AGQA 1L5LA 2Z9DA 3E1KA 5DYIA 4HGOA 1HK7A 2WJIA 3TCKA 1Z6QA 3VHXB 5EJHA 2ZQYA 1KAHA 1OH8A 2GH1A 4WCFC 3IQGX 1YKFA 2WABA 1JQDA 3IMGA 2WRZA 5A06A 5JAZA 2IBSA 3ZVNA 3T5MA 2GD1O 2Z58A 1H2HA 2C4MA 1XJ5A 2IYNA 3A0UA 3IPCA 3GJRA 2JFUA 3WGOA 4C0BA 1XL0A 3WRVA 1F8YA 2VF8A 3B2NA 1P80A 5LIRA 5D51S 4MP6A 4Q9KA 4Y3UA 1P7YA 2IYPA 4ZT3A 2B69A 1S3SA 3OE1A 1EVLA 1UBJS 2RBKA 3HWX1 1YR1A 2MSWA 3BDAA 3NW9A 5GGXA 1JAXA 1HDEA 1SA0B 1FUYB 3R7WA 3ECCA 4MJ7A 2I4OA 3I6MA 1M1NA 3W3AA 4O2AB 1BRTA 4U00A 1YVRA 3RU3A 5ETJA 4YCDA 3I5UA 1QQTA 3O26A 1AO3A 4OQMA 4RLHA 4RSRA 3SAJA 3D1LA 3THSA 2ET6A 3RNLA 3G0IA 2NWQA 2J30A 3T5TA 2FN9A 4Z8YA 4DR3B 1CVLA 1NMYA 1VL6A 1XCPA 5ECGC 4IIJA 3PEEA 1Q14A 1SC1A 3A1SA 1NWCA 3LQ4A 1DKRA 2IXDA 2WM8A 1IY2A 3GGPA 4WECA 3E53A 2FMFA 2E2WA 2B99A 2ZTLA 1N78A 1VB5A 4A0HA 2ZPTX 3HWWA 5CT5A 1QGUB 1TE2A 2QP4A 3ESRA 5CEJA 4I8IA 2CEAA 2SCUB 4KGZA 2PUDA 1U63A 4RHYA 1WEKA 4TTVA 5KHOC 3RS8A 4KVAA 1JHZA 3MTEA 2YOHA 3DE7X 4PO1A 3WKEA 4JS0A 1UJMA 2I3ZA 1NR7A 3OA2A 1V5EA 2HR1A 4LJ6A 1Z6XA 4EG8A 1TM3E 5FOXA 4O2AF 1YMUA 2AC7A 3LF2A 1YQGA 1D3AA 2NSJA 1A9PA 4MIYA 3NM5A 1T5OA 2CNWA 3M82A 1O1YA 4QVIA 1GAJA 2EFDB 1V5WA 4GRDA 2YNMD 4M9QA 2CEKA 3MCZA 3EVFA 4CFSA 8MHTA 4R16A 4GC5A 2X22A 4B44A 3LMKA 4FOTA 4Q7KA 1XSEA 4H1UA 2PH5A 4DIUA 3RUIA 4I55F 3ZWWA 4ZQIA 3NVAA 3A28A 1FTSA 1O6BA 1Z2EA 4X41A 1NUTA 2CNNA 2QZJA 4X8LA 2W4MA 1QH0A 3GJXC 3FGOA 3PKIA 4J0KA 5HBRA 1A4RA 1ISJA 4BHTA 2CD7A 2NIPA 1X9IA 1M1XB 3VR4H 4QUKA 4UD6A 2OV2A 3UAGA 1BS2A 1YA8A 2ASVA 4QFDA 5EIHA 2A9VA 2WIDA 1Y33E 4GI2A 3X1YA 3F5SA 5FBZA 3UHFA 1F2TB 2NT4A 2JIOA 2CHGA 2J85A 3V00A 2XWSA 1UAYA 3AH8A 3AEUB 3FPBA 4G5QA 5AW9A 1L9XA 1QH9A 1DJQA 3C48A 2P8SA 1RKQA 5LB2A 5I7FA 2YV3A 4XUGB 4FFVA 3TSAA 4C20A 3JSAA 4HDRB 1Z4OA 3VZCA 4AUNA 4OQNA 1QFZA 4NU0A 4CLDA 2CJFA 2I1WA 3BE8A 1KJWA 5ILQA 3VAYA 4X66B 4DLWA 1YB6A 2BMAA 3GJ8A 1NBEA 2OLKA 4D8VA 1ZVKA 3AOGA 1XMOB 3C43A 4D9VA 3NT5A 4MGHA 4BNJA 2AX3A 3ZV5A 3DDZX 1GA6A 2HKIA 5JQGB 2C4KA 1KZ7B 2JLVA 4R8KA 4I19A 4WDRA 1NQOA 1EDOA 2Q5JA 1IXSB 3OD5A 1AXGA 1PR4A 4OI4A 5D6NA 5ALTA 3RI3A 5KNDH 4OLJA 1H22A 1EVEA 2VH5R 2P4SA 1NKTA 2HSEA 1QCYA 1KSHA 1L5ZA 1UPXA 4XASA 1QGUA 3UV7A 3V1LA 4CL8A 4F5ZA 2AJCA 3GRYA 3R5XA 4J7UA 3SSMA 1KO5A 2VKQA 1W52X 2B1GA 1BJTA 3Q4GA 4IM7A 5ESRA 3WGKA 4DRYA 1SXPA 2PS3A 4O2RA 4KNYA 4JXZA 4K0RA 4O63O 2GM9A 2OECA 1TJ3A 2EKDA 3EZ7A 2CVPA 2G4CA 4DIEA 4NCAA 1WXEA 2JCVA 4YRLA 3HK2A 2VOEA 1EM8B 5K51A 5FH9A 1Q0ZA 2P7HA 1VG9B 2RK6A 4XI9A 3INRA 4DCOA 1LQUA 4G5SA 2XCOA 1OPRA 4CKWB 2BHSA 2IX3A 5DU2A 1H4QA 2D3TA 1TKAA 2NO0A 3R5FA 3W5HA 1ESNA 1NONA 1YZ3A 1S1MA 1L5MA 3FOWA 5BSTA 2WR8A 3ZNOA 1TI7A 4G1EB 1GQFA 1XRLA 2W2LA 1QTIA 4W5RA 1Q0HA 4DTIA 1GTRA 2PBLA 1GXCA 1TM1E 3NHBA 3AEYA 4FX5A 2VUUA 2XNKA 3DBIA 4IGKA 4IJVA 4ZQGA 3UFXB 4D1YA 4DBZA 1CEYA 4FGUA 4QPDA 3URMA 2BL4A 2Z1DA 5JO0A 3NU1A 5G0VA 2PX8A 4OK5A 1S2OA 2WJJA 1U2EA 3ETJA 4B31A 2UYCA 3ETDA 3G0OA 1NWHA 1UJCA 2CBXA 3D8SA 3H83A 3ICOA 3ZK9A 3HE3A 3ZE9A 4XIGS 1GL3A 1GRQA 2QD4A 3BL8A 3EQZA 3KT9A 1UL1X 3MGAA 1I1NA 3F6YA 4GSLA 2QTBA 4HDKA 4UKDA 5AOVA 2QLTA 5C8ZA 2A2ZA 3AP3A 1IUPA 1QIDA 3IP6A 4W99A 1H2BA 1U9YA 1GSAA 1KYWA 4WTOA 1Z5GA 5CH3A 1VHDA 2UYOA 2D5BA 2QTMA 1H8HD 1PR5A 2WC1A 5DW0A 1L5KA 4PAWA 2DB3A 1KH2A 1WQ1R 2QD2A 4DADA 4PGHA 5L53A 4IO0A 2XVYA 1Z28A 2JLAA 4C7MA 2PS1A 4JCOA 3T7SA 2VJKA 2IU0A 3WK5A 2R6FA 3TLGA 4F92B 3DDUA 4Q48A 4YRZA 4AKTA 1DOAA 3K6SB 3FDFA 3K8ZA 4NZZA 3GJ6A 1XMJA 2JJ1A 1DX6A 4U2GA 3T1QA 4QQRA 4X92A 1AZTA 2IYRA 2WWYA 2V8OA 1E2UA 2VUSA 1DB3A 3LY7A 3V8RA 2ICAA 2IIPA 1KO4A 3GMSA 3EA0A 1GYPA 3KXLA 2H51A 2OYSA 4LA4A 1JDTA 4M0KA 3PFCA 4MYSA 2FGKA 3WJ7A 4EW3A 1VYVA 3K71B 4AIIA 2QTHA 2X6QA 3IQWA 4OYRA 4FMCF 5IM5A 2J41A 2C8KA 5B3AA 4F12A 2C9ZA 3KV1A 3TW4A 3RGWS 4INPA 4X7RA 1GPDG 1RAAA 3A06A 3GWZA 2B8NA 5FNZA 3K7EA 3GF4A 3FVTA 4PS1A 4BFTA 2CB0A 2DLNA 4OI0A 1G8GA 4JKYA 1YZKA 1D8TA 3L4EA 3JYPA 4PZCA 2F1HA 2P2DA 1DDGA 3A26A 1J2YA 3ZDEA 2EYUA 4ZANA 1XQ9A 5T64A 2R68A 5G4LA 5JYBA 5AOAA 4OEHA 1U5CA 3EIWA 4HEJA 1ZZGA 4JIGA 4R1OA 1JEOA 3W1EA 1ZIXA 3AM3A 3EAGA 5HJ7A 3QW2A 3TIXB 3BZBA 1Q77A 4RU1A 1BVYF 1D2EA 1A71A 3OC0A 1ATIA 4J07A 3VU8A 3ZU6A 5C52B 1CK4A 4HDOB 2ZRMA 4MPJA 5H1YA 1KP9A 2Y0PA 2DTXA 1MGOA 4JV5B 2W71A 4PX2A 4AXXA 3KUXA 2G5TA 4LYAA 5ALNA 3OQNA 4ZOEA 2H2GA 3PGA1 3QYFA 5EKTA 4L6IA 3VKVA 4HFMA 4ZK6A 1MC4A 5JYEA 3KUUA 1HPLA 3P9IA 4EJSA 1MAAA 4MWZA 3ZWDA 2R5FA 2IYAA 2CL0X 4OCZA 3HZOA 4YMUA 3KSBC 2W42A 4C7KA 2A59A 1KMCA 5D6OA 3IYLW 5EGSA 3ROXA 3UIEA 2O19A 3OOYA 2ORWA 4L74A 2Q29A 4GBGA 4MKIA 2XGGA 5IXSA 2A6PA 1KVQA 4OHWA 4H35A 1FP6A 4JROA 1E5DA 4CDNA 4UFOA 5LUAA 1NDUA 2XEXA 4FEAA 3ISTA 2W4QA 3L3BA 3ITDA 2ZYHA 2ADFA 3D0RA 2XUGA 4LG1A 4C0SA 3WV4A 1FJ2A 1I01A 3UWMA 2V5AA 4RZSA 3UB3A 1WVMA 4BJ1A 2X1VA 4LF7B 1KJYA 5BO5A 2GJ4A 1NAIA 2IYVA 1XN1A 5FF9A 4IJWA 5IVHA 2WKRA 1J07A 1FFSA 1XZAA 1DRJA 1GPKA 1E5TA 2BCGY 5TMPA 2O8BB 4ZDKA 5FI0B 4UHBA 5HR5A 2R1TB 1KQOA 2ZJ0A 2HH9A 2KYRA 1YMVA 3BGDA 3DR5A 1E9AA 1S1CA 3GZ4A 3GZNB 4LRSB 3QVUA 1L4KA 2E6UX 4PNPA 3OFVA 3ZJUA 1KH3A 4WXHA 5INTA 5TPWA 3EDRA 1FFYA 1RM5A 4F2PA 4EHNA 3V1NA 5CA1B 3VC1A 2AOUA 1DWUA 3OWXA 5F2EA 1U1GA 1EDEA 4L0CA 3PU6A 2YYYA 3U3OA 3TZQA 4D3ZA 2XNDD 3WB1A 1XZ8A 1HZZA 1OBFO 2GPSA 3Q5DA 4JVOA 3FFXA 3PUWA 1MDBA 3VNBA 1ZCJA 1DKUA 2B20A 2M6SA 3GGDA 1XKLA 4LV5B 3GFGA 4MVCA 4EAQA 2MT9A 2R1VA 3K1TA 2PH7A 3SEFA 3U13A 4DG5A 1RC8A 3RRNA 2C1XA 2JJQA 3H1AA 1FP4A 4R71A 1S2GA 3LK6A 1ZK0A 5HKKD 1QFMA 1DIOB 2MSCB 3A3KA 3U56A 1VHTA 4XIFA 4PEVA 5F1KA 3WA7A 2VYQA 2I1VB 4QULA 1JFVA 4ACAA 721PA 1KYYA 2X1MA 1IBSA 4MGEA 1YB4A 4W5OA 3EPJA 4TS3A 5DTJA 1T91A 3W2IA 4URHA 3R0JA 4BGDA 4YPFA 1I30A 4C0KA 4PZAA 3Q6MA 3D6AA 1PS9A 1OMOA 3KZCA 5G3ZA 2P6MA 1MO5A 1U02A 2RHRA 3C3BA 1X7YB 1S9DA 2JL1A 3JS5A 3PHHA 1NASA 3SQMA 1A8PA 4RKRA 5ALZA 2JI6A 1EGAA 1YBAA 5FOWA 1QDUA 3LOQA 4C3UA 1EK6A 1J0EA 5AJHA 2PO7A 5HZGA 3LPMA 4Y2UA 2O2IA 3H1GA 1GA4A 1WCWA 2XRMA 2CK3A 4OL0A 5DYNA 4GLBA 5EVCA 5JE8A 5K4AA 1ZA1A 3LO5A 4GRIA 2I4MA 3RVPA 1ZC4A 1M7BA 3TUZC 3AI1A 5DWDA 1D6NA 1EFKA 2ZAOA 1YTLA 1APBA 1X1TA 4CU5A 3SFVA 4B47A 3MMXA 4RLQA 4CF3A 3UJDA 2P79A 4OHKA 1I10A 2IPXA 3X1JA 1QO7A 1THTA 1DKMA 2X9GA 3LVQE 3V8PA 4G5YA 4LNUA 4MS3A 4MI9A 4TXLA 3RVSA 2NQ2C 5ALHA 3WQRA 3P2KA 4D45A 5F3DA 2OCLA 3TH5A 1RAGA 2QT0A 5FCDA 1WSAA 2D2IA 3SLRA 3RRZA 2Y8EA 1I94B 1JSXA 1EIZA 2O06A 1GRRA 1W4AA 2FHPA 2GT1A 3CPJB 1XD8A 1LV8A 4GE3A 1FDVA 1USVA 3HUDA 3K73O 4GR9A 4NZ9A 2G0NA 3LBFA 3GFRA 2ZJ8A 3IODA 3JQPA 2YJZA 3EVCA 4RAQA 2QXYA 3IA7A 3NJ4A 2JI4A 1RP1A 2SKDA 1Q6ZA 4HH1A 3W8FA 4GOMD 3N74A 2PSEA 2Z1NA 4MGZR 1RVDA 1Z33A 2DBVO 4ZVNA 4DMFA 2AD5A 1PEDA 1MPTA 3C1OA 3LIPA 1HE2A 3C39A 4XQCA 5KSZA 1QMPA 3JCZA 3ND9A 2NO7A 3SVZA 5CYOA 2GWHA 2NZJA 13PKA 2C2GA 2R4QA 2WAYA 3JQEA 3C8UA 4NNOA 2VHUA 5F1OA 4X1YA 1RXEA 2CUTA 3ANYB 4MEJA 4MYHA 5EZ5A 4QTUB 1J2JA 1YJ5A 4KGVA 3PI6A 3H1TA 2YZMA 1G18A 1AKVA 1R4AA 4QDKA 3UNNA 1QSGA 3TK1A 1V1MB 4RNDB 4DQXA 1V95A 3ZE8A 2ZPAA 5FPKA 1GAXA 3ZCSA 3OZSA 1KHTA 5L4NA 1FS4A 1ADCA 5A5EA 2GZSA 1SCDA 4A0QA 2JGEA 2DQSA 1WO8A 2TYSB 2JJ1D 2O0JA 4MHSA 2GESA 1QTNA 3FKQA 3QMMA 2PQ6A 2WVGA 1DPGA 2UZ1B 2WYIA 3QELA 4TS1A 1KJNA 2PX5A 1C0EA 3Q2OA 4S1WA 4LGCA 4JC0A 1EQ2A 3HCWA 3I01A 4WWHA 1N2OA 5JZVA 5A4MS 2MSKA 3EG9B 2JLQA 2IYWA 3LX4A 4BOYA 1Q7EA 4Q9HA 5IAAA 3DOUA 3GJTA 2Q4RA 2PKWA 2QD3A 1II0A 1P9NA 1YZVA 2PG3A 3ZDRA 3AESA 4MEAA 4D81A 3UMFA 4OUDA 1T5SA 1OFUA 5JS1A 2XT9B 4MMZB 3MWDB 4Z7OB 5E6RA 4IX9A 4LKRA 4LZAA 2I62A 4ILKA 5C37A 5JXGA 1SU6A 2DFLA 5DX1A 1K92A 3LBNA 3A6FA 1MRNA 4OKSA 2ZJZA 4Q37A 3DVLA 3EVEA 5DGXA 2ZULA 2ZRHA 3CCFA 3R6GA 3S2IA 4JI1B 3BIWA 3FUTA 3AONB 4XD7D 2BI4A 1EA7A 2YYSA 4KRXA 4CPDA 4BV9A 1ECPA 4IHJA 5BOSB 5GTDA 2XNSA 2ZRJA 4D0RA 4X0EA 3QLEA 5LA6A 4DXAA 4Q7QA 5L7TA 5I8ZA 5LMUB 3LNCA 4BZZA 3IPAA 2GAJA 2XIJA 3IP7A 4G0VA 1GPJA 1JHAA 4ER3A 4JASB 3X2FA 4ZU6X 2VDUE 5DK4A 2I2DA 3D4OA 3H5OA 3L7KA 3BD9A 1MTZA 2XUDA 3K72B 3LUJA 3SNHA 1ZN9A 5E1OA 4FDVA 3T1YB 2ZBDA 4O4JA 5DPMA 5FUYA 3UW3A 1FVOA 4DMHA 3ZWVA 1G88A 3PUIA 3I6IA 1C7JA 1YKGA 3TOVA 1F1JA 3NHWA 3V8EA 4ZYXA 2DQYA 2JASA 2GZ1A 2OAGA 2ZB8A 4KRYA 1A7UA 2GPJA 4LDQA 1KU6A 1Q22A 3VR3D 2V6MA 3ZHZA 1ORTA 3RK1A 2ZR7A 5FTWA 4CEIB 1BH2A 2HIAA 2YMPA 3C5CA 3WQQA 4AJKA 4PPQA 1EESA 2OSBA 1Y6QA 4OAPA 4JYPA 4M99A 4BFCA 3RFFA 3A6HA 2OV4A 4UCQA 1FQKA 1M2OB 3Q7TA 4UULA 4X44A 3RT7A 1QRUA 4RFVA 1NBMA 5HQ3A 1N5JA 4NMLA 3RV3A 3WGGA 5EMJA 4XDHA 1V4BA 1L3BA 4TQUS 3UB4A 5EESA 4QUIA 1KK1A 4ZDJA 3QKWA 4KUEA 4NFLA 2OHXA 3CH6A 4REMA 4GPD1 1SUAA 3RKUA 1JSZA 3AWIA 5B6IA 5LNK6 5BV8A 4ZCIA 3JWIA 2IW3A 2QSYA 5EQDA 1HEYA 3C1TA 3WB9A 4H6WA 3K5PA 1DC4A 4BLPA 1CEXA 3MLAA 5KTMA 3ZHCA 3DZJA 4RK1A 4PBTA 4N6OA 2V7BA 4D9KA 1YOVB 1I4DD 3QVGB 4TYYA 3MS2A 4JDPA 3OQ1A 3H2BA 4XRGA 3QPCA 4TZ6A 5B4VA 2P77A 1PZNA 4UFNA 1HDRA 1XU9A 4JSYA 5IDYA 4WOJA 1R4MB 1E2DA 3C3DA 5D84A 4MR8B 3W3AH 3RSLA 2W00A 5IG2A 1OWPA 1OLUA 1ABFA 1RM0A 2OO5A 5EGNA 3M6WA 1BXGB 4ZCSA 2CNDA 4ZC8A 4HYQA 3PITA 2GCEA 3I42A 4RJKA 1HQCA 2BMEA 4UXHA 2IEYA 3OETA 4CLEA 5A4FS 4EFDA 3QVOA 2ZK7A 1UBCA 4O1HA 2GEDA 3L79A 3NTRA 3OZVA 3G1WA 3ZNNA 3O4IA 4GS5A 2WJPA 4FB4A 3PIRA 3K6JA 2JI8A 5CGQB 5DYWA 3RJ9A 4MAFA 3W06A 3SHFA 3DE6X 4FGWA 2DFNA 5EP1A 3DLBA 2RGNC 2D7DA 3IEMA 3GIWA 4C30A 5K2OA 3ANNA 4DARA 3TBHA 4BX2A 4LY6A 1LZLA 3LUKA 3CV3A 3EDOA 3D6UA 4A0EA 4JGGA 2GM3A 4R2LA 1GARA 1XI2A 4IV8A 4MW1A 1ZNXA 3UHPA 3EHDA 3T4UA 3UAWA 2RI6A 5CLIA 3LXMA 1ZL0A 3DXXA 4JI6B 1CCWA 1L7VC 3CUWA 4RF2A 1M8KA 2EZ8A 2FPKA 4EKIA 2JGRA 2ZRFA 1NBME 1JIJA 4AF8A 3VDRA 4NAUA 2VK1A 2XX3A 3DOCA 2N0SA 3EIEA 3SYTA 3VTFA 4MDFA 2PE5A 4RXMA 1X7GA 3PNBA 3ETGA 2C4WA 1NGSA 1AKUA 3FVQA 2V6BA 2GSDA 4ARVA 4LUCA 2PIAA 1QGZA 2O23A 3B7GA 3V8VA 5TEWA 2PSFA 2GXAA 1FEZA 1SCUB 4HDCA 4HVAA 2B3DA 4QL3A 1MUUA 2P68A 1G98A 2ONKA 1Z4IA 4KODA 3SR3A 1B6SA 3VR4A 4EG7A 1QIFA 4OJKA 2ZR0A 2C4TA 1H0KA 3U4GA 1ZC3A 4EB6B 2JGJA 1YS7A 4DJ5X 3EIUA 4EHKA 1C1XA 2JK0A 2Q45A 3JQGB 4CL2A 4KO2S 3VI3B 1WP4A 1AKRA 2ZT5A 2O5EA 3CW2A 1E3LA 2WWIA 4CKWA 3AUUA 3BG5A 3DWFA 3LECA 1D4ZA 1SZDA 3QSGA 4UE3S 2ZIXB 4C0XA 5G53C 3BCSA 2GUWA 3D7SA 3F7TA 1ZM7A 2CC2A 3QWHA 3UQYS 3FG9A 3PDWA 1RMQA 2H1HA 4ON9A 4JI3B 1PWXA 1H0SA 3R1IA 5BQPA 4JWKA 4PGGA 3RTGA 5CNIA 2W8ZA 2Y6UA 1JLRA 1SUDA 5AOBA 5BMVB 3MIIA 3EGVA 1N0HA 3T1OA 1QS0A 1Y3FE 4IIHA 3IVRA 1L4YA 3UGJA 4XIIA 1S89A 4UHDA 1FU7A 1Q1GA 3WYBA 2JPEA 3SDZA 2HMSA 5BRNA 1O54A 3QMPA 3GOHA 3EPHA 3AU9A 4Z3DA 1AHHA 2P4HX 1QC5A 3L4KA 4KMOA 1SXJE 4Q4HB 1T1IA 3NUZA 4I2VA 4ZD6A 5IJ9B 4JVMA 1XZJA 3E1GA 3OIVA 1V25A 3FSEA 5A4KA 5IZCC 5FL7A 1Z2OX 2G9QA 5DBFA 3WWOA 2YVUA 1EE2A 1Z4NA 2JGDA 2QN1A 4B3BA 2YMMA 3STVA 4M9RA 1JJFA 1CDDA 4QDZA 5LP6F 4N7JA 4HNAA 3RR2A 5I51A 1BCRA 2J5BA 3EZGA 3TD2A 2GEUA 2H2DA 1CLEA 4Z4EA 3FYUC 3ZHOA 4AFNA 3LRPA 3OEHA 5JSYA 4ZHQF 5ELXA 1UFOA 2QVLA 5IC5A 1AV6A 5DEIA 2XUFA 3ODPA 1VMKA 2HC9A 4IJ5A 3UW1A 1PL0A 1KORA 2GM4A 4UNSA 4FZVA 1KEPA 4LE1A 4DMKA 3FSJX 5LZ8A 2AXEA 2ID7A 1HURA 4QJIA 5FV4A 1UZLA 1QJ4A 3HLKA 3H7AA 2Z3ZA 2EQBA 2C9YA 2O3QA 2QIPA 4C0QC 4DCPA 4MP8A 4I50F 1A8IA 3UPUA 2X6RA 3IUQA 4EG0A 2H1FA 4J8PA 2AB0A 1IOVA 1JZQA 2IV7A 3D8NA 1K7XB 1T9GS 3F2VA 4EPTA 3HYRA 1I5OA 3RSOA 4FD3A 2DBZA 3ME5A 3GCDA 1ZJJA 4DLNA 3D7NA 1VYHA 2IPOA 3H17A 4DWJA 5CBKA 5JARA 2FYTA 3TTUA 5MDHA 2ZTUA 1I5EA 3WGTA 5EP4A 8ATCA 3M5CA 4P6VF 4CEHB 1HDIA 1QO9A 3M5PA 3WQSB 4RD3A 5ESXA 1AC5A 1K86A 1S7GA 2KLHA 1A77A 3CTMA 5EP3A 4XEUA 4ZT4A 4W5HA 1O08A 2L19A 3ZTWA 5JRZA 4F3TA 3CPEA 2PRKA 1QV6A 4LQDA 1IEWA 2BJHA 5IARA 2VJPA 4E5YA 1YRYE 5CNMA 1NTOA 2GZ2A 3B78A 2ZJ7A 3LJKA 5BN5A 3PJGA 3LPNA 3PFNA 2XUOA 2FMXA 2DPYA 1LX6A 3KHSA 3M5DA 3UYKA 4BX9A 3P9YA 3V80A 2YWHA 4CM8A 4BQFA 3AKZA 3THWB 4EHJA 3RIMA 1N2BA 5C32A 4IVRA 4L07A 3NBYC 4EJFA 1GZHB 1HT2E 4UZSA 5CHEA 5G02A 5D3MA 1PFYA 4MKXA 1L3IA 4YALA 5T41A 3EGCA 4RIGA 3B1FA 2DY0A 3T1NA 3THXB 3F9CA 2BFAA 1UP7A 1VBKA 2HK8A 3CEMA 3L41A 3BZUA 3TNYA 2RDMA 2GRUA 2HD4A 1FQJA 1WWKA 1QYRA 4FONA 5I8PA 1XRJA 3F5FA 3KHTA 4Q6BA 1HOXA 4U4AA 4R83A 4XDZA 4LY9A 3ZX4A 4XVUA 1SKBA 2ZUEA 3AW8A 1AGPA 5U4QA