2I2QA

Fission yeast cofilin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
SFSGVKVSPECLEAFQELKLGKSLRYVVFKMNDTKTEIVVEKKSTDKDFDTFLGDLPEKDCRYAIYDFEFNLGEGVRNKIIFISWSPDVAPIKSKMVYSSSKDTLRRAFTGIGTDIQATDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Actin Filament Turnover by Severing and Nucleation at Different Concentrations of ADF/Cofilin.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Actin-binding protein
molecule keywords Cofilin
total genus 35
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2i2qA00
4CBXG 5L6WC 1X67A 5HVKD 3EH2A 1CNUA 3EH1A 1Q8GA 1COFA 3CIPG 5KYYA 1P8ZG 4CBWG 3FFNA 1Q8XA 2W0IA 1P8XA 1T44G 3EFOB 2KVKA 2MV2A 4KEDA 2FGHA 3A5OS 4JD2H 1T3YA 1NPHA 1RGIG 2MOTA 1H1VG 2LXXA 1M2OA 2FF6G 3EGDB 3L50A 2HD7A 4Z94G 2QTVA 1VFQA 4BEX1 2D8BA 2XF1A 1AK7A 1PCXA 1NMDG 1YAGG 2FH2A 2NUPB 1CFYA 1NM1G 5KYUB 2VILA 2L72A 3A5LS 1M2VB 1QPVA 1YVNG 4KEEA 5KYWB 3FG6A 1NLVG 1ESVS 5KYXB 5HVKB 5KYWA 5KYYB 5KYNA 1M2VA 4PKHB 1F7SA 1WM4A 1UDMA 5FAFA 1V6FA 1MDUA 2NUTB 3CJCG 1SVQA 1DEJS 1T2LA 1D0NA 1TVJA 3DAWB 1AHQA 1WFSA 4PKIG 2NUTA 3TU5B 2XFAA 3EG9B 3Q2BA 1C0FS 3A5NS 1HQZ1 1C0GS 4S10C 4LIZA 3EGXA 3EGXB 2LJ8A 1PD1A 3EFOA 1SVRA 3EG9A 2NUPA 1VKKA 1KCQA 1D4XG 3FFKA 1WNJA 2LLFA 2FH3A 2VACA 1EQYS 5FAEA 2I2QA 1JHWA 2FH1A 5DD2A 5A1MA 1PD0A 3CJBG 1J72A 3EGDA 5IVUA 5KYXA 2VIKA 4KEFA 3FG7A 3A5MS 2FH4A 4CBUG 1TMWA 1T3XA 3CI5G 1M4JA 2MP4A 1SVYA 4PKGG 2FF3A 5KYUA 1AK6A
chains in the Genus database with same CATH superfamily
4CBXG 5L6WC 1X67A 5HVKD 3EH2A 1CNUA 3EH1A 1Q8GA 1COFA 3CIPG 5KYYA 3DA7A 1P8ZG 4CBWG 3FFNA 1Q8XA 2W0IA 1P8XA 1T44G 3EFOB 2KVKA 2MV2A 4KEDA 2FGHA 3A5OS 4JD2H 1T3YA 1NPHA 1RGIG 2MOTA 1H1VG 2LXXA 1M2OA 2FF6G 3EGDB 3L50A 2HD7A 4Z94G 2QTVA 1VFQA 4BEX1 2D8BA 2XF1A 1AK7A 1PCXA 1NMDG 1YAGG 2FH2A 2NUPB 1CFYA 1NM1G 5KYUB 2VILA 2L72A 3A5LS 1M2VB 1QPVA 1YVNG 4KEEA 5KYWB 3FG6A 1NLVG 1ESVS 5KYXB 5HVKB 5KYWA 5KYYB 5KYNA 1M2VA 4PKHB 1F7SA 1WM4A 1UDMA 5FAFA 1V6FA 1MDUA 2NUTB 3CJCG 1SVQA 1DEJS 1T2LA 1D0NA 1TVJA 3DAWB 1AHQA 1WFSA 4PKIG 2NUTA 3TU5B 2XFAA 3EG9B 3Q2BA 1C0FS 3A5NS 1HQZ1 1C0GS 4S10C 4LIZA 3EGXA 3EGXB 2LJ8A 1PD1A 3EFOA 1SVRA 3EG9A 2NUPA 1VKKA 1KCQA 1D4XG 3FFKA 1WNJA 2LLFA 2FH3A 2VACA 1EQYS 5FAEA 2I2QA 1JHWA 2FH1A 5DD2A 5A1MA 1PD0A 3CJBG 1J72A 3EGDA 5IVUA 5KYXA 2VIKA 4KEFA 3FG7A 3A5MS 2FH4A 4CBUG 1TMWA 1T3XA 3CI5G 1M4JA 2MP4A 1SVYA 4PKGG 2FF3A 5KYUA 1AK6A
chains in the Genus database with same CATH topology
4CBXG 5L6WC 1X67A 5HVKD 3EH2A 1CNUA 3EH1A 1Q8GA 1COFA 3CIPG 5KYYA 3DA7A 1P8ZG 4CBWG 3FFNA 1Q8XA 2W0IA 1P8XA 1T44G 3EFOB 2KVKA 2MV2A 4KEDA 2FGHA 3A5OS 4JD2H 1T3YA 1NPHA 1RGIG 2MOTA 1H1VG 2LXXA 1M2OA 2FF6G 3EGDB 3L50A 2HD7A 4Z94G 2QTVA 1VFQA 4BEX1 2D8BA 2XF1A 1AK7A 1PCXA 1NMDG 1YAGG 2FH2A 2NUPB 1CFYA 1NM1G 5KYUB 2VILA 2L72A 3A5LS 1M2VB 1QPVA 1YVNG 4KEEA 5KYWB 3FG6A 1NLVG 1ESVS 5KYXB 5HVKB 5KYWA 5KYYB 5KYNA 1M2VA 4PKHB 1F7SA 1WM4A 1UDMA 5FAFA 1V6FA 1MDUA 2NUTB 3CJCG 1SVQA 1DEJS 1T2LA 1D0NA 1TVJA 3DAWB 1AHQA 1WFSA 4PKIG 2NUTA 3TU5B 2XFAA 3EG9B 3Q2BA 1C0FS 3A5NS 1HQZ1 1C0GS 4S10C 4LIZA 3EGXA 3EGXB 2LJ8A 1PD1A 3EFOA 1SVRA 3EG9A 2NUPA 1VKKA 1KCQA 1D4XG 3FFKA 1WNJA 2LLFA 2FH3A 2VACA 1EQYS 5FAEA 2I2QA 1JHWA 2FH1A 5DD2A 5A1MA 1PD0A 3CJBG 1J72A 3EGDA 5IVUA 5KYXA 2VIKA 4KEFA 3FG7A 3A5MS 2FH4A 4CBUG 1TMWA 1T3XA 3CI5G 1M4JA 2MP4A 1SVYA 4PKGG 2FF3A 5KYUA 1AK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBX G;  5L6W C;  1X67 A;  5HVK D;  3EH2 A;  1CNU A;  3EH1 A;  1Q8G A;  1COF A;  3CIP G;  5KYY A;  1P8Z G;  4CBW G;  3FFN A;  1Q8X A;  2W0I A;  1P8X A;  1T44 G;  3EFO B;  2KVK A;  2MV2 A;  4KED A;  2FGH A;  3A5O S;  4JD2 H;  1T3Y A;  1NPH A;  1RGI G;  2MOT A;  1H1V G;  2LXX A;  1M2O A;  2FF6 G;  3EGD B;  3L50 A;  2HD7 A;  4Z94 G;  2QTV A;  1VFQ A;  4BEX 1;  2D8B A;  2XF1 A;  1AK7 A;  1PCX A;  1NMD G;  1YAG G;  2FH2 A;  2NUP B;  1CFY A;  1NM1 G;  5KYU B;  2VIL A;  2L72 A;  3A5L S;  1M2V B;  1QPV A;  1YVN G;  4KEE A;  5KYW B;  3FG6 A;  1NLV G;  1ESV S;  5KYX B;  5HVK B;  5KYW A;  5KYY B;  5KYN A;  1M2V A;  4PKH B;  1F7S A;  1WM4 A;  1UDM A;  5FAF A;  1V6F A;  1MDU A;  2NUT B;  3CJC G;  1SVQ A;  1DEJ S;  1T2L A;  1D0N A;  1TVJ A;  3DAW B;  1AHQ A;  1WFS A;  4PKI G;  2NUT A;  3TU5 B;  2XFA A;  3EG9 B;  3Q2B A;  1C0F S;  3A5N S;  1HQZ 1;  1C0G S;  4S10 C;  4LIZ A;  3EGX A;  3EGX B;  2LJ8 A;  1PD1 A;  3EFO A;  1SVR A;  3EG9 A;  2NUP A;  1VKK A;  1KCQ A;  1D4X G;  3FFK A;  1WNJ A;  2LLF A;  2FH3 A;  2VAC A;  1EQY S;  5FAE A;  2I2Q A;  1JHW A;  2FH1 A;  5DD2 A;  5A1M A;  1PD0 A;  3CJB G;  1J72 A;  3EGD A;  5IVU A;  5KYX A;  2VIK A;  4KEF A;  3FG7 A;  3A5M S;  2FH4 A;  4CBU G;  1TMW A;  1T3X A;  3CI5 G;  1M4J A;  2MP4 A;  1SVY A;  4PKG G;  2FF3 A;  5KYU A;  1AK6 A; 
#chains in the Genus database with same CATH topology
 4CBX G;  5L6W C;  1X67 A;  5HVK D;  3EH2 A;  1CNU A;  3EH1 A;  1Q8G A;  1COF A;  3CIP G;  5KYY A;  3DA7 A;  1P8Z G;  4CBW G;  3FFN A;  1Q8X A;  2W0I A;  1P8X A;  1T44 G;  3EFO B;  2KVK A;  2MV2 A;  4KED A;  2FGH A;  3A5O S;  4JD2 H;  1T3Y A;  1NPH A;  1RGI G;  2MOT A;  1H1V G;  2LXX A;  1M2O A;  2FF6 G;  3EGD B;  3L50 A;  2HD7 A;  4Z94 G;  2QTV A;  1VFQ A;  4BEX 1;  2D8B A;  2XF1 A;  1AK7 A;  1PCX A;  1NMD G;  1YAG G;  2FH2 A;  2NUP B;  1CFY A;  1NM1 G;  5KYU B;  2VIL A;  2L72 A;  3A5L S;  1M2V B;  1QPV A;  1YVN G;  4KEE A;  5KYW B;  3FG6 A;  1NLV G;  1ESV S;  5KYX B;  5HVK B;  5KYW A;  5KYY B;  5KYN A;  1M2V A;  4PKH B;  1F7S A;  1WM4 A;  1UDM A;  5FAF A;  1V6F A;  1MDU A;  2NUT B;  3CJC G;  1SVQ A;  1DEJ S;  1T2L A;  1D0N A;  1TVJ A;  3DAW B;  1AHQ A;  1WFS A;  4PKI G;  2NUT A;  3TU5 B;  2XFA A;  3EG9 B;  3Q2B A;  1C0F S;  3A5N S;  1HQZ 1;  1C0G S;  4S10 C;  4LIZ A;  3EGX A;  3EGX B;  2LJ8 A;  1PD1 A;  3EFO A;  1SVR A;  3EG9 A;  2NUP A;  1VKK A;  1KCQ A;  1D4X G;  3FFK A;  1WNJ A;  2LLF A;  2FH3 A;  2VAC A;  1EQY S;  5FAE A;  2I2Q A;  1JHW A;  2FH1 A;  5DD2 A;  5A1M A;  1PD0 A;  3CJB G;  1J72 A;  3EGD A;  5IVU A;  5KYX A;  2VIK A;  4KEF A;  3FG7 A;  3A5M S;  2FH4 A;  4CBU G;  1TMW A;  1T3X A;  3CI5 G;  1M4J A;  2MP4 A;  1SVY A;  4PKG G;  2FF3 A;  5KYU A;  1AK6 A; 
#chains in the Genus database with same CATH homology
 4CBX G;  5L6W C;  1X67 A;  5HVK D;  3EH2 A;  1CNU A;  3EH1 A;  1Q8G A;  1COF A;  3CIP G;  5KYY A;  3DA7 A;  1P8Z G;  4CBW G;  3FFN A;  1Q8X A;  2W0I A;  1P8X A;  1T44 G;  3EFO B;  2KVK A;  2MV2 A;  4KED A;  2FGH A;  3A5O S;  4JD2 H;  1T3Y A;  1NPH A;  1RGI G;  2MOT A;  1H1V G;  2LXX A;  1M2O A;  2FF6 G;  3EGD B;  3L50 A;  2HD7 A;  4Z94 G;  2QTV A;  1VFQ A;  4BEX 1;  2D8B A;  2XF1 A;  1AK7 A;  1PCX A;  1NMD G;  1YAG G;  2FH2 A;  2NUP B;  1CFY A;  1NM1 G;  5KYU B;  2VIL A;  2L72 A;  3A5L S;  1M2V B;  1QPV A;  1YVN G;  4KEE A;  5KYW B;  3FG6 A;  1NLV G;  1ESV S;  5KYX B;  5HVK B;  5KYW A;  5KYY B;  5KYN A;  1M2V A;  4PKH B;  1F7S A;  1WM4 A;  1UDM A;  5FAF A;  1V6F A;  1MDU A;  2NUT B;  3CJC G;  1SVQ A;  1DEJ S;  1T2L A;  1D0N A;  1TVJ A;  3DAW B;  1AHQ A;  1WFS A;  4PKI G;  2NUT A;  3TU5 B;  2XFA A;  3EG9 B;  3Q2B A;  1C0F S;  3A5N S;  1HQZ 1;  1C0G S;  4S10 C;  4LIZ A;  3EGX A;  3EGX B;  2LJ8 A;  1PD1 A;  3EFO A;  1SVR A;  3EG9 A;  2NUP A;  1VKK A;  1KCQ A;  1D4X G;  3FFK A;  1WNJ A;  2LLF A;  2FH3 A;  2VAC A;  1EQY S;  5FAE A;  2I2Q A;  1JHW A;  2FH1 A;  5DD2 A;  5A1M A;  1PD0 A;  3CJB G;  1J72 A;  3EGD A;  5IVU A;  5KYX A;  2VIK A;  4KEF A;  3FG7 A;  3A5M S;  2FH4 A;  4CBU G;  1TMW A;  1T3X A;  3CI5 G;  1M4J A;  2MP4 A;  1SVY A;  4PKG G;  2FF3 A;  5KYU A;  1AK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...