2I33A

The structure of the class c acid phosphatase from bacillus anthracis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
238
structure length
238
Chain Sequence
VKLTDQQLMADLWYQTAGEMKALYYQGYNTGQLKLDAALAKGTEKKPAIVLDLDETVLDNSPHQAMSVKTGKGYPYKWDDWINKAEAEALPGSIDFLKYTESKGVDIYYISNRKTNQLDATIKNLERVGAPQATKEHILLQDPKEKGKEKRRELVSQTHDIVLFFGDNLSDFTGFDGKSVKDRNQAVTDSKAQFGEKFIIFPNPMYGDWEGALYDYNFKKSDAEKDKIRHDNLKSFDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid phosphatase
publication title The crystal structure of the Class C acid phosphatase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 94
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2006-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i33A00
2WF6A 2ZBDA 4NAVA 3E81A 5AW5A 2B1QA 1Z4LA 5ALJA 4BNDA 3NUQA 4UMDA 3NASA 3QU7A 3HLTA 4XQ0A 4HYTA 2ZOSA 4UU0A 4UAUA 4Y2YA 4C4RA 2ZG6A 1Q91A 1IWOA 2C88A 2FI1A 1K1EA 2GFHA 2YMQA 1T9ZA 2OBBA 3ZTWA 1YDFA 2JARA 1N9KA 2BY4A 4RESA 3WKAA 3MMZA 2C8LA 1EK2A 3SD7A 2B0CA 4Y2PA 2HF2A 1NF2A 4ZEVA 5ALHA 5ALIA 1U02A 3SMVA 4CF4A 4E88A 3L1VA 3MN1A 2ZBGA 5AVRA 1TJ4A 4BX2A 1Z4MA 3L8EA 3KD3A 2WHEA 5ALOA 4YCMA 3OCUA 2HDOA 3F9RA 3UMBA 3AR2A 3DDHA 1RC8A 2NO5A 4PNHA 3FGOA 2ZXEA 2RARA 4I9FA 2AH5A 5AM5A 1L7OA 1RLMA 1TJ5A 1TJ3A 3KOOA 1VJRA 3OCYA 3FPSA 5T41A 5AM1A 3N1UA 3OCWA 5IS2A 3QUBA 4HGOA 3A1EA 3QUTA 5E0OA 2D2VA 2C8KA 5AICA 3U7EB 1SU4A 3KDPA 3I28A 2IYEA 3ZVLA 4BKMA 1Z4KA 3ZWKA 2G09A 3A1CA 3DNPA 5ALFA 2I55A 4Y2SA 3WK6A 5AKYA 2FPRA 5AI6A 3WK7A 4OFZA 5AVVA 2YJ6A 1X42A 2P9JA 1YV9A 4C4SA 5AW0A 4I9GA 3BWVA 5ALPA 2EATA 1RKQA 1FEZA 2ODAA 4Y2JA 2W4MA 3M9LA 2DQSA 3L8HA 4UMEA 3ET5A 3HYCA 5ALQA 1PW5A 3AR9A 1QQ7A 3ZWDA 2G07A 3SLRA 4UMFA 4AS3A 1RQLA 1ZJJA 2AUTA 2MU1A 5AKXA 2CFTA 3PGVA 4ZEWA 2GMWA 3WK9A 2G08A 4NV0A 3CNHA 5ALVA 1Z5GA 3QXGA 5AI0A 4YCNA 4CNQA 5AVUA 4YCLA 1ZS9A 3OCXA 4BEVA 3PCTA 3EPRA 4CF3A 4G63A 1RLOA 1XP5A 5ALUA 5AKGA 1XPJA 4BX3A 5AKKA 1QH9A 4Y2QA 5FP0A 5AVTA 4RETA 4OCZA 2JAOA 1U7PA 4Y2XA 1RKVA 5IT0A 2R8ZA 3UM9A 2IOFK 3L8GA 3L0YA 1RMYA 2WM8A 5AM2A 2BDEA 2I7DA 2HOQA 2YJ5A 4BEWA 3QU2A 2CFRA 4IG4A 5A3QA 1CR6A 3QUCA 1NRWA 3MC1A 3VAYA 3QNMA 4HGPA 2P11A 2ZBFA 2FEAA 1Y8AA 3NALA 2G1AA 4J2TA 2YMPA 2OYCA 3UMCA 3J7TA 4G9BA 3SHQA 2YFYA 3ZVMA 4XPZA 2B82A 2I34A 5IT4A 3BA6A 3ZU6A 3MPOA 5AW2A 5ALKA 2ZBEA 3NRJA 4KX5A 2JGAA 2G80A 2GHTA 4NFLA 3AR5A 1ZD4A 1L7MA 3QUQA 2QYHA 5AW7A 1WZCA 1Z4PX 2AGVA 5ALGA 3NANA 4GXTA 4DCCA 2NO4A 1O08A 1XVIA 2P69A 1RRCA 1QQ6A 2YMMA 4NWIA 5ALZA 3ZI4A 2R8EA 3U26A 2YJ3A 1ZRMA 3ZTYA 5AKEA 2YN4A 2O9JA 2Q4RA 2HF7A 5AK6A 3ZUPA 3QGMA 1T5TA 1AQ6A 1YNSA 5AW9A 3I1YA 4XE5A 5AVXA 4HAIA 1U7OA 4EZEA 1Z88A 3N5KA 1O03A 4FE3A 3L7YA 2WF7A 2W11A 4JDPA 2JAWA 4EELA 1LVHA 5AIAA 4DFDA 5AKIA 2VKQA 4GIBA 3L0BA 2MSNA 3ONNA 5AVWA 2FUEA 4BX0A 5ALTA 4UATA 3S6JA 4DW8A 5AW3A 2QLTA 3SF0A 1SWWA 3CZ4A 3QLEA 1RMTA 1N8NA 2O2XA 3EWIA 5AM4A 2RB5A 3SKXA 1S8OA 1RKUA 3U7GA 2RBKA 5A3RA 4MWOA 4BBJA 4UARA 1SWVA 3ET4A 4F71A 1ZOLA 5AW1A 2WFAA 5AM3A 3W5BA 1QYIA 5AI8A 3B8EA 3QU5A 4UMVA 4KYTA 1L7PA 4FYPA 5AKJA 3KZXA 2HI0A 1YMQA 4KNWA 3N8GA 4Y3UA 1L8OA 2PQ0A 1RQNA 1MH9A 5ALYA 1LTQA 3W5CA 4XOUA 4AP9A 5AW6A 3E8MA 1Z4OA 1JUDA 4L57A 3FM9A 2AMYA 3WK5A 1L7NA 2HEGA 4ZEXA 3QU4A 5AVQA 1L8LA 3AR8A 5ALEA 1CQZA 2FPXA 2OA0A 3W5AA 4YIKA 2IOFA 1YJ5A 1L6RA 3AR7A 4UM7A 5ALNA 1WR8A 3A1DA 3I6BA 1VJ5A 3U7FB 5AW8A 2B8EA 4FFDA 2G06A 4UM5A 3WKCA 2R8XA 4EENA 3ZX5A 3L0CA 3QU9A 2JAUA 3B9RA 2RAVA 4YIHA 3L8FA 2B30A 3EF0A 5ALLA 2HCFA 5AHXA 4KN8A 3N28A 3EF1A 2HHLA 3IB6A 2IA5A 4JB3A 5AKZA 1WPGA 1YS9A 2I6XA 3NIWA 4OD0A 1KYTA 4UASA 4O8CA 3AR4A 2HO4A 3U7HB 4BNDB 4MUMA 2FDRA 3N07A 3RF6A 4YH1A 4Y2RA 3PGLA 1Z4NA 3GYGA 1Z5UA 2WF9A 5AVYA 1J8DA 5ALRA 3ESQA 5AI4A 3K1ZA 1EK1A 2FPWA 3WKDA 3NAMA 2Q5EA 2GO7A 2C9MA 3TLMA 1S2OA 1ZD2P 3ZX4A 5AESA 1ZD5A 2YMLA 2HX1A 3E84A 4Y2VA 3WK4A 1F5SA 3M1YA 3R9KA 3R4CA 2B1RA 3ESRA 3IJ5A 5AIBA 3WKBA 3DV9A 5ALWA 3D6JA 2IOHA 5AK4A 2R8YA 5AVSA 4HGRA 1WVIA 4L6AA 5A3SA 2PKEA 2BDUA 4L6CA 4C4TA 2FPUA 3L5KA 4J03A 2NYVA 1U2TA 4KNVA 2W43A 5AK3A 2CN1A 4UW9A 3QX7A 2PR7A 1Z4IA 3R09A 5ALXA 3E58A 3DAOA 3QYPA 3AR3A 2YJ4A 3RFUA 4B6JA 2HSZA 1Z4QA 2EARA 3OPXA 3P96A 4EEKA 1T5SA 2Q4TA 2FPSA 3ZW7A 4AS2A 1U2SA 5ALSA 1Z4JA 5AW4A 4NABA 3U19A 3W5DA 3OTQA 1VFPA 2C4NA 3L1UA 4H1WA 5JJBA 3KC2A 3UMGA 1TA0A 4EX7A 2FUCA 3ED5A 4Y2TA 1J97A 3IRUA 5AM0A 3B9BA 4CF5A 2I54A 3A3YA 5AVZA 4KX3A 4OHFA 5AI9A 3ZVNA 1NNLA 2X4DA 1RMQA 5AKLA 3WKEA 1ZD3A 5AK5A 2I33A 3OCVA 2YBDA 2OM6A 5AKHA 1QQ5A 3WGVA 4HGQA 3FVVA 3KBBA 4UU1A 4IFTA 1Q92A 3PDWA 4DWOA 3SKYA 5ALMA 3FPBA 2CFSA 4F72A 2WF5A 2YY6A 4QJBA 2G0AA 2GHQA 3WK8A 4BYGA 5ALDA 2EAUA 5AI5A 1RPZA 4CE6A 1ZRNA 3WGUA 4Y2UA 4EX6A 1RDFA 3OCZA 2P27A 2B8JA 4UAVA 4YGYA 4HGNA 2WF8A 3AR6A 3FZQA 1RLTA 1TE2A 3U13A 3I76A 4QQFA
chains in the Genus database with same CATH superfamily
4HDKB 1S8FA 3BFJA 3IMEA 3VPFA 5KYUA 2ENUA 1DKMA 1HTTA 2IHBA 1EWKA 3T7RA 1G60A 1Q0UA 4O5AA 4CRWB 4CTMA 4N5DA 1LBTA 2CYBA 3H2JA 5D5HA 3H1EA 2PS1A 4I36A 4IVQA 1ZHOA 2IHYA 1A1SA 2M98A 2VCHA 3C3JA 3DE4X 3EBOA 3PHHA 4GLJA 3RD5A 5LMNB 5JT1A 4KPYA 1VJCA 3VMFA 1SG6A 3OURA 4BVFA 1E7MA 3DR3A 3PFFA 1EXMA 4YK7A 1CQPA 1RKBA 2E4UA 1OAOC 2CYCA 4EPXA 3SZOA 4RPJA 3ZD7A 4JELA 4UCQA 3RUFA 1MHTA 1D4AA 3DDCA 4P82A 1CJCA 5TQ2A 4Q4JB 2W00A 3M3PA 4II3A 3KKNA 2Y71A 4HO1X 1UF9A 2WJJA 5LWQA 2CMKA 3NDJA 1U02A 1BW9B 1EBUA 5FAKA 4C7OB 2A4MA 4LJ9A 4MCJA 1MB3A 1XKTA 3F46A 3HZHA 4RMHA 4Y7DA 2WABA 1XPUA 4FSHA 4O4JB 1Z13A 1MXHA 3X44A 3GXOA 3LCCA 5E8JA 3FYDA 5HFAA 1T29A 4NHEA 3JQFC 5M29A 1WXGA 2GPSA 1JG4A 4A6EA 1U80A 3PI7A 2GCNA 3PQEA 2Z57A 4WZBB 5BNWA 2NV6A 2O05A 1DB3A 1E3SA 1J33A 2Z95A 3DL0A 4L0MA 2J33A 2DPMA 4MB6A 1ZC4A 3SE0A 4KFCA 2HMUA 3OKAA 1OBCA 5K8IA 821PA 4GLOA 1H9CA 1P7YA 4DVJA 5BQPA 4HVLA 2UUPA 2RC6A 3IT3A 2R4TA 1R1DA 4ZZIA 1O5TA 4P7JA 1ZX1A 3OCWA 1R37A 2H1SA 4X1KB 4RBNA 1KVSA 4QOEA 1OHHA 2BGLA 1NASA 2I4NA 3O8DA 1LB1B 4US1R 4BKUA 1VKOA 1YASA 4KO2S 4ZREA 2C2MA 3DCNA 4RE5A 3LH5A 3I28A 1GPAA 5FBKA 3V5NA 5DK6A 2TYSB 1YKSA 1A96A 1U3GA 1P60A 2PEYA 3LGAA 2RH4A 4KXNA 4E7PA 4ZZ0A 2I55A 5DYIA 3IBCA 1IDOA 4RHCA 2C58A 1N34B 3LD9A 3WK7A 2CJXA 4QHTA 1FTYA 1X70A 3ROZA 5IU6A 1PQUA 4R01A 4RORA 3P9PA 4TRRA 2BHLA 5EWJA 3EIXA 1YOBA 3AEQA 3F3SA 4LY3A 1QE5A 4NE9A 4XWAA 3IIKA 1T26A 2GPBA 3FLBA 2DCMA 3MWEB 4I0WB 4OI4A 4EW6A 1GM5A 4IBOA 3BWVA 5ALPA 1TW3A 2J6IA 1JFVA 4DCNA 4B5LA 1HR0B 3R75A 4L6IA 5E3IA 3BD6A 3TE6A 2FK7A 1VKHA 4HX9A 4UMEA 1X7WA 2OO5A 4KNYA 3AR9A 5CB6A 5DM1A 4YXWA 5FNVB 4DTCA 4US0R 4RCVA 4J1SA 3KEMA 5LA6B 3AGQA 4WOJA 3VHLB 2QMQA 3N2GA 2FEWB 1C2YA 5IX8A 3PGVA 3KR2A 4F84A 4LMPA 2GAAA 1N2ZA 1VYUA 6YASA 1JG7A 1VP3A 3KSZO 1JLHA 3HGTA 1XCJA 4DC1A 1C4KA 3PLRA 4I6JA 2HLDD 4LXXA 4X1IB 4RQBA 1UBMS 3SHFA 1ISJA 5FTNA 4HNRA 3E9DA 4EJSB 4BNMA 4KWTA 3WGNA 4RLFA 1SVKA 5TEVA 3CE9A 3U3RA 2FN3A 3G79A 4YQFA 4G23A 1RJEA 1QHGA 1WZEA 1XVTA 2X15A 1XU9A 5DGXA 3SYRA 3TRKA 3WDSA 2BTQB 1K7YA 5AKKA 2GCEA 4MINA 3BAZA 4B4OA 4DJAA 3L6EA 3A9WA 3G0BA 1SAYA 2NG1A 3O82A 5FOVA 3SNKA 3W6ZA 4CZ2A 2P9GA 4KQCA 3HRKA 4C3OB 5JEDA 1P2SA 2BHNA 3PFCA 4JZYA 1KMCA 3NV9A 2VNKA 7ADHA 2DQ4A 2B0JA 2JH9A 1FBNA 1J8VA 1XZCA 3Q6MA 5NULA 2KX7A 1EPUA 2XA1A 2PWAA 1RXYA 3IQWA 4NH0A 2A9PA 4UAGA 1E4EB 3L79A 3ANTA 3HKBA 1JA1A 4MLCA 4R40A 4DMHA 3NHZA 1GFZA 2GZAA 3MJCA 4FMCB 3VM6A 2WA1A 4P0PB 1XD8A 1XZNA 4GE0A 4JLBA 2WG0A 1HT1E 1LZLA 3U1TA 4HGPA 2W2LA 1RC1A 2AZ4A 2ZQ5A 6LDHA 3PDJA 4IDDA 2OYCA 3CKYA 2I9KA 1R0XA 7REQA 4LEIA 4WZAA 5D3QA 4BFUA 3J7TA 1J0AA 4KTVE 5HKBA 4IDGA 2BM1A 2OYSA 4X45A 4IQ0A 2HU2A 2YHUA 1DAPA 3DC2A 2Z8YA 3KQKA 5JS2A 2WB2A 2B82A 1O6GA 3PRJA 4IKPA 2WU8A 1LPAB 1R66A 5BSKA 1GNSA 3AVQA 3B7PA 4QUBA 1P1HA 1AGYA 3FVQA 4MRPA 2J9XB 2JS7A 5DGCA 3RK4A 3EJ6A 3O74A 3OU6A 4NFLA 2CJYA 3D5EA 3TQOA 1N2CB 3HY4A 3OZDA 5EJIA 1DHRA 2WKQA 2V9ZA 3ZHBA 1E3EA 2XMCA 2IP1A 2EBHX 1ATIA 2ZAIA 1N4DA 3JYOA 3PQ5A 5JQGA 1G6Q1 3H42B 1Y37A 1WZCA 4BP3A 4BTVA 1K92A 1QV7A 1OH7A 4F12A 4IUBS 1R00A 2GDZA 3OG9A 2RGRA 5F33A 4PC3A 3EH1A 3SQNA 2IRWA 3P2MA 1T9GR 5EIEA 3OA0A 1MNAA 2PX0A 4MUXA 3TJMA 1BX1A 1W6RA 2DGDA 3H05A 2WA2A 3FDZA 3AB3A 5IXYA 1RQ7A 3EEYA 2FHSA 3LX8A 1H2RS 4MUIA 2R8OA 2DY1A 1JQKA 1XQXA 2CLFB 2Q2NA 1PNTA 2QLMA 5KJ6A 4L5BA 2IYRA 4P1ZA 1CVIA 1WW3A 2PUTA 3HVUA 5AW9A 1EAYA 1VJDA 2C5FA 2QTFA 3DVAA 4GZ3A 3VISA 1Y1RA 2VK1A 2ZYDA 2EP8A 1YF3A 4WUTA 4D74A 5AUQA 1CV2A 1V1MA 1N57A 2XAAA 1L4YA 3AJAA 3P19A 4JN6B 4TTVA 1GTSA 4JC5A 4PAGA 4ENRA 5HPYB 4E70A 3DDOA 1AXEA 1KXZA 2VLIA 3H84A 3VC7A 3BFPA 1C8KA 1B8UA 1GEGA 2JJ8A 1NWHA 3IDAA 4UM8B 1UT6A 2NZVG 4XGRA 4EELA 3VKFA 3VSDA 1Z35A 3EMKA 5A9TA 1C0KA 2EZ9A 3P9CA 2Z2JA 2DHDA 2X8WA 4FYYA 4HDNB 5HE8A 3RSGA 2V7PA 1EJ6A 3GHYA 3EYWA 3P0RA 1JFLA 1XTIA 4C7XA 5BW5A 3WL3A 1HQCA 2MR5A 1TU0A 1X38A 3EGDB 2JBAA 5EEGA 3M70A 3HO6A 4NZOA 4IFBA 1H66A 4HN4B 3S8EA 4MVJH 1BQ4A 3DS8A 3WL6A 5T7BA 1QTIA 1N2EA 1T10A 1M1YE 1SWWA 3N74A 4C29A 4HDMA 2X4GA 1JKJA 4QOJA 5F5LA 3I30X 4DA6A 4NESA 3RABA 2VUIB 6PFKA 1A76A 1M6VA 3UN1A 2HH9A 3LAWA 2BCEA 4NDAA 1QU2A 4LOIA 4B71A 4RZUA 1A7AA 2IEAA 3FCEA 1RZUA 2QHXA 4HR7A 4W5WA 1R74A 2CVOA 4NG4A 3T5MA 1BVRA 1YCGA 1OC4A 1WPRA 4AY6A 3CXRA 2NO1A 4TT3D 2R9VA 3DT9A 1UPFA 2XEXA 2XKJE 4YMGA 1TZBA 4OIFA 4N8EA 4EMUA 2HCRA 3U9TA 2JAQA 3HO1A 2BISA 3A1TA 2A0YA 4YUAA 5IBPA 3BORA 2XYHA 2OAEA 2V65A 3M81A 1VKZA 3PE3A 5ABPA 2GZ3A 1TZMA 2AWNA 1RAIA 3JATB 2GLUA 3KQYA 2PRSA 1BKSB 3QEMA 4HWOA 1N5OX 4KR2A 3A4LA 1CR4A 1C9DB 1FYWA 2ZIWB 2BVNA 4AP6A 3I0ZA 2IK8A 4E33A 1MHPA 3IH5A 4DDHA 2QWXA 1JHOA 3NDRA 3IC5A 3X43A 4IOJA 1Z06A 1P9LA 4HEHA 1ZUHA 3QK7A 4LNUA 3LRPA 3PWKA 4OJNA 2WWVD 5GQSA 1KJ9A 1XDGA 5SV2A 4X85A 1OXKB 1P1FA 2JIOA 4BO9A 2ZJ5A 2FG6C 1V6SA 2R8BA 3HO8A 2VOEA 3MS2A 3S2SA 2GJAA 2H3EA 5EQJB 5KYXA 4UKDA 1YR8A 3EQ6A 2OHVA 2ZJAA 3I5XA 3FE2A 5FLEX 2J5QA 4F46A 1QP4A 3L0CA 4XB1A 1XF9A 1SOMA 3QVGB 4EG0A 1A7JA 4ADSG 2LZ0A 2V6BA 2KS6A 3AOEA 3VYSB 1HTWA 1TRKA 3KR9A 1HLDA 2BSAA 3AK4A 3JSXA 2HF9A 2XT9A 2YZ2A 5FHQA 3V4VB 2FEKA 4H18A 1CUGA 5IP5A 2YFQA 1V39A 2XCSB 4CWAA 2XW6A 1SHJA 3GMSA 4NBWA 4PIVA 4Q7QA 4UASA 2B83A 3SS8A 1LQ2A 3PQ6A 1VPTA 3WBJA 1WXHA 3OOWA 4KPUA 3U7HB 1MVNA 3IAHA 1SH7A 3UHFA 1UBFA 4KLRA 5HKLA 1RHJA 3I58A 1E2JA 4CFSA 2IP2A 4KAJA 2W6QA 1UBHS 1MRSA 4E1AA 1G64A 5JBQA 1E0JA 3UJ9A 4M7RA 4D0RA 4LF5B 2RKOA 4B6FA 4MV6A 4C0XA 3ZWNA 3A6EA 3H4MA 3CB2A 4H7KA 1YGPA 2FPGA 2Q5EA 4HVAA 3ICOA 4NENB 1GGKA 2WYOA 4OGFA 3MUEA 3ZDFA 4V1CB 1CE8A 1FTSA 4MDFA 1Q6YA 4JI1B 2OCGA 4X7MA 2PXHA 1FJXA 1BOOA 1DO0A 2HX1A 3CLRD 4XIFA 3R77A 1E3WB 5KNBD 2ZFUA 5A7GA 1G8MA 4RPCA 2B1RA 3PDCA 3QVLA 2LDXA 4EG5A 4B7ZA 2Y1KA 4HAUA 5B6JA 2PD3A 3OE5A 2YTZA 2ZYGA 4XFJA 4IFIA 4PLPA 5D3KA 1Z08A 1WQ4A 1X7YB 2JGIA 4UVDA 4Z3DA 2XBMA 4F5WA 1CFZA 3IVCA 3MPUA 5K6RA 3WWZA 5IAOA 1WMEA 4M0UA 4PNEA 1I1QB 3KYCB 1R8QA 1D5CA 4ZCRA 4ZCQA 4R8SA 5K8TA 4UFNA 1M2OB 5JXJA 3FYTA 3D1VA 4Y6QA 4KK3A 2GAOA 1E66A 1QO0A 1VLZA 1SHZA 4IGFA 4FFMA 4LCJA 4FYHA 4H7EA 3AEUB 1OPRA 3TIXB 5DRTA 3R5TA 2D7JA 2QL5A 3OZFA 3PNBA 3R09A 4P4SB 1CPYA 4AMBA 3BD8A 2CSUA 2HA2A 2QIOA 1G7CA 1Z4QA 3B1FA 3OPXA 4LJ4A 2ZPTX 1T1IA 1S6YA 1DUIA 1XD9A 2GCPA 3O5AA 5J3JA 4LQ4A 5IKPA 1TO1E 3OP4A 4M6WB 4L8LA 4RQUA 3H3XA 1E2EA 3Q85A 2Q5LA 1GQYA 3EFHA 1U0RA 4M9XA 1XZPA 2VWPA 4NABA 4QC2A 1ABEA 2H9YA 1NF3A 3AM3A 2PZKA 3JQAB 2YN0A 2PS3A 1W30A 2YYZA 3BK2A 2FWRA 4FX2A 3DWGA 4R6XA 5CPFA 3ZNPA 1VFPA 4MV8A 3WBKA 3JPYA 3A6PC 1ZMTA 1L7AA 3QPAA 5GJVC 1XJ0A 5CM9C 1SFRA 1EXDA 1IBMB 1NYQA 3T3DA 1RIIA 3ZW9A 2HC9A 5AM0A 3GRFA 4ZVTA 1EHIA 3TRJA 1TGYA 2FETA 3TZ6A 4P3KA 1JHUA 1ULSA 3QF4B 3RRYA 3I9FA 5JAZA 2UUBB 2DPHA 1Z38A 2DQZA 1OKKD 3IMCA 1PK7A 3N2KB 4V2UA 4DRXB 3AXTA 4R1PA 1G21E 2EFJA 1Z37A 2PWPA 5AHKA 3TZQA 1XIVA 3FRIA 1PR6A 1Z8FA 2CXPA 2R6HA 1Q50A 4DL9A 3JARB 1CY6A 4BQIA 3K3PA 1FPMA 3G2OA 3GLHE 1MQ9A 1ZQ9A 3TZHA 5KQSA 1J7JA 6REQA 3RG2A 1SG0A 1OAKA 5MN4A 1RRPA 1PFKA 4J6FA 1P9WA 3L9XA 1JH9A 3PDWA 5I9MA 2ZYWX 3HHEA 4C7KA 2F1RA 3KX2A 3LUAA 5I7AA 3TMYA 3PPWA 1VRVA 4GWLA 3NDBB 2E5WA 5FPYA 2X8BA 1ZI8A 3HKEB 4TTSA 2WF5A 3HB1A 4K9OA 4RPLA 2HJ9A 2Z8YM 3WK8A 3Q2OA 3TLAA 1K5PA 5EG5A 5F3RA 3D31A 2VA8A 5FCDA 1VKRA 2XQJA 5HIIA 4B7UA 3AMVA 3I2IA 1YWGO 4F9TA 1A8QA 2ZRPA 4HDKA 4RTOA 2YYSA 2IDMA 2JD1A 1V8OA 2GERA 4HWGA 4XRGA 2PLRA 1U2GA 4UAVA 1GSOA 2XRFA 5ICSA 3S1LA 4LFCB 4LWPA 4MTLA 3UJCA 2PX2A 1U4NA 3JWEA 4IIDA 3IIMA 3CEHA 3GUUA 4NU0A 3MAGA 1VJ0A 2ZUWA 3H9JA 3RKRA 5GIOE 1P19A 2BUAA 2QYTA 1U90A 2V03A 4KXVA 4V0RA 2H4XA 2QTTA 2C8JA 2O7VA 4MUFA 4WD3A 3QOWA 4XM2A 3AIKA 2YMQA 1NQWA 2Q7OE 5DM4A 2RJNA 1ABFA 3EH2A 3OIVA 3GDOA 4GLLA 3HNRA 2D3WA 3LOPA 3L7JA 3SS7X 2JARA 2QUZA 4Q4JA 4Y1GA 1YS4A 3OETA 3C7TA 4QYIB 4KOEC 2O8EB 3OE7A 2OXRA 3SIPA 1QGUB 4CQMB 1XLVA 1XAIA 3DUWA 3CRNA 2I71A 4H7FA 3SHVA 1SCKA 1ANKA 3CUVA 3H0EA 3SD7A 1BW9A 1EB9A 1L7EA 1UBNA 4C7OA 2HIGA 4EB6A 1EFVB 3D6AA 4MQBA 1FY2A 1C81A 1KU6A 4O4JA 1GR0A 2CBGA 2HL6A 5ALIA 1I33A 1U94A 4CG3A 4G8DA 4F5YA 3D3WB 3UYLA 2ZTLA 5EGNA 1WNTA 2C77A 4OA8A 3V32A 5JEEA 1M3SA 1WCWA 4O3FA 3L8EA 3THYB 4OLHA 4WZBA 1WLSA 4OXYA 3DZKA 4HVCA 1RHMA 2WP0A 3NIBA 5D6NA 1RC8A 3CLTD 3K0FB 3K92A 4K6GA 3GFSA 4A0FA 4L4XA 3K05A 1ZMRA 2Z58A 2Q6LA 2AK3A 5FORA 3EC2A 4YUYA 5E6UB 1N33B 3WYNA 3CVYA 2WYVA 1D0SA 2P62A 1GGMA 1KI9A 1TJ3A 3QBEA 1VJRA 1Y42X 1CDZA 5D7BA 2GRAA 2CMDA 2C1EA 1T4GA 2QAGB 3RQIA 1E3MA 2QV7A 1P6QA 1BWQA 3EZ7A 3VYTB 1MAWA 1NW7A 3BMOB 3K94A 3E7PA 3PXGA 1ZG3A 5CDFA 4E32A 3QUTA 3ZJTA 3LT1A 3I2HA 5BYKA 4EZBA 2NVOA 2QLNA 1CVLA 2FRVA 1PWXA 4ITUA 9MHTA 5EP2A 4B75A 1CNMA 3SFTA 3KFXA 4TZKA 2G9QA 4ZVOA 1E1DA 3MW8A 3QY0A 4RFVA 4ZU3A 4DJEC 3NOQA 3EMDA 1VXOA 3DFMA 3H9CA 3OIWA 3UXEA 3ZZ0A 5HR5A 3KHSA 3E2IA 1IZ9A 4ID3A 4K03A 3ZWOA 4E2FA 5IHXA 4YRKA 5KX5F 1GAXA 2JCVA 4R2HA 4XYEA 1KI3A 1OFIA 3MWEA 1QRUA 1RTTA 4URUR 4B83A 2ZSUA 4D4HA 1T5OA 1LVGA 4NJEB 1EFKA 1H0KA 2PZ8A 2CLOB 2A9FA 4R3UC 3M0EA 4LZOA 4FEYA 3MILA 3A6LA 4FQ8A 4NZ9A 1TEVA 3I01M 3PR3A 2X76A 1F5NA 5HRCA 5KYKA 2D1YA 1E0DA 2C5LA 5IDVA 2H07A 1PFUA 3ILVA 4WY5A 4B6PA 1HYBA 1EFUA 3HYCA 1POXA 3OP1A 4KV7A 4PQGA 1MV8A 1ENOA 2FUG1 2H4ZA 2VI5A 2IFTA 2W4QA 3QFHA 4FOSA 4A0HA 1NVXQ 2PNFA 4UMFA 4U9HS 2QR5A 4MVJF 2HBQA 4AM8A 5LP1A 4MX8A 1I0LA 3W2IA 4BNZA 1WD5A 4ZDIA 4LC9A 3HPRA 5L95A 2ODTX 3K35A 3RR2A 1W8IA 1WY7A 3HBJA 4PR0A 5FTMA 2VQ3A 4EJSA 1CJTC 3HV2A 5JCZA 2CLMB 3VR6A 1TZJA 1U7TA 1WXFA 4GLFA 2DE0X 1KYQA 5AWFC 4YC7A 4CNQA 2BTQA 2E49A 1E1QD 4IOKA 1PKEA 3DE1X 2F3SA 1UQUA 5FADA 5CXXA 1Z0IA 1ZUWA 4QPPA 5HKOA 5IBQA 2HDNB 3QVUA 1XKLA 4FFOA 1XPJA 4EI7A 1C9JA 4N9QA 4W9NA 4Y2QA 1XBTA 1FW8A 1BA2A 1LFDB 1P3DA 2EEPA 5J9FA 1P8AA 1UAGA 3LWZA 1KI8A 1SCQA 1J2EA 2FG5A 2NPIA 5IUJC 1XK7A 1CD5A 1UL1X 1E4EA 1YQWA 4EKYA 3GRYA 4YV2A 2XVMA 4G07A 1JXMA 4G8JA 1IJFA 1LSSA 3OPVA 2B94A 2BGKA 4KO8A 3IPRA 4MTCA 3PD1A 4DYHA 4TTPA 5BRJA 4CQNA 2QN7A 3TECE 2IZOA 3PNVA 3NJ8A 1WUIS 3GH1A 4IG4A 3IQXA 5K0SA 3R6WA 3THWB 2ZIGA 1AH2A 2Q6TA 1M8PA 3RWOA 2C3OA 3V1MA 1IHDA 2QL9A 4KDFA 3OLZA 4KAAA 5D7NA 1PTJC 2AOUB 4TN5A 4MSUA 3F47A 4E5PA 1DX6A 3Q3HA 1GQQA 1ORWA 5COQA 2RGYA 2I87A 3AJEA 3ZE0B 1NUAA 1RWQA 3PJRA 4V0NA 1JHRA 2YXNA 3OTIA 1O4WA 1NTRA 1YE3A 2ZIZA 1Y9EA 2AXNA 3WIVA 4RL6A 3WRXA 1HLFA 4JYPA 1QG2A 1Z7YA 2FR1A 1ZCFA 1X13A 1N2CA 1XRSB 2AFRA 3Q9LA 4K9SA 4U2CA 1W36D 1P9RA 2I4LA 2G70A 1ZIPA 4KQJA 4BLPA 4PBTA 3MPOA 4ZAZA 4S1TA 1ZHHA 3AIOA 3HJRA 5DO9A 2AC7A 1O96A 3L8YA 2PH5A 1O9GA 3BEOA 4N0PA 2GRUA 4GRAA 1KJYA 4JH0A 2AEFA 1N5RA 1B4DA 1H2XA 1SUBA 1TVCA 2WHPB 1JJIA 2VNIA 4G0NA 2POQX 1C3VA 3K0EA 1JVBA 4CIAA 2FPIB 4US2R 4LGVA 1V25A 2XVZA 3V8VA 5E1OA 4TL9A 2EF1A 3PYMA 4KQ9A 2B2XA 2IUFA 3L0PA 2QRNA 5EJGA 4DZTA 3N7AA 2C9DA 1O08A 1FP7A 2P69A 4ZARA 3U4HA 3D1LA 3NNDA 3C6QA 2I29A 3ACCA 3B20A 1Z6TA 3PUXA 4FGZA 5JNWA 1ZN2A 3U26A 5DLYA 4AD8A 2FWAA 4B81A 4DWWA 3P4XA 1C9NA 1MA3A 1TVKB 4P81A 2YN4A 4P53A 5JS8A 3HR7A 1HSOA 1EB8A 3Q88A 2G7ZA 1P4HA 2JAHA 2JLRA 1VE7A 5NLLA 2GILA 4N12A 2L19A 4BNJA 3MELA 4Q03A 1G8YA 2NYAA 4ZC8A 1ZJ5A 3A7EA 1G5HA 3EFEA 1Q7EA 4XE5A 3HCFA 4XSVA 2I9PA 2SKEA 4YWHA 1FFGA 4D25A 2QR2A 3O73A 3N5KA 2PSDA 3KL4A 5JSHA 1KZ9A 2A5FA 1SPXA 2NXCA 1LK0A 1P1IA 4HJRA 1RP7A 2B61A 3Q7SA 1HKHA 1TM5E 2PVCA 3EGDA 5HJ5A 4DLSA 2H11A 3RRFA 3GJ6A 4EJ6A 3REFA 1T9BA 1U0LA 4LNAA 1JDPA 1GV1A 4X8HA 3OMWA 3ZQKA 3TWOA 4OHKA 3AVWA 2QMUA 4W82A 4MA0A 3X1XA 3H9BA 4XR9A 5BVHB 4GI2A 4WFJA 3AI1A 2XODA 4ALNA 3KQQA 4KEAA 3L0SA 2PSHA 5H4GA 4HDOB 2G25A 3KXKA 1C0EA 3HFGA 1RMTA 3R0VA 1Q14A 2WIBA 3LTEA 1TM2A 1DKUA 1S8OA 2AZMA 3O8OB 1VGVA 5K3DA 3OEYA 1E32A 2H2AA 4UNQA 1L7VC 2IUUA 3QMVA 3IBGA 4CV0A 4DREA 1OVGA 1NRJB 2I65A 4DLXA 1ZOLA 1NVKA 4PLYA 2EKZA 1Q11A 4K6KA 1J0DA 1VB3A 3K09A 5JDCC 3DMYA 4P2BA 5F1YA 4GVXA 3SQMA 1BCRA 1A27A 1B6TA 2OV1A 2D4AA 2QTCA 3ZHUA 4KRFA 3I1IA 2JA2A 4MPRA 3PC4A 2HK6A 2WM3A 2ZWPA 4PHGA 2J3DA 5CYOA 2B2CA 2V97A 2H1OA 1M9NA 4BVHA 1FRVA 4JB2A 4QUDA 4GE3A 1DELA 3GR6A 4KN6A 5T8KA 3W5CA 4A15A 3QUAA 1FXWA 5AW6A 3F74A 4E94A 1WP4A 3FZEA 1P31A 1SC6A 1ID8A 1JUDA 3HXKA 1WMSA 1N36B 3B8HA 1L5RA 3UAYA 2DT5A 3GFGA 3GI1A 3B60A 1FFCA 1JG3A 2C2WA 1AF7A 2UV8A 4JL5A 3HFRA 3B1WA 2WQ6A 3QMPA 3EXFB 4XX1A 3CZ5A 4BNGA 1E7QA 1E5TA 1K08A 1TXGA 3QWHA 3QXSA 1XQ1A 4BQNA 2N1MA 2XCLA 3RW9A 2VRNA 2FX3A 1OH8A 1QDUA 3G0DA 2IT1A 3ICVA 1OLXB 4PTLA 4FNAA 2XLCA 3V8PA 3QVGA 4H59A 1V4VA 3PRKE 4Q9IA 3IDFA 3KR0A 3T7EA 4TMFA 4BVJA 2H4WA 1K7FB 4UD6A 2X8AA 4CQJA 1NW9B 2BJVA 4B6GA 2AQ8A 4F6CA 2W2NA 2HPHA 2QZ4A 1B8OA 4KV9A 1YQEA 3N70A 2EZTA 4LSZA 1GPWB 2O4CA 4EA9A 3T54A 3BGDA 1IXKA 3GLGE 2DH5A 4NC9A 4Y1EA 4CKEB 4CETA 1W5BA 1N75A 4I2NA 2J3IA 4KN8A 1T8RA 4XCQA 4CM8B 1E4VA 1FX1A 4ZK6A 2GSDA 1T91A 4L08A 3ZIAA 2QX6A 3EPHA 2EKBA 3COSA 3P2KA 1Z6GA 2PVPA 2V3WA 1KYTA 1SKAA 4K9KA 3D0RA 4A2PA 4OQMA 4IX1A 4M36A 3R3YA 3D7RA 4HTFB 2LXNA 3PEVA 5K3OA 4OQFA 5HGXA 4IHJB 3L5OA 1NDHA 3BH0A 4BUZA 2SHKA 1RAHA 3K0KA 3M6VA 4NENA 4P3XA 5KTNA 1Y6GA 2R8PA 4V1CA 5AOAA 3FA2A 1OB5A 1RM3A 3K8QA 4U7TB 3FY4A 3K1TA 2H31A 4BGEA 1E3WA 2OMEA 3EUAA 1PT6A 3GIWA 1BFUA 3C2QA 1R4NB 4JB0A 4P83A 4GR5A 4J49A 5TSDA 1FCJA 1KQ3A 3TCXB 1DJMA 1PR5A 3WDMA 3WK4A 3LKDA 3PA8A 2FPLA 1WV0A 1X7YA 4Q4HB 4U5QA 5JZMA 2QRKA 4ER0A 5A2QA 1F4PA 4OH1A 4ZO8A 2VHEA 1SR8A 3T0FA 1Z2DA 1IXSB 4H4EA 4BNVA 4LRWA 1G5IA 5AUNB 3KYCA 3LHDA 4PG7A 4QUHA 5HJ7A 4JI8B 5B53A 1QH8B 3DYBA 4JUFA 2C0PA 3C3WA 4AZSA 3OJWA 3VR4D 3AG6A 2IYPA 2I2DA 3AILA 4MNTA 3AQ4A 3W9BA 2FNAA 3AEUA 2WAOA 3E9CA 1LNQA 4EY7A 4EKIA 2NQ2C 4WKNA 3EBLA 3F7TA 4P4SA 3RBZA 3S2FA 1WUYA 2NVWA 1V8PA 3G6WA 4L9RA 2O07A 4TVOA 1J49A 4L5IA 2CEKA 4TXMA 3FAZA 2AR7A 5DK4A 5IBRA 5A0FA 1WS6A 4M6WA 4BVKA 4E11A 4EHHA 1LW6E 1OWLA 3K53A 4N3AA 1K7SN 3ZU2A 3D8RA 1GRVA 2HY7A 3HBLA 3OC0A 4GMKA 5GADl 3O1JC 3LFUA 3JQAA 4Q1EA 4TKVB 1KR2A 1M0TA 1R0BA 2QYSA 2YV4A 1QH1B 1VE5A 4X71A 3WLMA 4JYBA 5EJ8A 1K89A 5EXPA 1QX3A 2XNKA 5JNSA 1COWD 2GZSA 1G0OA 1Q0LA 1Z4JA 3N86A 2Y1GA 1SBYA 2HYDA 1P2UA 4AULA 1E6WA 4CVNA 2M2IA 4ZCLA 4DV3B 2PX6A 3O8NA 2FFQA 3CCFA 3R6LA 3U4GA 621PA 3QF4A 3C48A 3HCRA 3WWOA 5K0EA 4KYVA 3NYWA 1PP4A 2Q0QA 3WIDA 3N2KA 3ED5A 1R5OA 4LXUA 4DRXA 4YRBA 3K8ZA 2XE8A 3L46A 5IFLA 1FNNA 4IL5A 5KVCA 1BO6A 1NYTA 2AC4A 3A3YA 3BIFA 2R6AA 3BXHA 4ENQA 1IN5A 2ESRA 3GQBB 3N2NA 4WX2B 3TB4A 1ONNA 5PGMA 2QVBA 1KFJB 3LBHA 3BTOA 4K9RA 1R64A 4MVJG 1Y7LA 4WINA 4LSMA 5IC6A 4J2OA 5B4UA 1Q0SA 3ENWA 1TF7A 3MJEA 3NGMA 3ZQ6A 4BQQA 1M5RA 4YI3A 3HA3A 2HHHB 3CSDA 2AIRA 4BE9A 3FWHA 1OQAA 1AX9A 3DHYA 3OZWA 1GKLA 1JEYA 1PV2A 4HGQA 3O4RA 4C4ZA 3PVCA 4FOPA 4YHBA 3RS9A 4D0NA 1KQPA 3HKEA 4RHTA 5J2TB 4ZO9A 5DN6A 2P9QA 3QSGA 3B1YA 1TF2A 3R40A 1S3FA 4L0DA 4RQAA 4ZT2A 1PR9A 3SQDA 2PUGA 2BLLA 3PLAE 2AFIB 1HC7A 2IEDA 3NETA 4C01A 1I7PA 3SFZA 3HS3A 4F38A 5LQKA 1XCPA 2OD9A 4IGIA 4E6EA 1SBQA 2QP4A 1LSUA 3E4CA 2EZ8A 1GFWA 1GZHB 2P7HA 4H2DA 4MUAA 2CV1A 3SDBA 3GMIA 2HWYA 1F3LA 4DOMA 2V3CC 5ALDA 2EAUA 4GUAA 5EGSA 3LCUA 4XSHA 2HSDA 1IWBB 1GRCA 4MLDA 1TB4A 2DFDA 1Q0RA 3OCZA 4XXHA 3O91A 3KV3O 3JD1A 4ERNA 2OCIA 1XMVA 3V2HA 1II9A 3TD9A 3UCFA 1BYIA 4BTEA 4DQUA 1D0IA 2HHAA 4CT0A 3H4IA 4BU0A 2ZBDA 3C70A 1QFSA 1VL0A 3K9GA 3QYJA 4LYFA 3VR5A 4B35A 4KKVA 4RY8A 1TLLA 1RHQA 4G36A 5IZ4A 3GCXA 1N0IA 3HLTA 3T9CA 2WJAA 5KOHA 2O8EA 1UXGA 3OCCA 4QYIA 2W2XA 2FGJA 2ZG6A 3BILA 1QGUA 1Q91A 4CQMA 2GFHA 2B37A 1K1EA 2FSFA 2E5LB 1ZK3A 2OBBA 3VOSA 5IABA 2XF8A 3NGXA 1S4QA 2V6GA 3COPA 3KB2A 4RV4A 1EFVA 5E7QA 2RJOA 4LMRA 2G9ZA 4PXSA 5IXJA 2ZI9A 3EGIA 4CMEA 4HEA1 1SVUA 5HQJA 5TR9A 2NTEA 4RH3A 2GBCA 5JFTA 4DA8A 3TDMA 2J3LA 3GXBA 2ORWA 2P40A 2X1VA 3S27A 2H29A 4IIJF 2CXQA 1RZ3A 3JYNA 4MULA 4AQDA 2VDPB 2OV8A 2D2EA 3DAFA 4TPKA 3NTQA 4MIKA 4WLVA 3F49S 5I7SA 5IPFA 3K0FA 2Z1DA 4FGWA 4ENTA 4WK4B 4M1QA 2I8LA 3BCRA 3TLXA 3CPSA 3HTXA 2C3UA 5E6UA 2AJTA 1MQAA 4EATA 2W2QA 1A0OA 1T3GA 3L6OO 3AFIA 3VV3A 3UMBA 4A36A 2JI7A 1OYWA 5BWCA 3U39A 5DTIA 3T5DA 3K8OE 3U4CA 2QTNA 5IK2D 1YR9A 3RIHA 3OQMA 5FULA 1GCIA 4ZCIA 1KL7A 4LZPA 2EQBA 5CHEA 2M1XA 2R62A 4EW1A 4EW3A 2DLCX 1L6IA 1TJ5A 3I61A 1LBHA 1F12A 3BMOA 2VZEA 4IXMA 4MS3B 4Z7OB 4G41A 3BF7A 1OIVA 1YCDA 3EVFA 2WUWE 1KY3A 4S1WA 1E1RA 1P2FA 2GA9A 2C1ZA 3TIVA 3V42A 3DVSX 5A7HA 5LQCA 4AECA 5IF9A 3SSNA 3VPAA 3E05A 3QWBA 4INOA 1DWQA 3P9ZA 1QO9A 5AR1A 3TLZA 4R0MA 2FQWA 3BT7A 3D7SA 4W1QA 4XWWA 3PDIA 5E2IA 4ZCTA 4PGHA 1ULHA 4YAFA 1LFAA 4YI5A 3AM1A 3ZWKA 1JSLA 2QT1A 3MXTA 3JQQA 5EL0A 2RGXA 2BRUC 4O1MA 1YHZA 1UWLA 4NJEA 4OI0A 1NQOA 4N8SA 4XDHA 4IHAA 4ZAGA 3SYTA 5GINE 1QHEA 3LWNA 3MIIA 3KRTA 1N0UA 1QYXA 4Q3BA 1N3YA 4IZOA 4HXGA 3TUIC 2A1UB 2O1EA 3RI3A 3E61A 4Y1FA 4WNCA 3TIFA 3NVMB 2FSVA 4PC2A 4UFOA 3RS7A 1J0XO 1KI4A 1ZU4A 3A8TA 3KE9A 4OKNA 3X2EA 2R85A 4E5MA 1JB1A 5KNCD 2FF5A 2EERA 4H3KB 4ZYXA 3LKVA 3A6ZA 4FM9A 2HSGA 2XTAA 1NFRA 3UAZA 1OZFA 3TZKA 2PH1A 2YIJA 5TY0A 4JUAA 1E7WA 3QF7A 4YBRA 3TQQA 2WVGA 4K6MA 3BHMA 2VQDA 3DA8A 2IIBA 1SOUA 4G85A 3WGMA 3K9FC 4QVKA 2OCPA 1W94A 2X9QA 4KGDA 5CITA 2BMFA 4KSCA 4QLAA 1EUCA 1L3BA 1XV5A 2FQ1A 1G9SA 3CLUD 5FLKA 2WC1A 5LOVF 1A71A 3CX7A 4HS4A 2C4MA 3GLKA 4JC4A 4F3YA 1WXXA 1BG6A 3P2YA 4ENPA 5DTEA 3V97A 3K5PA 3WC4A 4O08A 1KSGA 4QOFA 4BWYA 3T9FA 4DLVA 2NXEA 3OTGA 4EI2A 2ZRAA 2ZJ3A 5ALUA 1PQPA 1KAEA 1JAHA 5AVJA 3ZY4A 4O2LA 1U8TA 5KC8A 5FP0A 2JVKA 4LY6A 3VPDA 3DW3X 1JQEA 4FR5A 4LBZA 3RROA 3RGGA 4CKZA 2D4HA 1L5MA 1QGAA 3CEPB 4QVGA 2GCIA 3GN2A 3QOYA 4XDZA 3ICQB 1EVLA 1YDWA 4CNBA 2QIPA 4L16A 2ZXFA 4POAA 2CXSA 3QFRA 4U8HA 5DVZA 2VTEA 1KIMA 3UUFA 4ANFA 3Q40A 4JL6A 4YJ2F 1JFTA 3DZBA 4H1HA 5JTTA 3TFWA 4IM7A 4LVCA 4CM5A 4DDVA 4G0UA 2AOUA 1DPGA 2FKAA 2WWGA 2PEZA 4PFSA 5CLQA 4BO8A 3HP1A 3QUCA 2YXBA 4URYR 2V7XA 4ZHQF 5E6SB 2IYQA 3CVWA 1ZH6A 5L53A 3F4KA 4YMUA 1Q77A 4R8RA 4YRMA 1PFGA 3KALA 3SP1A 4F2HA 2UZAA 2ADMA 2XXBA 3FUXA 3FKSD 2FZ4A 4L5CA 5G1OA 3CKKA 1Q74A 4RHEA 2FLVA 4A1OA 5LP6A 3FYUA 1RQRA 4LHSA 1SD1A 1MC5A 1L4KA 2HWXA 4KL8S 4PFJA 3NTOA 2DBZA 1GA4A 1ESEA 2H7YA 1TX4B 3K0CC 3GGCA 4HV4A 3HJCA 1PU2A 3L02A 3QOXA 2K2QB 4DS3A 4F11A 3ETDA 4X61A 1O0CA 4TVSA 2GN0A 2G4LA 4CG2A 5H82A 1O95A 2GHTA 3LLMA 4OY3A 4PONA 4FEAA 2MHCA 2VLBA 2FPIA 3AR5A 4JKYA 1MVLA 4OL0A 1X7XA 4RZ2A 4UVEA 1QZ3A 4OI1A 1RRFA 4TN1A 4K3VA 3P2OA 4Y0NA 5AJUA 4EDFA 4JLNA 1CJSA 4V2IA 2P67A 1CEYA 5LZ7A 3ZHRA 4D92A 2CDRA 3D64A 4QNRA 4WFIA 5I4CA 5DPMA 4KK4A 3KJFA 2WTBA 4ZZ2A 5JAUA 5F12A 1D4FA 1R50A 2X6QA 1OE0A 1TVKA 4INZA 4NV3A 3RS4A 3ABOB 1CU1A 1JIQA 1CC1S 1NC3A 3S4YA 1ZGBA 3K70D 2Z6QA 2MR6A 3ROMA 5KEIA 1T4DA 1SHKA 2RGUA 5CRIA 1UH5A 2CEAA 3GPBA 5IKMA 2BDTA 3KYIB 4N3BA 4HJXA 2ZR0A 2IVZA 2PTGA 4NNOA 4BN4A 3S40A 5FFFA 3VU0A 3FUVA 3OFNA 2VP4A 5H68A 1GIAA 5HGJA 1JILA 2CHUA 2IX9A 2QW1A 3HBFA 5BV0A 1L5HA 1XJQA 5CW2A 1JJ7A 4FYMA 2QN3A 3EWSA 1BFDA 3G9QA 2A78A 3LY5A 2IS2A 4YFVA 3P0JA 2GVDC 4MIEA 2AN5A 3V55A 3DCYA 1HFEL 2EVWX 4F0JA 1UJMA 4RZSA 3TVYA 1GO2A 2AWOA 4Z8XA 2WMNB 1LVHA 3L8MA 4GMXA 3GY0A 4FINA 4UEOA 1LI7A 2J0SA 5TMDA 4LJ5A 2ORVA 4AJLA 4ZI3A 5AKIA 4TTTS 5BVHA 1PR4A 4HQKA 4HFMA 2QTZA 4HDRB 4I1PA 4RL4A 4HQRA 2HTFA 2WICA 1PNRA 1O87A 2G6TA 1UOQA 3IR7A 5C4GB 5FWDA 4JLOA 5CPBA 3R8FA 3KTDA 3G8YA 1VMDA 1K5GA 3MJVA 4HDCA 4XIGS 3O8OA 2VSOA 3VVMA 3NHWA 4DBLE 1IRIA 2A67A 1TTHA 2J87A 4FT4A 1XXHE 3I9MA 3SF0A 5KYXB 5DGHA 1OH6A 5C46F 3SKVA 3T3PB 5JH7F 4IEIA 4UDYX 4P5EA 2ZTSA 5H9VA 4KR7A 1DIRA 2E4YA 1E4YA 1XAJA 1RYHA 5FXMA 1NDUA 4MUJA 1IBCA 3PU6A 5TGZA 5F9FA 1UBLS 5DYTA 3LZ6A 3UENA 5K0BA 1GNVA 5CVJA 4O59O 4NEGA 3VH3A 1YKFA 5IXSA 3EB9A 3V1NA 2J59A 4MVYA 1TCAA 4W99A 4RZXA 4YJ3F 1L7PA 3O75A 3UB2A 2J46A 1ZNZA 2YJNA 1MJNA 4UU8A 4WK6A 4ML3A 5KJCA 2ZROA 1XO1A 1KP2A 3KKLA 3WNQA 3Q8LA 1TT5B 3N8GA 4DR4B 1DUSA 1L8OA 4QELA 4DIBA 1MH9A 4TWZA 3T5PA 1JIUA 4KO1S 2HUPA 3FR7A 4FOTA 1UJ4A 2C61A 4XOUA 1AQJA 1MG0A 3EXFA 7MHTA 4EWLA 2Z9DA 3NBAA 2NADA 4GP7A 3VJKA 5G1PA 1JR4A 2PQ6A 4IMIB 4MS1B 5DNWA 1HT0A 2H7VA 3EGWA 4ZEXA 5CDUA 1S2MA 2HMWA 3K7EA 5DE3A 5AXCA 1QIDA 2H5LA 2OCKA 2V45A 3D3QA 3ZQUA 2AF3C 3JQGB 4B4UA 2F4VB 4Q18A 4EGSA 2VF8A 2F1KA 1ECPA 2P9EA 2CV2A 4BNLA 4BVAA 3CW8X 1Y4SA 4S05A 2ZUUA 3GLIE 3IBFA 4JJ4A 3GUHA 4XJXA 3WQRA 2R86A 1K7CA 3SI7A 3SZRA 1PNVA 4ARIA 3CUKA 2E4ZA 1H5UA 1T9CA 2V74B 2GJ9A 1QDEA 4ZCSA 1YB5A 3R7WB 2ZRMA 1VHDA 5B1EA 4CKEA 2FHPA 1FJHA 1GZ4A 3KZKA 3TINA 1C1DA 2V7QD 4CM8A 3TXAA 3R76A 4JQCA 2REQB 1SXJC 1PL0A 2GFQA 3FZNA 3WTCA 2P9HA 2P79A 2BGGA 1I13A 3BSWA 3WBFA 2J8ZA 4CTKA 2FE4A 3EF1A 4WMLA 3IOYA 3K0BA 4FN4A 1AIPA 4IHJA 3AUYA 3RTBA 1OR8A 1D8TA 4EECA 1VJTA 4X7PA 1OF1A 1L5VA 4W7SA 2CD9A 3HU5A 1PWYE 2P1DA 3EZFA 6GPBA 4QFBA 4F04A 4BB6A 1PJSA 3BK1A 3N07A 4N7JA 4QHSA 4RKFA 2HFJA 4X9XA 2DXIA 5LDGA 5CDSA 1V9LA 2FQXA 2O1SA 4OB6A 4XGNA 3GFFA 4N49A 2AKAB 4BO3A 4DM7A 1R4NA 1CR0A 1WJGA 3GAMA 2XNDA 3HJGA 3B6ZA 4OGKA 2FZ5A 1NY6A 1F7VA 4UOEA 4JNKA 2ISQA 3ADCA 2A1TS 3ZGZA 4P4TA 2JFPA 3SICE 4Q4HA 2CUZA 4B45A 3ENNA 4TM7A 1S89A 4FE4A 4M22A 3WJ7A 3CZAA 3UA3A 1ZD2P 1O2DA 2ONZA 4IJUA 3DJFA 3ZX4A 5B58C 3IT0A 2FW1A 2IHZA 3E84A 2I67A 5CX4A 2X4LA 4D8XA 1Q5PA 1S2IA 2FU5C 1FPQA 3I6ZA 4NH4A 4PGMA 4A5OA 4BNNA 5JDIA 3I62A 2C9OA 1QH8A 5CA1F 3LUBA 1F6DA 1ZR2A 4P86A 3JY6A 5B3LA 5ICMA 5JJIA 4EGAA 1NMZA 3CUEF 1CJVC 1V43A 4PSCA 5DGTA 1TCCA 3GLQA 3KWFA 1PS0A 3IUNA 4OXIA 2OFFA 2P1RA 3WYCA 4AJPA 4MS4B 2PUFA 5JHHB 5A1JA 2ICAA 5CK5A 4ZZ3A 2B4TO 3KOYA 2ZRQA 4DRZA 3C5WP 3OTOB 4JEUA 4F4UA 2PX8A 3DEHA 4L6CA 2IUEA 4GMDA 4D6XA 1GG9A 2TECE 2I2BA 4J03A 1HLPA 1U9IC 1TMGE 4FXPA 4BKRA 4UTRA 2W2LD 4RADA 2FA9A 3T4PA 3LRTA 4LDRA 2QTLA 3ON5A 2WG1A 3QMWA 1EVYA 1RQ2A 2HTEA 4Q93A 4RVCA 2J0VA 3HNPA 3ICPA 3ZPXA 4BBZA 2QRJA 1G9TA 1LSOA 2W2TA 3D8HA 3QYPA 1LJ8A 4ZVQA 1Q1EA 2P4SA 3N7TA 5K2MA 3WGTA 3IOBA 4XYBA 1CUUA 4BKPA 1RP1A 4DMGA 4DWJA 5H80A 3GZ4A 4A0QA 2BLNA 1MBZA 4YRTA 3W2HA 4YCCA 3QH4A 1P5HA 1A8SA 3MJTA 3ZW7A 5JJLA 2J08A 3CVXA 3HADA 2O0JA 4V0OA 1IY2A 1U3VA 3ZZNA 5A2GA 2VRCD 3W7AA 2P4QA 1LXCA 5DTRA 1NP6A 2EC5A 3DBIA 3H6KA 1VKJA 4J6EA 3LXUX 2PFGA 2W2MA 2YICA 3VAZA 1EUDA 2QY9A 3DGFC 4PPQA 1DC4A 3W06A 2JHFA 2B4YA 3Q6IA 4G5RA 5HXAA 3X2FA 4JV5B 1K9SA 1NU6A 4LHXA 4NATA 1L5FA 2KLHA 3H8VA 3SC4A 1AXRA 4MRNA 5MF6A 2P2DA 4YRJA 3STUA 2JLXA 1FDVA 4O25A 2IKSA 1O5OA 3VYWA 4ZAYA 1KBZA 3D2LA 4ZPJA 1FP2A 3RYHB 5BO5A 4EPTA 3RC1A 4FKMA 1SOWA 3JWGA 1KERA 3PNYA 3A6FA 1H1DA 1SXIA 3HPQA 4LOHA 1Z7BA 5AKLA 4BASA 4UC0A 1T3SA 4JI6B 5HS4A 1ZD3A 4XWKA 1P5RA 2AI3A 1YGYA 2JFNA 2OXFA 2W6MA 4S3MA 4MCHA 4LUCA 2ZUBA 5J2TA 4QAQA 1NJ2A 1YRBA 3AJRA 4J16A 1ZA2A 1WCXA 2O3TA 2AFIA 3H13A 4P33A 3D2AA 4WAUA 1C8BA 1A98A 2HIAA 1Q92A 2YNMA 3ZH9B 4D9JA 3WNZA 4CCSA 3STVA 1NIPA 5L9AA 1KO7A 2P2ZA 3L1KA 3ZD9A 3AF4A 4UBKA 5J4VA 4HZGA 1WMAA 4LJYA 4G89A 1GGNA 3FUCA 2GZMA 2QQGA 4UM9B 1AZLA 1XD2B 2BFBB 2JCBA 1CJKC 5BSTA 5SICE 1QHNA 1RPZA 1K8XB 3PL5A 4IO0A 4ZYVA 3UGTA 3HN7A 4YJFB 1RXVA 3INNA 4KRGA 5DNEA 3C4VA 4KDCA 1E5DA 5FBWB 1EVJA 3ZBTA 5JTUA 2O57A 4TKZA 1SKYE 3DMTC 3ZVRA 4KI7A 3ZLTA 2QSJA 1M8JA 4LOAA 4ZQIA 1YFZA 4CMJA 2VWHA 1KZ7B 2ZRJA 3F1KA 5F2EA 1B8VA 4UAUA 5L7YA 3U7JA 2VHJA 1W29A 1RWKA 2VKTA 1YU6A 3IMFA 3B53X 3SDSA 1BDIA 4R1SA 4LPSA 1W96A 1ZONA 4UUQA 4XIYA 4D6PA 1NG9A 1XMXA 5LD2C 5DRYA 5LQJA 6NULA 1E1KA 3IERA 3SYMA 3O3OB 4JBGA 3WKAA 2W6OA 3X1ZA 5C37A 2Y2UA 3ZN2A 5HCUA 3WAJA 1MJFA 1VBNA 3U0BA 2X8JB 3QXJA 2NYRA 3EHEA 3M5CA 1NMSA 4HB2A 4UUMA 1N6OA 1USIA 3IDOA 5BSRA 3TQIA 3F3YA 3HCOA 1I2CA 4J7UA 4JENA 3VNQA 3GJQA 4AB1A 1I3CA 1LPMA 2MSLA 1R8YA 4RMNA 3TRFA 1T6XA 1X8LA 1TO2E 3AJ8A 4EJMA 4F4DA 2XOXA 3WJ1A 2CMGA 2EX0A 2NYUA 4E13A 1CFJA 1VYVA 1WZIA 2Q2VA 2DERA 3IEIA 2ZIAA 1RHKA 2NP7A 2H06A 4P4NA 1MZVA 3JWIA 4MS3A 3Q7TA 1NU8A 4NK5A 3TSYA 1C14A 3OPQA 4RJJA 5EUMA 2ZAOA 2Z83A 3ZS9A 3ZCRA 2JZCA 4OJMX 1JTVA 1L8XA 5A5FA 4RAOA 4W8HA 3CVOA 3ZHSA 4LI0A 3U4MA 2H1FA 4YAKA 2Q2QA 4KO4S 1QV9A 4O4IB 1NC1A 1Z22A 2MSCB 2NUTB 4LBVA 4PGGA 3WP0A 1NLMA 3Q2KA 4L07A 4KMRA 4RXUA 1WXWA 2VJPA 2GN1A 3W6NA 4XLZA 3GPDG 1H1TA 4PYNA 3RC8A 2D2VA 5DBGA 3TUJC 1QAQA 4XOIA 2R6ZA 4GLBA 4UCWA 1KEWA 1G18A 4YB8A 4TV8F 3B5IA 4ZAVA 5CD9A 1MOZA 3R5KA 3O83A 4TWIA 4B3XA 1T2AA 4QDXA 3S1SA 2A1UA 4MUGA 5DBEX 3W34A 2GBLC 2WVHA 5BMVF 3NM5A 2LCFA 5E2AA 2DKNA 2BOVA 3GJZA 2B4KA 3FKQA 3HCCA 4J4BA 3BWCA 5ULLA 4RK1A 1H4VB 1ISRA 3PQ8A 1AGNA 3SYLA 1SQGA 2XB4A 3AHJA 4OGGA 1EGQA 3P8ZA 4N18A 4RY0A 5I7VA 5CCEA 3ZJUA 5F4BA 4MDEA 3JQ8B 3MERA 3DEZA 4QEZA 5HF9A 2EFGA 3QKIA 1KVUA 4BAGA 1DG1G 2GEBA 4ACAA 3A1WA 1X1CA 3GRKA 3LCRA 5E4JA 3EZXA 2HYIC 2HAEA 3DGEC 3EF3A 3I9LA 4M38A 1W87A 2DMRA 4G0OA 3IPAA 4FI3C 4LS3A 4LSWA 4F7WA 3Q7RA 2MOKA 4A2CA 3OOJA 2QTAA 1CY7A 5KOHB 1MJHA 1AKEA 1XL1A 1C7FA 3DMRA 1U3CA 4Q3DA 4B46A 1Z29A 1E2UA 1OXTA 5A7FA 3H0KA 1XX6A 1WBJB 5IYZB 1QS0B 2IPXA 3NX4A 2HK7A 2UZ1A 1VE9A 4C2UA 2HMTA 5FOUA 4TMKA 1CS0B 4AF7A 1S9DA 4BFYA 3NUZA 3U31A 3VOAA 1TK2A 4OQDA 3P26A 3GJTA 3VI3B 4YPOA 5K8VA 3BMCB 3MSCA 5EMHA 1HTBA 4F45A 3FB4A 3ABZA 1E9EA 1XRPA 5DM2A 4QXPA 5IDYA 1W4BA 4NTZA 5TC4A 3MT0A 3D0KA 1UZMA 3KO8A 2AEEA 4KFRA 4C2TA 1Q15A 1TZCA 2XBUA 3GJYA 4WDQA 3TGWA 2GAIA 1MNQA 1NNSA 1DJNA 2QUIA 3HCEA 3V8RA 1I7DA 2XUPA 3VJLA 1NLZA 1U0JA 2NT4A 2GXQA 3A14A 4FYXA 4CMGA 5ITVA 1WU8A 2NXWA 4RVGA 3UQZA 2ODEA 1AJEA 2IOFK 4M0LA 4PLGA 2WM8A 4HAWA 2IF0A 2WTMA 5AM2A 5E6SA 2BI8A 1QO0D 2OGUA 4D99A 5BORA 1GL3A 4RD3A 3SWWA 1II8B 4L8YA 1EXNA 3MINB 4ARZB 3GVXA 4YRCA 2CFRA 1KMHB 1FMTA 4J0GA 3W8RA 1GPJA 521PA 5E1BA 4DE5A 4LJRA 3CO5A 1RZRA 1VCMA 2V59A 4TROA 4FN5A 1JU4A 1NW4A 4RMJA 2J3KA 4IOMA 5K0ZA 2HCJB 1E3IA 2ON6A 3TD6A 2FEAA 2XR1A 4DILA 1BX3A 2D74A 3K1YA 4R9NA 4TTQA 3U3MA 2VPIA 2YMPA 3V1YA 3ER9A 3UMCA 4RTPA 3LDUA 2OORA 1A9ZA 1CUCA 3R2JA 3S2UA 1DKPA 2I3ZA 2OCXA 2RGNA 3AFNA 5BT8A 2C5GA 5JRDS 2TMDA 2AF4C 1JECA 1KYYA 1YVUA 1CUDA 4U4AA 3PQ7A 4IDHA 4XCVA 2OCLA 5CUQA 4BO1A 1JYFA 3JAKB 1J09A 3BRQA 4GUDA 4LV8B 3TPCA 4HRYA 3CXUA 1ILEA 1SRQA 1YVEI 4KUEA 1N5DA 4BC0A 4C9BA 4CL8A 4ZJYA 4KX5A 3B13B 4JGGA 3C5CA 4RKRA 2GETA 2ZYIA 3JYPA 1KBOA 4QPCA 1CUSA 2OC9A 4BBPA 3IEUA 2JK0A 2FUG6 3GDWA 3Q7PA 5CM2Z 1Y7PA 4GBMA 3SVTA 1T2EA 3GUYA 4LYEA 2ZT6A 4W8OA 3RIGA 2JASA 1YRQA 4YMSA 3TLGB 1U3WA 1DWOA 2D1RA 2OB2A 4OBEA 1U6IA 3WWPA 1D2GA 1QB8A 1WUHS 3WLJA 3ZC3A 2GM3A 1S3GA 2NO4A 2F8LA 2RAUA 2PBLA 2H54A 4LZLA 5LQRA 3BKWA 3UPUA 1XMQB 1EVIA 1K6IA 2R8EA 3MRXA 4PLZA 3T5CA 1YTUA 3E8SA 2FVYA 3M6IA 2YJ3A 4OBXA 1JJAA 4KMOA 1KC3A 5IJ9B 4WY8A 3DL2A 2BGMA 1SJ9A 4A82A 3F9IA 3O8QB 1L5KA 1PN3A 4L1KA 5LKAA 3OFSA 3RU2A 4C1NA 3KJNA 1K8YB 3RYFA 5JZSA 2VWQA 3ANMA 1YZ3A 3ND5A 4YAUA 2DHEA 2VTBB 4A2QA 3K4PA 2ZYRA 4HVTA 5ANRB 4YMVA 4C0LA 1PJZA 4GZ5A 2C8VA 2EL7A 3S7ZA 3UK2A 2VJLA 4FSDA 7YASA 1PEYA 1I4EB 2EBFX 1JHVA 1U7OA 1ADFA 2KSQA 1W5TA 3RH0A 4FZ3A 4NLLA 2ST1A 2A2ZA 5F1KA 1O03A 4HDRA 4ZI7F 1OPXA 3EULA 4OP2A 1KJZA 2GX6A 2YY5A 3IJEB 2D0DA 2PTHA 2XE4A 2XMGA 1P8JA 2I6SA 3IHLA 1KK3A 3QPUA 3UUWA 3UBTA 1KR5A 1YUMA 1SCJA 1U04A 2RB4A 2MSNA 2O7SA 2AXQA 3ORSA 3VDMA 4CHTA 3AP2A 4XW2A 1WDMA 1WDLA 1VCOA 3BVPA 5KSYA 4HP8A 4MUKA 5CX1B 3S6JA 1V3VA 4KXMA 3VX3A 1IXRC 2DLNA 4QGHA 5I9SA 5ETJA 2KI5A 4MZDA 4ETIA 3SQOA 1VCNA 4AK9A 1FFAA 3OE7D 1MENA 3I9OA 5G0VA 3STHA 1RE0A 3SKXA 3D81A 1DINA 2ERCA 1W52X 3D7KA 4DSTA 1HE4A 3O84A 4QTZA 3U7GA 3EOBI 1NM5C 3GVHA 5CVEA 4BBJA 1KOFA 1Y7HA 1P77A 3MQ2A 5DCYA 3ZD8A 3OPYI 1EBBA 4UOZA 2OGWA 1TU3A 2E3JA 4OU4A 3WGIA 2IHNA 3AWIA 4LYJA 2LR0A 1M34E 2VHUA 4V0QA 3R8CA 3U9LA 1DTEA 5AI8A 3EOZA 2XNSA 3B8EA 1JJVA 1GY8A 1I80A 1TT5A 2IYVA 4UBNA 3M3DA 1NOKA 1HF3A 1C0LA 1T25A 1LC3A 3BDVA 4PE5B 1ZOSA 3AYXB 3B3FA 3DR5A 4RK5A 3WV5A 1JE0A 5FI3A 4BLWA 1RQNA 1LF0A 3KSAC 3L01A 4MS1A 2R1TA 1IAQA 1M0SA 1FF9A 4NS1A 4AP9A 1K3UB 1B15A 1MN6A 3K4QA 2JJMA 2YWBA 3R5XA 2GCGA 3UT0A 4WXRA 1Z4OA 3JQGA 5JV5A 1G3MA 1T9GS 1XEXB 1UADA 2F43A 1ONBA 2HEGA 1C7IA 2E9SA 4O2AB 3UT5B 5DTQA 4DLTA 3U6KA 4A10A 3MJFA 2GBGA 1L8LA 3M6XA 4Q47A 3NBZC 1WNFA 3C3YA 1L5GB 1J06A 4DLWA 3DBRB 1M67A 2AFHE 4TMWA 3A9VA 3R7WA 2ZB8A 3C3AA 4R9VA 4GYJA 1U8AA 4NZZA 3FTPA 1R16A 5KAPA 1C7QA 2HFKA 3BQMB 2IBTA 1I2AA 2SKDA 2FWJA 3EY4A 4KXWA 5DDIP 3LVQE 5CP8A 5FL7A 3RUAA 4ZGGA 3WDKA 2REQA 4XUEA 1G7TA 3A0RB 4WHMA 4K6CA 3O38A 3AUAA 2RGGA 3O95A 1J5EB 1HE2A 3QFSA 1FTQA 3QU9A 4CMBA 3NW9A 4XEUA 4BWVA 2JAUA 2WRZA 2YXDA 3TFQA 3KSUA 5JS7A 3HBNA 4F9GA 3HZOA 1ST2A 5K7SA 2RHBA 3CIFA 3W2GA 1NV9A 2Q3EA 4YREA 1HGXA 1RQXA 3B1VA 1D2HA 1HM5A 1FP1D 3EZNA 4C04A 4YP5A 1MT0A 2BN4A 3IJPA 1PX0A 5TIIA 2X86A 3LVFO 4DLKA 4UXHA 2RK6A 3AVVA 4MHSA 1I7SB 3NTRA 3L0ZA 2WT9A 4QRIA 5TB5A 1Q95A 4QPZA 4BZXA 4KLCA 3HABA 3JRWA 3THSA 3S55A 4EEXA 2FMIA 1ZNWA 5K03A 1L7DA 3ODPA 4GH5A 5KSPA 2SECE 4FQ5A 2DUNA 3JQ9A 2BTOA 2BSXA 1JIVA 1QCZA 4TV9B 3VXKA 3NAMA 4FONA 4LISA 2C94A 1U9JA 2YV1A 2EP5A 2QRVB 2WYHA 4EHBA 3HCDA 2W8ZA 1RJGA 3PEEA 3WZLA 4ZHQB 4XQ9A 3SBXA 2AC2A 1EFPB 4KXQA 2IEYA 3A2NA 5EPUA 2XUHA 1Q21A 4B87A 3G0HA 2QD2A 1ZVKA 2R6GA 2WQZA 1NXWA 1SOVA 4PW0A 3NNSA 2YQ4A 2D5LA 2QPTA 3SLGA 1OIWA 1H0SA 3T6KA 3BG5A 4MS4A 1AUQA 3RHFA 2A30A 2PS0A 4FLFA 5E1MA 1IAVA 3A26A 3IVMA 1U3TA 3DKIA 5J5AA 1LJLA 2ZYUX 3QLVA 5CCBA 2A84A 4HGRA 4YMWA 4CL0A 1KZHA 3W04A 1M2WA 1WVIA 1X7GA 2GHRA 3LC0A 4GKAA 3OM0A 1N6RA 4LVUA 1LDYA 2F6RA 3LYHA 2K2WA 2PKEA 3GB9A 1JHXA 3L04A 4GI7A 4CKWB 3SZMA 5CVTA 3LT5A 3UGQA 1HEYA 3DTTA 1OI3A 5C80A 4DA4A 2IKQA 2J9ZB 3C7CB 4HQ6A 1URPA 2NTNA 4TTAA 5KYNA 5DM60 2J3HA 5HIMA 1J1IA 3KK0A 1J9ZA 4UFPA 3SJUA 4UE6A 1J07A 1DADA 1Q1BA 3C8UA 1O3YA 4MJ3A 2YV2A 5TF0A 2ZVPX 3CPJB 4KRYA 4AJIA 2R00C 2FFRA 2VDQB 2WVAA 4KQXA 1ZH8A 1XTPA 3W0LB 1I3KA 1W581 1T5BA 2Q46A 2AHOA 4MGHA 3D8BA 4AN4A 1X0VA 3IMKA 4KXYA 3ZCUA 2AZXA 1H85A 4BFLA 3W2TA 3I4LA 1CF4A 4ZRDA 2II6A 1G16A 4MQLA 2FR8A 3W7VA 2XY4A 1G38A 5JYDA 3K32A 4H16A 1LRLA 4I1OA 2IXTA 1EWVA 2A58A 2HQSA 5AJTA 2C95A 4ZVLA 4H1WA 1FUKA 3GRAA 4LJAA 1KMIY 4AXXA 3SK0A 5HQ3B 4GKKB 2GJSA 4HRAA 5K4GA 3O03A 4Y2TA 1B42A 4TS4A 4CEJB 5FDFA 2VAMA 1J97A 1SXHA 1SCDA 3TQSA 3TL6A 3A1UA 3ESXA 2XT6A 5T64A 3SXJA 1H1LB 5IJ0A 3H3JA 2ATIA 1B14A 4BCBA 5KWSA 2PQMA 1U1EA 3OF2A 4KU4A 1IZYA 2PZFA 2OCYC 3PXEA 4M1SA 1EP1B 4RANA 1RXEA 4B3RB 1BWSA 2OM2A 4Z3OA 1KZ1A 1YZFA 2OM6A 5BWMA 2J09A 1GTVA 3G02A 2CCKA 2CLDX 4I4NA 4IHKA 4NBRA 2PT7A 4CEIB 2FUNB 1C1XB 1W34A 4QARA 1XD2A 3WO1A 5HUHA 5JS6A 2BFBA 2RGEA 1U8UA 1L5OA 5DW0A 2A3NA 2HIMA 4F72A 4DQDA 3PBKA 5JH7B 1TQ2A 5JSQA 1QV6A 2WOJA 3LV8A 4YJFA 5LP6C 3WJ2A 1JEAA 3ORHA 2DBQA 4A6DA 2O06A 1P7ZA 1XMJA 2D1FA 3DVQX 1YBFA 3E1GA 3PD7A 4FDMA 1JALA 4KWIA 3RVLA 3ST7A 4CE6A 2I91A 3DPIA 4KR3A 1CDEA 1KORA 2QGFA 4JQZA 2O3QA 4PLFA 1NXQA 4AKHA 4L28A 3A9TA 2YHSA 3GO4A 3QYAA 1JBEA 1W1WA 3ZHZA 3B3JA 3OM8A 1TE2A 4JB8A 3RFFA 3BFKA 2JFBA 3PX3A 4YJ3B 2JANA 3VUFA 3IYLW 1B41A 3E81A 3FWPA 1FTWA 3KTOA 3VAAA 5DNYB 2C7PA 3DLHA 2D5AA 4JJFA 3HWWA 3EIUA 5TNXA 3BXFA 3NAZA 4WSOA 1NVGA 1GPMA 1RWBA 5CFMA 4M76B 5A0TA 1ESDA 3NHMA 1QANA 2FI1A 4HMPA 1W0KA 4QBGB 3SQLA 4P8RA 4D9MA 2XQGA 2JIZA 5J47A 1BKDR 2QVLA 4G5GA 2QE7A 4G4GA 5FUMA 2PFKA 2UUCB 1THTA 2VJDA 2V1XA 4G8CA 2HEIA 3E27A 4ENVA 4D8UA 4HHEA 4ZMSA 4TSFD 4F3TA 1DIBA 4UTOA 2XVAA 2JFWA 3Q0TA 4Z9XA 3EHDA 4MUNA 4DRYA 1DEHA 5D3ZA 1NF2A 2V7EA 3QLUA 4I55B 2QLBA 3SMVA 2JJYA 2ZBGA 3L8ZA 3MN1A 4HLUA 1Y82A 4C05A 1BXKA 2N1BA 2P3LA 3LVBA 4TS9A 1HDZA 5TGTA 2NPOA 3DZ8A 3BWBA 3GVPA 2JRLA 4RZ3A 4IDPA 2M6SA 1D2AA 1GTMA 3GCWA 2CLHB 1KEKA 4ARCA 1J99A 3D6NB 2PD6A 4XAQA 1VGRA 1TC1A 5C5DA 2OP0A 3NWOA 4LYAA 2R5FA 3LYUA 4AO7A 4LDZA 2F1HA 2XEDA 3WR5A 1L7OA 4C5AA 1XWWA 1E3TA 1ZVJA 2PIDA 4O4IA 1VOTA 2AOXA 2FW8A 3F6EX 3HVHA 3KOOA 3GJSA 4MQFB 4PX9A 1IJKA 2B36A 4Q9AA 1Y8CA 4R2WA 1ZJZA 5CFZA 2I03A 2QRZA 4BMNA 3V48A 5GV8A 3CUWA 3ZQ4A 4JU9A 3N1UA 4CU5A 4EF4A 3V8EA 5I6DA 1B26A 5A3VA 3EIHA 2B9EA 3A1EA 1VG9B 3KKPA 4B3TB 3ESYA 1KEZA 1LLDA 2QPAA 5C8VA 4TMXA 3RF7A 2CW5A 2A9JA 2Q1XA 1MZPA 4RC9A 3G0OA 2PH7A 2ZSBA 4P35A 3ZV5A 3HUTA 3NBXX 1IY9A 3EE6A 3P32A 3T61A 1Q84A 1A1VA 1I3NA 4AUMA 5D3MA 2CY0A 3JQ8A 1MEJA 5EHIA 3JQPA 1UC4B 1KI1A 2HO5A 3M9XA 2FPRA 3P2EA 5LNK6 1KZGB 1JDUA 3QTTA 4KQIA 1A7KA 2FJ0A 1UCFA 2WJWA 1JPJA 2GK7A 2YJ6A 1KGDA 3ECSA 3NPMA 5DHSA 5C5IA 3NWJA 3MG9A 4LYYA 1EXVA 5HP4A 5E1DA 1IZZA 3E5MA 2JEZA 2G9RA 1O7JA 2QM8A 4TYNA 5KREA 4RDHA 1OLSB 5IEJA 1IN7A 2AD1A 4Y2JA 2C4UA 3KDSE 1RCTE 3KSMA 4V1CI 5IYZA 2RK4A 1KNQA 1QS0A 1QQ7A 4NKRA 5KWIA 1Q0TA 4HEA6 3ZHTA 1T6ZA 3JXEA 4E5VA 1SUIA 2BH9A 2WVJA 4L8WB 2R97A 1JLKA 1CS0A 2ZI5A 4D4MA 4NG5A 3DCJA 3DXFA 5AKXA 2YC4C 4FDUA 3O31A 3DB1A 4ODIA 4OREX 2GBIA 1L5SA 2DZDA 2VJOA 3DZGA 5T57A 1V8FA 1IOVA 1E4OA 1Y3HA 3BMCA 3GGJA 2G08A 1QSGA 3IP6A 1ZCZA 1CF9A 2CNDA 3AI3A 3K2EA 3VPHA 4RZQA 4JI4B 1PV1A 2O2SA 2PPLA 5C8YB 4AO8A 2D0PB 2OFOA 2G71A 4BMDA 2Z1NA 5JJ5A 3W4KA 4CF3A 4GI5A 3GGOA 4B09A 4MYHA 3EZLA 3H1PA 4Q4DA 2GYYA 1X3SA 3GLHB 4LVOA 4M8NE 1F8GA 2E6KA 3CW9A 3SJ7A 4YMHA 4QTYA 2CCGA 1VKNA 5HQTA 3ECAA 5FWAA 3V1UA 1QHHB 3EGXB 1WMFA 1HDCA 3EQ7A 3IQZA 1Y3IA 3OEHA 4JYCA 4L8FA 4OMCA 4U6SA 5AVTA 1II8A 2IX3A 2IY7A 3ILYA 5IT0A 4XX0B 3MINA 4ARZA 1TZ2A 1MOPA 3BXGA 3FSGD 5HBGA 5KVQA 1KMHA 1CUWA 3FJ1A 4D3XA 3CW2A 2J4DA 5JBIA 3C85A 4DY6A 2BFWA 1O5IA 1LF5A 1K7EB 2P30A 3MS4A 1CX9B 2Z30A 4EMBA 1R6UA 4JXJA 1W93A 4MDYA 2NVUB 2VT2A 2WE8A 3PNMA 3TE7A 1JU3A 3QU2A 5A3QA 3AFHA 4QUJA 3CRMA 3P0FA 5JD6A 1QNFA 1JQDA 3EQ2A 2DR0A 3MVEA 2HDWA 2GN2A 3IUYA 1Z63A 3VAYA 2QJTA 3OFJA 1NKVA 3WI7A 5IHPA 1J7KA 3F4BA 3JQAD 3NALA 3WRVA 5BXYA 2NPFA 4J2TA 4Y6OA 3C3PA 4OH7A 4DJDC 3BCUA 3JQBC 5BWOA 1RXSA 3D8NA 3JAKA 4HBGA 5DEIA 3VJMA 3H1TA 3D5QA 4JOSA 1T5HX 2QZZA 3DMHA 1CQJB 4DR3B 1C7RA 3MF4A 1DHTA 3UZUA 3BXXA 3OSZA 4GOOD 2Z2IA 3DM9B 2J0EA 5DXAA 4AJ1A 3SXPA 1T34A 4W7IA 4JI0B 3ZU6A 5IF3A 4CM4B 2BMAA 5K0LA 4IKOA 8ABPA 3TLGA 3E9YA 4AJ9A 4O3MA 1O1YA 2NSLA 4XUDA 1L4NA 5ELXA 4UBOA 3KOXA 4YROA 1CUJA 3HEAA 2ECPA 1LS1A 3NHPA 3QUQA 2J6BA 2QYHA 3G68A 4JBXA 4RS3A 5JJCA 3A1FA 4BLRA 2AYZA 2GYWA 3KJXA 3OQJA 2G67A 1QRTA 4RK7A 1OTXA 1GCAA 1ZCAA 3WYEA 3G1TA 5IJ9A 5IWCA 5KCZA 5IJWA 2XKAA 3UC5A 2PN1A 1T9DA 1DMRA 1M76A 1MO2A 3O8QA 1XT6A 1OAAA 4B2IA 1MCZA 2J3JA 3BXEA 4FC6A 4W1PA 5IT9A 3UW3A 2PUCA 4M86A 2PJDA 2PZJA 1CETA 4Y6LA 4BNUA 2YHIB 4ND8B 3PUKA 4MO9A 2VTBA 4MEBA 1JT9A 4FHEA 1GGEA 1S3IA 1VFNA 1WV1A 4NBVA 5E38A 4MVWA 3UV7A 2A5DA 1P18A 1PDVA 1U0OC 3GZJA 2FN9A 3ISVA 3TQHA 4DIEA 3TXXA 3L1HA 1EZZA 1NI3A 4DLBA 3KELA 4OTZA 4N6GA 3WLTA 3DOFA 1YIAA 2YH2A 3G8BA 3GELA 4RK4A 2XBLA 1GG5A 3OM1A 5EYPA 2P4EA 1GLVA 5AVXA 1IBSA 2R8RA 1YL5A 4OK5A 2JLAA 2P2NA 2J30A 1CNEA 2QRQA 3OH8A 1Z2CA 4ZT5A 2PBFA 2DWPA 4O8ZA 3ENKA 5JYCA 3NHAA 4Z5XA 3DULA 4GI3A 4PZZA 3VR5D 1P9OA 1YZHA 1KEVA 3BHNA 5CX1A 5HRAA 4BO4A 3I34X 1U5CA 5F3WB 1Z2EA 1R6VA 3BB3A 3OESA 4ER5A 5CH8A 3D4IA 3JAMA 4J43A 4M99A 1ND5A 1LK7A 3D7NA 4CQMD 1C9EA 5FQOA 3ITNA 2VDWA 1BEZA 4BWFB 5KQGA 3K4HA 2G0NA 1QP7A 1VHLA 1CG6A 1GAEO 1RVDA 3NBFA 1HO3A 4NOMA 1Y8ZA 5BOSB 2VPPA 5EHZA 4K28A 5JCPA 1YCHA 1WLYA 2BGTA 5TRTA 1D09A 4JNCA 4TL7A 5JMTA 1FJ2A 1G8PA 5DTMA 1RKUA 1JQBA 2Z3VA 1CJMA 2CFCA 2Z3ZA 1FTNA 4EYOA 4FYVA 5HEKA 4H6WA 1KI2A 3BWMA 4FP9A 4PU0A 4EPRA 2O7NA 3K31A 1PR1A 3MAJA 1QPGA 4DCUA 2B99A 2O0KA 1PUXA 2IV7A 2P65A 4BEBA 1US8B 3NHJA 1I1HA 1EDBA 4GPAA 4A4DA 2VPYA 1X8JA 1YQQA 1SCNE 2EYUA 1X15A 2RCYA 3T7SA 2EEZA 3NBQA 4M7OA 5C4MA 5JATA 2JD0A 3SYKA 1JIKA 1ZK4A 4R7GA 1D2EA 3DOJA 4XVQA 1TD1A 1JSRA 1TA9A 4NONA 4AS1A 1A7UA 5BRNA 1SO8A 4CLDA 5JWOA 5B7NA 1XEXA 3KFVA 2ETVA 4GPEA 3UXHA 1J24A 1DKRA 2QTMA 3BM5A 3IAEA 1BU5A 4MP3A 4ND5A 4O2AA 4WNAA 3UT5A 5TS2A 1RWMA 1ZK2A 4ECAA 1D6JA 4DQ0A 2WUVA 2HA3A 4NNJA 4AYWA 1QG6A 1NBOA 5D8DA 3MOGA 4LHZA 3PUVA 3P4UA 1F38A 1LPPA 3DBRA 2WU1A 3BA1A 3SC3A 5E7IA 3LT2A 4TYPA 2AEJA 2FP4B 1KJ8A 3DFFA 1DQZA 1ICIA 1RJWA 4PAMA 2IHUA 4R0NA 4BNXA 1SIOA 2I3BA 4NX2A 2UUOA 4JVNA 4X6UA 4XWTA 5K3FB 1QBGA 2INGX 3LO8A 4FB5A 1F9AA 5I7FA 1UEIA 2Y1CA 4CR8A 1KI7A 2O8FB 1QTQA 1DV1A 1ECLA 4PRLA 3L0OA 1L4BA 2ZUFA 3T5AA 2OOSA 3ZK8A 4I99A 2O2HA 2RONA 3C4JA 4BKOA 2QAIA 2DHCA 4QLBA 4YASA 2R8XA 2PLWA 5LQUA 2O2IA 3QVVA 4EUKA 2P2YA 2QXYA 1IL0A 2OBLA 4YRQA 4QM7A 4CEHB 3REQB 2F48A 2FCRA 1JZTA 4N0EA 5BWLA 4MB2A 3F6PA 1XZHA 1E63A 2IODA 2ZEJA 3BZWA 4LJKA 4C2AA 2DETA 3N28A 1YZNA 1L4HA 1DQPA 1KP9A 3I37X 2DQYA 4LZAA 5A04A 5HIKA 3T1OA 2R1UA 4D9IA 1BDBA 1Y5IA 4UDNA 1NQVA 5AJZA 3EZGA 4L9WA 3LOUA 4EI8A 4EFDA 4QU9A 4C08A 3TBHA 3OF5A 3JQDA 4TV9A 3DKVA 5KNLA 4DMUB 1Z4NA 3AHFA 1OUMA 1OXXK 2QRVA 1VE6A 4C89A 4ZHQA 3QBJA 1D2NA 1U0NA 2GBFA 3FHTA 1EFPA 1KAGA 1M74A 2X5XA 3DDSA 5A4DA 1OASA 4GC5A 2WIDA 3EY9A 1Z2AA 3C5HA 2AJCA 1IBLB 4TOIA 1CUIA 2BUBA 2X19A 2PGNA 1MB0A 2PCLA 2QN8A 3LYLA 3TSZA 1KQFA 3HSYA 1ZD5A 3DV0B 3R0ZA 4Y2VA 4XVRA 5EE0A 4DLZA 5JANA 2GD0A