2I33A

The structure of the class c acid phosphatase from bacillus anthracis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
238
structure length
238
Chain Sequence
VKLTDQQLMADLWYQTAGEMKALYYQGYNTGQLKLDAALAKGTEKKPAIVLDLDETVLDNSPHQAMSVKTGKGYPYKWDDWINKAEAEALPGSIDFLKYTESKGVDIYYISNRKTNQLDATIKNLERVGAPQATKEHILLQDPKEKGKEKRRELVSQTHDIVLFFGDNLSDFTGFDGKSVKDRNQAVTDSKAQFGEKFIIFPNPMYGDWEGALYDYNFKKSDAEKDKIRHDNLKSFDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid phosphatase
publication title The crystal structure of the Class C acid phosphatase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 94
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2006-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i33A00
2B30A 3FVVA 3L8EA 5ALLA 5IT4A 1LVHA 3QUBA 5AKGA 2R8ZA 3U19A 3E81A 2ODAA 1ZD4A 2G06A 5AVSA 5AIAA 2G08A 3QYPA 2JARA 3ZWDA 1NNLA 2EAUA 2DQSA 2I6XA 2AUTA 3R09A 3FPBA 3AR9A 2VKQA 3W5AA 1U2SA 3DDHA 4EEKA 4HGOA 4CF3A 3IB6A 2HSZA 3U7EB 1RQLA 2G1AA 2I34A 4UAVA 5AM0A 5AM2A 1ZS9A 3ZX4A 3NIWA 5ALPA 4YGYA 3K1ZA 1WZCA 3OCXA 1JUDA 3QU4A 3QU9A 3I1YA 3A1CA 1Z4JA 2QLTA 3ZWKA 4J2TA 5AESA 2HDOA 2B0CA 5ALNA 2EARA 2P69A 3MMZA 4C4TA 1YNSA 2RB5A 5AVRA 1Z5GA 3SKYA 1RLTA 4DFDA 1RKVA 3WK9A 3E8MA 3AR5A 5ALSA 3QGMA 1Z4LA 3L0CA 2D2VA 2IOHA 3U7HB 3CZ4A 3MC1A 4EX6A 5AI8A 1L7MA 2GO7A 3ED5A 5ALIA 2Q5EA 2JAWA 2RBKA 2X4DA 4YH1A 3GYGA 1RKQA 3OCZA 2R8XA 3KBBA 3MN1A 3QNMA 3N5KA 3U26A 3QU2A 1QQ5A 3L1VA 5AKXA 2BDUA 1SWVA 1TJ3A 3L1UA 2YMQA 3OPXA 1Z4IA 4UW9A 3AR6A 5AKKA 4KNVA 4YIHA 1RPZA 1NF2A 2I55A 3WKDA 1RLOA 2C88A 3P96A 5AM4A 5AW9A 5AKYA 4UM5A 5AW8A 5AI6A 1YJ5A 4XQ0A 1Z4KA 3QX7A 3ZUPA 5AVVA 3TLMA 3SF0A 5AVQA 2CFRA 3ZTYA 5AVUA 1TA0A 3L8HA 4BKMA 1T5TA 4RESA 3WK4A 2FUEA 3QLEA 3U7GA 5E0OA 3E84A 3ZU6A 2NO4A 3M1YA 4E88A 4O8CA 4XPZA 1ZD5A 2C9MA 4KX3A 4F71A 2IOFK 2PR7A 4CNQA 5AW7A 3WK8A 4UU0A 4Y2PA 3WKEA 1VJRA 3NASA 3WK7A 3QXGA 3VAYA 1SU4A 3J7TA 3AR7A 5ALHA 5AIBA 3EWIA 2B8JA 2OBBA 4OCZA 1T9ZA 3S6JA 1S8OA 4AS3A 4BYGA 5AVXA 2G80A 1AQ6A 3UM9A 2HOQA 2R8YA 4BBJA 3WKBA 4HGQA 1ZD2P 5ALDA 2FDRA 2JAOA 4FYPA 2W4MA 4F72A 3FGOA 1J8DA 1L8LA 3A1DA 3NAMA 3HLTA 2ZBEA 2NO5A 2IA5A 3W5CA 4YCLA 4Y2YA 5AW1A 4J03A 3KOOA 3ZI4A 4BNDA 1XPJA 5AVYA 3ESQA 5ALJA 2WF6A 5AW3A 1FEZA 1WPGA 3I76A 2WF8A 3QUQA 4UM7A 2IYEA 4Y2UA 3SLRA 3WGVA 5AKIA 2MSNA 5A3QA 3ZTWA 1RLMA 5AI0A 4FFDA 5AKZA 1Z4PX 3UMCA 3WKAA 2GHQA 1RC8A 1ZRMA 4NWIA 3N8GA 5AKLA 1U7PA 1RRCA 3KDPA 4KX5A 4NV0A 4UMDA 2YBDA 1RMTA 3U13A 4OFZA 3KC2A 4UARA 3NANA 5AVWA 2WHEA 5AK6A 2YMPA 3NUQA 5ALZA 5AW2A 1T5SA 3RF6A 3FM9A 2OA0A 4Y2SA 3KZXA 1EK2A 1U2TA 2C8KA 1Q92A 5AKJA 4BX0A 1XP5A 3F9RA 1ZJJA 2C8LA 2JAUA 4EENA 3B9RA 4ZEXA 1K1EA 4XOUA 1U02A 4Y2TA 5ALGA 4MWOA 2AH5A 2GMWA 4BX2A 1Z4QA 3L5KA 4BEWA 1L7PA 2YY6A 4NFLA 3L7YA 3CNHA 3ONNA 5AHXA 2HHLA 5AK3A 3ZVLA 1MH9A 1QYIA 1RDFA 5AK4A 3I6BA 1PW5A 4C4SA 2O2XA 2YFYA 4NAVA 3UMGA 1YS9A 2I33A 1Z4OA 1L7NA 4YCMA 4EELA 2FPUA 2FEAA 3DNPA 2AMYA 5AM5A 2YMLA 4B6JA 5ALFA 3EF1A 2CN1A 2QYHA 3W5DA 2CFSA 2WF5A 5ALYA 4H1WA 2YJ4A 3BWVA 1S2OA 3BA6A 3IRUA 1X42A 1L6RA 5JJBA 4GXTA 2AGVA 5FP0A 2HF7A 3QUCA 4KYTA 1QQ7A 4L6CA 2ZBFA 5AKEA 3EPRA 1O03A 2FUCA 4JB3A 5AVZA 2OM6A 1NRWA 1XVIA 3WK5A 2I7DA 3FPSA 5A3RA 3ZW7A 2HEGA 2EATA 5IS2A 2FPXA 5AVTA 1Z4NA 4KNWA 2B1RA 1L8OA 1KYTA 3SMVA 4Y2JA 4NABA 4Y2QA 3M9LA 4UAUA 2OYCA 5AW0A 4C4RA 3N1UA 4G63A 1J97A 3A3YA 5AM1A 5AI5A 1Z88A 3SD7A 2B1QA 2G0AA 5ALOA 1EK1A 5ALKA 4EX7A 1WR8A 2W11A 3AR2A 4Y2RA 2CFTA 4HAIA 4HGPA 4CE6A 3PCTA 3L8FA 3MPOA 5AW5A 4CF4A 1LTQA 2FI1A 4IG4A 4I9GA 4HYTA 1Z4MA 4CF5A 1VFPA 2P27A 5AICA 4DW8A 1QQ6A 2BDEA 5ALRA 1F5SA 2YJ6A 5AI4A 3FZQA 4DWOA 4UU1A 3PGVA 2ZG6A 2WFAA 3UMBA 1O08A 4MUMA 2P11A 2ZOSA 2R8EA 4L57A 2ZBGA 3ET5A 5ALWA 3AR3A 1TE2A 3A1EA 4KN8A 2G07A 4UMEA 2HO4A 4L6AA 2ZXEA 3U7FB 3PDWA 3NRJA 2W43A 3IJ5A 4OHFA 2WF9A 4AP9A 2HCFA 3B9BA 4BX3A 4YCNA 2FPSA 3WKCA 3AR8A 3R4CA 2YJ3A 5AK5A 2B82A 2HX1A 5IT0A 2I54A 5ALTA 5AW6A 2PKEA 4ZEWA 1RMYA 3N07A 4BEVA 4HGRA 4BNDB 4UMFA 5AI9A 5ALQA 5ALEA 3L0YA 1Y8AA 2YN4A 1QH9A 3DV9A 1VJ5A 3N28A 2Q4RA 3DAOA 1ZD3A 1YV9A 3ET4A 5ALUA 2O9JA 4DCCA 4GIBA 2ZBDA 3PGLA 4AS2A 2IOFA 2YJ5A 4IFTA 2FPRA 3D6JA 3ESRA 3OCWA 3OCYA 4QJBA 2HI0A 3OCVA 1L7OA 1ZOLA 1WVIA 4FE3A 3R9KA 5AKHA 3WK6A 1RKUA 3W5BA 3ZVMA 1CQZA 3E58A 1TJ4A 1RQNA 4OD0A 3EF0A 3SHQA 3KD3A 2G09A 2MU1A 4Y3UA 1TJ5A 3RFUA 2WF7A 4Y2XA 3SKXA 4ZEVA 2WM8A 2B8EA 1U7OA 3ZX5A 5A3SA 4RETA 1ZRNA 2JGAA 3B8EA 2HF2A 1Q91A 3NALA 2FPWA 4QQFA 4EZEA 3QUTA 3QU7A 1YDFA 1CR6A 3L0BA 4XE5A 3WGUA 5ALXA 1IWOA 3AR4A 4UASA 5AM3A 2P9JA 2GHTA 4G9BA 1SWWA 4I9FA 5ALVA 2C4NA 2BY4A 1Z5UA 4UMVA 3ZVNA 1RMQA 2RARA 5ALMA 1N8NA 1N9KA 3I28A 2Q4TA 3L8GA 2PQ0A 5AW4A 3QU5A 1YMQA 3OTQA 4PNHA 4Y2VA 4HGNA 4JDPA 4UATA 4YIKA 3OCUA 5T41A 2GFHA 2RAVA 2NYVA 2YMMA 3HYCA
chains in the Genus database with same CATH superfamily
4R01A 1YK1A 4EGQA 4EHFA 5B4VA 1TJPB 5EJ6A 2PD3A 1LLDA 1FFBA 1GA6A 4FZJA 5DX1A 2BHSA 5DN9A 3AM5A 3U3RA 1U3DA 2P4QA 2VP9A 1N2XA 4FHEA 1LQ2A 2GHIA 3TKAA 2Y9MB 3GLGB 5MHTA 1RZRD 4Y7DA 3JQDA 3OT1B 1Y7LA 2H16A 2WTBA 1JTFA 1NFQA 1CY1A 2VP0A 3VDQA 1YHZA 2QJWA 1QCCA 1ZOIA 2P4EA 4OXRA 2JLYA 1E6CA 3BWEA 3GQBA 4DEYA 1FP2A 5T3UA 3TTXA 1GU0A 5JS8A 1N0HA 3QELB 2ODWA 2GM3A 1RPAA 2ONZA 3LC2O 4GWGA 4M7OA 5DFAA 1DHTA 2XECA 2YVKA 4AMUA 1R6DA 4EY5A 3WGIA 3CZMA 5IYZB 5KTKA 2VHVA 3PSHA 5P8WA 5BSMA 1VTKA 5H83A 4E51A 4FHFA 2I2WA 2X6RA 3KJZA 2E0IA 3O3MB 2PNFA 3IVMA 3EW9A 4DPLA 3HNRA 2XCLA 1BGVA 3D7LA 1GFSA 4IUCS 5E8JA 1M6WA 2ERYA 1TYAE 1Z5NA 4N5NA 3PXUA 1ENYA 2RI0A 5J2TF 3ANLA 3HXPA 4Q4AB 4KPYA 2OB1A 5DJ5A 5BV1A 3FRIA 1P0PA 2HJGA 5IDVA 3T1VA 4DLTA 4E5DA 2X8WA 5HEKA 3OZIA 4Q05A 3NRCA 4LOAA 1XDDA 2VWQA 2OBMA 3DE2X 3PFWO 5ER9A 4EFNA 3U3ZA 5BURA 3FUTA 3IEIA 2C3OA 5E7QA 4RKWA 1EH5A 2J9YB 3GJTA 3I9V1 1UOEA 4P58A 5CG1A 1EHIA 1DDGA 2HDOA 5JMTA 4J3FA 1NP3A 1ISRA 2KSQA 3AP2A 4KGXA 1A82A 5HK8A 3UENA 4YR7A 1IVSA 2J3KA 2HY7A 1R8XA 2V7UA 4JI2B 4W8GA 3OF3A 3AEQA 1TFRA 4PGHA 3HYRA 3R77A 1DQYA 1W0JD 1SU8A 1XD9A 4URWR 3Q72A 3PEVA 1RKVA 2WZBA 4GSYA 4RVDA 2JGDA 2DHEA 1NMZA 2REBA 5E7MA 1G9SA 1BHO1 2PZFA 1B8UA 4LDAA 4Q9HA 3MC1A 1SG6A 3O1JC 4RORA 5DM0A 3R7WB 1LGYA 3TNJA 4FR2A 1NBIA 3IIMA 3Q3VA 1C7EA 1EFPA 2GD0A 4P5PA 5CM8B 3CB4A 3H16A 1UZAA 2XWSA 2FRDA 3LF1A 4KIGA 3B7PA 2EL9A 2OZEA 3ADPA 4FD2A 4MVJE 1L5GB 3I83A 4B4DA 4DIOA 2EKLA 2WU8A 1PJBA 3OOSA 3SEZA 3OCZA 1F06A 3S99A 3VYWA 2ZU6A 3A32A 4OFXA 1JG2A 1KVRA 2YS6A 1CY7A 1RBMA 3P4UA 3TNFA 3U39A 1LRKA 4PM4A 4BC0A 5BV8A 4DZTA 2GLXA 1BGWA 3HS3A 3CF6R 1NTOA 3O8QB 4MPTA 3N0VA 1ZOSA 2C57A 2JGNA 3OX4A 4GE0A 2J6IA 2Z08A 4UM8B 1WLYA 2Z9BA 4TMYA 5G4KA 2C4MA 1BFUA 5JALA 3HUFA 3TUZC 3G13A 2FEOA 5T8KA 4II2A 4RCVA 5L7WA 5F9HA 1LF5A 5F9FA 3MTEA 4B76A 3H9GA 1DIHA 2FV8A 3X2FA 4D3YA 4DC0A 1UJ6A 1GZUA 3A4NA 1ZIPA 2NW6A 1JLRA 3D0RA 1X38A 2FUEA 3RWMB 1GNQA 5BWBA 3DL2A 1ZIXA 3M3HA 3UB4A 2CHVA 3ZU6A 2OV8A 3H9BA 1UDAA 2XZTA 1XO1A 3D6FA 2JHFA 5F78A 4R8KA 2BP7A 3HY3A 1QVAA 2AC4A 3EXAA 3EGEA 4I8DA 3ZQ4A 1NKVA 1MV8A 4GE3A 1PG5A 4ZCPA 3OICA 4DXAA 4QA9A 3RQSA 3WSTA 4DIFA 1KFCB 3ISTA 4UHCA 3S7ZA 4DLKA 4IH1A 5ALHA 1Q1AA 3KVOA 3KQLA 3QKIA 2QL5A 3LY7A 4HH1A 1PIWA 1BS1A 1UBSB 5AIBA 4AKIA 3S6JA 2FX2A 5GAJA 3N2NA 4AS3A 2NZXA 4GR4A 4XM2A 2I3BA 1J33A 4JQOA 4QHSA 1G2IA 3Q11A 2OCLA 1C1DB 4ETIA 1V45E 1VL1A 1QDEA 1SVMA 1XNHA 1TZJA 2Y1XA 4IDNA 4E5SA 5LQRA 2GASA 2QTVA 3JALB 3CISA 2GNAA 1W47A 3JZFA 1VJ0A 2IGTA 4FOPA 3QJGA 4NJEA 5F2EA 5C8YA 2WJ3A 3GVHA 4QQRA 1FFSA 5EXSA 2QMOA 3IAAA 3VU9A 2RAPA 4D9JA 1EFLA 1K8YB 3BGIA 5IUJC 2CXUA 1ZH8A 3KU1A 3TOCA 2XTJA 3EC2A 3ZGXA 1BQ4A 2VPZA 5BP7A 2ZYGA 1UKCA 1WBDA 1J9GA 3GBVA 4KYVA 1PQ4A 4LC9A 3BGWA 3JQQA 3RTEA 1R37A 3VSBA 1V71A 2JCXA 3F6YA 3HO8A 3ETJA 3OECA 4YCLA 4D1YA 4BO6A 2R6FA 3UK6A 2NZ2A 2PWBA 1O0BA 2Q5FA 1T0BA 4X8LA 3S5UA 4BNDA 2GDZA 1PT9A 4CIWA 5K3FB 4F97A 3SX2A 3VH1A 2B69A 4EYEA 5KB3A 4M0MA 1LLFA 3KVVA 2NUTA 3WISA 1K98A 4O2AB 2OLJA 5LC1A 3JQFA 1RBQA 4MQFB 4N3GA 4YQZA 3THRA 1ZGHA 3CMCO 4TTJA 4MCAA 1UT8A 4HCJA 4MRMB 4Y2UA 1ORWA 4DWWA 1L8QA 1Y34E 3JD3A 4INOA 3VOTA 3LK7A 4BX9A 1W0KA 3P2IA 1W4RA 3CJRA 3JQ8A 2QUBA 5AI0A 5FTJA 2H5IA 2R5WA 3ZCRA 2QW0X 3V2GA 4QT4A 4MIKA 3W2FA 5JD5A 1WW8A 4AULA 1PR9A 1UC9A 1J49A 2HQBA 2WWFA 2Y0CA 3OESA 4GEGA 3T9FA 1L0BA 1LBTA 3KCNA 4FHDA 5D5HA 3U3JA 2W6OA 3RSHA 3T7RA 2JANA 3EG5A 1ESEA 4LXQA 1I30A 4AC9A 1U11A 3O84A 1ZAKA 5HF5A 2A9FA 3U13A 3W06A 4TGLA 1ZYUA 2YC4C 4J9UE 1N9GB 1R8SA 2ZKLA 4PG8A 1R5JA 5HDBB 4D8WA 1MZPA 1FTWA 2NSHA 2WJYA 3JPWA 3UMSA 1TVKB 1Y1QA 3J81k 5TMBA 5L8VA 4RA9A 3W8NA 4MQBA 3EB9A 3WAKA 2Z2IA 2FJ0A 4QBKA 4M8NE 4XVUA 1G7TA 2DE0X 4YVFA 1BKSB 3CW9A 1IN8A 4BGDA 3Q3JB 4EYGA 3IOYA 2V58A 3EDYA 4NU8X 4Y2SA 3NJRA 2L19A 1Y7HA 4MGHA 3WYNA 2JIPA 1EIWA 1E3LA 3FGNA 4KYUA 5JSUA 2DKFA 3MWLA 4XYLA 2ISSD 2QP3A 4Q66C 4R54A 1DJOA 2XGOA 4KE8A 4AN1A 4DLBA 4XWOA 5AUPB 5FUVA 3Q7SA 4K8RB 3QVMA 3ONEA 4IRUB 4RFSB 5TR9A 4BZQA 3I3OA 4ZOLF 4U02A 3ZNQA 1TVEA 4ARZB 2YOGA 3AY7A 5C7LO 4NFLA 3B2EA 4YONB 4NZPA 2IYXA 2G0NA 3ND5A 3G9UA 4IIXA 3RF7A 2HEIA 5B12A 4BZZA 3O03A 1IXKA 1DAOA 3V8BA 5DT2A 4AUEA 1NLFA 4D80A 3U5ZB 2PX3A 2WD9A 3A6ZA 4KGZA 3H0EA 3ZY2A 4JJKA 5D2CA 3HWWA 1B6GA 3ZN2A 2RAFA 1CW2B 5LPNA 4F86A 3OPMA 1DKQA 1WMBA 2HWUA 3H3JA 4ZVOA 2OLKA 3I9MA 1V9LA 3GIDA 3RFTA 3BH6A 4DMKA 5IU6A 4HAVA 3AOEA 2E4VA 2FEAA 2IYRA 2XZOA 3D6AA 4WGFA 3KSZO 5ADHA 2ZSKA 3F0TA 3ELYA 2RKWA 5COQA 4QSMA 1HEUA 3ILVA 3KKZA 5GJBA 1OC2A 4L8YA 2JD0A 4QULA 1B14A 3GUYA 4N0PA 2BCJQ 2UUCB 1XU4A 4TL8A 1XQVA 3QPCA 3F6RA 2LVBA 5EGNA 3T3GA 2PLNA 1BXRA 4DDMA 4BMNA 3RT1A 3WLOA 5A5EA 3QX3A 2UV8A 5F5XA 5JYEA 2CYAA 2YRWA 1LBEA 1FTNA 2AKAB 2GF9A 3G6WA 3QUCA 1RRPA 4MS3A 2ACKA 1QX4A 4RSHA 5D00A 2FSVA 4MJ3A 4D46A 1DJNA 2Z6QA 4UXIA 1MOZA 4EJMA 5JCOA 4IHJA 3LAWA 5JMOA 5DYIA 3WL6A 2OZPA 1QH8B 2P67A 3MCWA 5A7GA 4ENQA 4Q6WA 1G20E 1ZD9A 2HD4A 2C98A 3PNLA 3NC4A 4F1KA 5C52B 4GDMA 1OFIA 1IBRA 2AS0A 2PD4A 3I04A 4FVTA 1XCJA 3AUXA 3NXSA 4U6QA 4LKOA 1J0BA 2XMBA 3PEUA 3U7QB 2UZ1A 1IULA 5I7FA 1Y37A 1N2EA 4C4RA 2PZLA 5CDTA 3KYCA 1PGOA 2PQ6A 5DM4A 2MSKA 2JFOA 3LZ6A 2E6KA 1XJ0A 1JI0A 2FLVA 2VF2A 3D7KA 4K9OA 4TSRA 2AMVA 3IHTA 4L7QA 4ZYZA 5KYWB 1QIJA 3TQFA 1UFQA 3KWLA 1U5BA 2VJMB 3E9YA 4JLUA 2Y71A 4OAOA 3W5IA 1KOFA 2OC4A 1RWOA 2F1JA 2WSSD 1E1QD 1QFZA 1Q16A 2OOKA 2WT9A 3NHBA 4IWYA 4IIGA 4ER6A 3GGJA 4EJSC 1R12A 1ZJ5A 4KBYA 1E9BA 2O5VA 3I2FA 4KLCA 4WK4B 3T7CA 1VG1A 4UBJA 4R8RA 5TF0A 6REQA 5JD4A 2Q27A 3VC3A 1OXTA 4F91B 3C5WP 4CF4A 3EXIA 5AW5A 5A7FA 5I6DA 4LQDA 1BGXT 2GSWA 4KI0A 4NPAA 4WSOA 5C3UA 2IPNA 1SOVA 4KVGA 3FDXA 3NFYA 2PUAA 1N6IA 1RVDA 3AI3A 3AZQA 1NQXA 3QE4A 1IXZA 1JFRA 4UUOA 3N2KB 2X3UA 2J41A 2R2AA 2IDZA 3H13A 1L8AA 4O5AA 4N03A 1YIDA 1S8FA 3AK4A 1U04A 4H0NA 3EEOA 4A6PA 3DFFA 4UEOA 3ZY5A 4YRNA 2WFAA 3HVJA 3N53A 3O92A 1HK7A 1M1NB 1XJQA 2PS1A 3EBLA 4MUMA 4WCFA 3WRXA 3GFRA 3OPNA 1SCAA 4IDDA 2F4NA 4ZDWA 2P3SA 2PX5A 5BN4B 2O48X 1LSSA 4CODB 1A5AB 1PL7A 2WSLA 1UZNA 1ISIA 3EVEA 4PLCA 4QECA 3ANTA 4KIJA 1LNZA 4BB9A 2Z5GA 2H59A 4R84A 4FFBB 3WGZA 5HPYB 3WLKX 1QHFA 3LW8A 1DWOA 1DBQA 1L7DA 3IP6A 4TN5A 5C7OO 1V5FA 2Q5IA 4G85A 5CCBA 3Q3HA 2XCRB 1P39A 5EHQA 1XEXA 2H07A 3UNXA 4HZGA 1MB9A 2WE7A 1E61A 1K7SN 3PVCA 1PZHA 4IH9A 4BO8A 4YCNA 4W1RA 1LS6A 3PXCX 2FOXA 4OM7A 1KEKA 1HY3A 1YE5A 3HZRA 5CB4A 1O87A 4MROA 1YVDA 1FJ2A 2DWOA 5FPYA 5AK5A 4PZCA 3RT7A 1ETHA 3U6KA 4R68A 2P5TB 3PNOA 3EEFA 2PKEA 4KXWA 1NM5A 2YJGA 2YCBA 1F9AA 3CX4A 3LHIA 3X1DA 3GJ4A 2ZI7A 4GAEA 3SJZA 3LUPA 1RWKA 5DHFA 2JCBA 3WA7A 1HDXA 3I52A 3NKLA 2BGLA 4XYEA 3Q10A 2IXBA 4BRUA 1UBKS 1C8VB 3NWOA 4A4DA 4G0ZA 4KQIA 4REOA 5DV9A 2BEWA 2QTFA 3BOSA 1GGKA 1JDUA 1OAOC 1P9RA 1URPA 3BWDD 1SUBA 2EWWA 2PG3A 2O9JA 2W6QA 3A9TA 4URFA 2EQ5A 3I58A 3AWIA 3OC0A 2J9XB 3I01A 3S40A 4NARA 1CUJA 1LDYA 2VPTA 3BCRA 3SF8A 4A8HA 3IR5A 4DM7A 2Z2ZA 3PWTA 2P8JA 3G89A 2D1TA 3HJNA 5TDHA 3LBAA 3QUSA 5LD2B 4H7FA 3I1JA 3P20A 5JVDB 3W3AD 1ZXBA 1QIKA 4CU5A 4DDTA 2C2ZA 2GI4A 2YS7A 2Y0EA 1EU1A 3DTNA 3I9LA 4I55B 3VDXA 1RKUA 4BO7A 8ABPA 1ULSA 3TNYA 1P3JA 1CUIA 4WXYB 4ENVA 4LXGA 2QUHA 4CDGA 4QXMA 2ADMA 2NLOA 3SHQA 4J0KA 4DJAA 2PBFA 5KWEA 3R3JA 3AKCA 4AZ3B 4HX2A 3LHSA 4Q1DA 3EGOA 5EI5A 2OKCA 4XSGA 3DVAA 2Q2VA 1KI3A 1T0UA 1ZBQA 3C8MA 3MWYW 4FQ7A 4JXJA 3WJ7A 5I01A 1K3UB 5K8VA 4DLAA 3T1HB 4IO0A 3VPHA 3L4BA 1IZ0A 5JXHA 4JP5A 3OEYA 4Z4IA 3B8EA 2DSNA 2JPDA 2O0MA 4MV5A 4D3FA 3C3WA 3UV6A 3BICA 4OHYA 4MVCA 1SC9A 3WE7A 2OD7A 1L5RA 2W90A 1E3EA 3OQVA 4DA0A 2RHDA 1CIPA 3Q40A 4ZTZB 2P9JA 2HIGA 3ITDA 5LXTF 5DYGA 2OOSA 4G9BA 5JSKA 3E6AA 4B3FX 4DMLA 3GFSA 1ST2A 2ZRHA 2Z95A 5TMEA 5BRJA 4CLOB 4WPGA 4DAEA 4O2AF 1AKNA 5JH7A 1NF9A 5DOZA 2RAUA 3KTFA 3OQ1A 2GEJA 2DAPA 1ZA2A 3C4VA 3GMTA 1BDIA 1TZCA 5D51S 3ZCPA 3HC7A 4MWDA 3HACA 2BGIA 3TW8A 1GHTA 2VDRB 4GSLA 4CMIB 1XK6A 2Q2NA 5I9LA 4YIKA 5CT6A 3WGQA 2X8LA 1E6UA 1O0CA 5M2QA 1EDBA 2WNIA 2ZQYA 2RAVA 4MPJA 2NYVA 1X19A 2QE7D 1NNUA 1I5OA 2B30A 1R6AA 2OFFA 5K99A 121PA 3BX1A 3CO5A 1AV6A 3I04M 4PZ0A 5CB6A 5FBKA 5KHAA 1OILA 1GKLA 3OF5A 4A7PA 3REQA 1NDHA 3MJTA 1IN7A 4BVAA 4OUDA 5C35A 5F7OA 4EG4A 4EK9A 5LVAA 4Z53A 1JG7A 3AV0B 3PUXA 4BO1A 3RAFC 2RC5A 4L9RA 5IULC 5K09A 1T9GS 1JEYA 2REQA 2X0RA 1DL5A 4HAZA 3WGTA 5HK9A 4LS3A 1A8HA 1OJLA 2BMWA 1XMIA 3DS8A 3NBZC 5F2NA 1UAGA 3GZ4A 4OJQA 2B21A 1E8DA 3RC9A 4AJOA 1P7PA 3IBSA 4BJ1A 3TPCA 3HUEA 4O4IA 3WJAA 1KZ1A 2IGBA 2X5OA 5FOSA 4EW2A 2R1ZA 2ZPUA 2HN9A 3R20A 2RCYA 1E4YA 2O54A 3E03A 4RKYA 5EIWA 5CK4A 1U8CB 5ENDA 3T5PA 5K0ZA 2BKXA 1C4KA 1THGA 3ZHUA 1RHUA 5KTSA 1AGRA 5CYPA 1F60A 3ZDFA 2MSEB 1JVBA 1KR2A 1GNPA 3HJGA 3W4JA 5DM1A 4DLZA 1SVKA 5IC4A 3VVLA 4ZMBA 4B3GA 2G7MC 5IMSA 2IHVA 1ZXXA 2BFFA 1K8RA 4GI5A 2GCNA 3T8YA 5H70A 3D6HA 3LPMA 4FDTA 2E4AA 2C29D 3U7EB 2OUKA 3CRVA 4PR0A 4BAUA 3H4IA 3TINA 3U1BA 3E9DA 1TCAA 1ESZA 2UXCB 4HGYA 2JD1A 5CNIA 2IHYA 2EEPA 2C84A 2WIBA 2G5CA 1E2MA 3P9QA 4WUTA 4LY6A 4AU1A 1M6VB 2X3FA 3T7DA 5UKDA 2JASA 3V4PB 1C3OB 1FYVA 1X3SA 3K6JA 5EUMA 3LIPA 2WM9B 1PJCA 1DCKA 2VQDA 4RLFA 5EZ6B 4C88A 4BVHA 2N46A 3UHJA 3W78A 1K66A 5I7EA 3D8NA 4BCBA 1QP7A 1XXHB 1L4MA 2BUAA 4D6PA 3OIVA 1ZH4A 16PKA 3KXDA 4JKIA 4TVBA 4HAXA 5BWOA 1ORRA 2NGRA 1C3XA 3ICCA 3PTLA 3WLTA 1SXHA 3H2KA 1PFUA 2B8TA 1OTXA 4PC3A 4U8HA 4EA6A 1VGRA 4EKEA 4ZCLA 1CQWA 4TMVA 5P21A 4NDAA 1A8SA 3CZ4A 3EIFA 3E5MA 4KWHA 4O0LA 4LZAA 4Z6KA 3BFXA 1T9GR 4WN3A 2ZJ4A 1C7QA 1G17A 2UZAA 3ED5A 2CL5A 1JMKC 1EUZA 3GLGA 2DPGA 1KHTA 1G8FA 5C8ZA 4RQUA 3ZQJA 2Q9AA 2PX6A 1Y3IA 1G4HA 4PS0A 1EP2B 1ONOA 2DPHA 5FWAA 6YASA 4TZ0A 4AMZA 3B6EA 1WVMA 3NCHA 3KAQA 3L1VA 4XIGS 4BNFA 4ZYXA 1XEWY 4OYLA 4KTVE 3CZPA 5FFNA 4Z3DA 3I01M 1JEDA 1XI2A 2O1XA 2VWGA 3AR6A 4HAWA 3SQMA 4ZC1A 3CTMA 5CW1A 1Z7YA 4IDQA 4IQ0A 3TDKA 4YIHA 3WKDA 3HU3A 3D6UA 1WQ4A 2J33A 3P96A 4WJKB 3Q8MA 2XVMA 2XEXA 3N3AC 5THQA 3L7DA 4UE6A 3T9CA 1Z4KA 1X14A 3I62A 1UMCA 1Z29A 1G2QA 6LDHA 3M49A 4BGEA 3HE3A 3EZ9A 4YAUA 1TA0A 5FWDA 3AY3A 3FMOB 4LZPA 3TRFA 4TYQA 5TGZA 5HYVA 4FKMA 3K70D 4C7XA 1CUDA 3U7GA 4TKVB 3N74A 3NEAA 4F7DA 1E2FA 1M2EA 1X1DA 3M1YA 4CQLA 4MVJG 1LPOA 2PM8A 3L0OA 2VA8A 1DPGA 4DS3A 2B36A 2F90A 2YNMC 4MR7B 3NASA 1EK0A 1L9XA 2REOA 1G7RA 2FFAA 4K6HA 3DXZA 3G68A 1SVIA 4EUFA 5KO2A 5JS1A 1B0UA 1JT2A 5DBEX 4K6KA 2OFXA 5SYMA 1FPMA 3BF8A 1XLUA 1QPZA 4G1EB 2KS6A 3QE3A 1X1CA 3LOUA 3Q2IA 4X63A 2A5JA 2PZMA 4OCZA 5FLYA 5B5SA 3JQGA 3ZGNA 3ETGA 3PXDA 1HFKA 3BJIC 1R16A 4DILA 3L6DA 4GC5A 4JJGA 3LC1O 5IC6A 4BL5A 1RXVA 3DT6A 1SC1A 5H3CA 3WAGA 3G1TA 2CUKA 2QZZA 2IH4A 3HY4A 2N75A 1XRLA 2QR2A 3A8TA 4D5EA 2AWOA 2AHOA 3LXUX 4IJKA 3RK4A 1AN9A 1PK9A 2GK4A 4PHGA 4B82A 1PL0A 3DV0B 3NTVA 2NU9A 4JJ4A 1IG3A 4XIJA 1X7WB 5EOVA 2XHEA 1H2ZA 2GPYA 3A1DA 1GUFA 1Z15A 1L5FA 3A25A 3G9XA 3CEJA 3NAMA 4LQLA 4YHBA 4C0BA 4C9BA 3JD0A 2IYAA 4JASB 4V0LA 1T1EA 3HMKA 1KERA 4NMXB 4LV8B 2ATXA 4ZAVA 2GNPA 2AZMA 4QWMA 2I8LA 5TQJA 3IHLA 3ZH2A 2MSLA 1CUUA 3KOOA 3QWAA 2XITA 5CFOA 4RVGA 4I46A 3ADCA 1S6YA 1GJRA 1K88A 3EZ6A 1H2RS 2IXEA 2YIVX 4MUYA 4NBKA 3VAAA 4F12A 2UZ3A 3STUA 3WYCA 1SG0A 4LJ7A 1YQUA 1EB8A 5A6VA 2PMBA 3F1KA 4TSFA 1FQWA 2CD9A 2HSWA 2XIQA 3CLUD 4K3VA 4LX8A 3W9BA 3C6KA 3OTHA 1HOXA 3O8LA 4R6WA 1ILWA 2HCJB 3B3FA 1ODTC 4FZ3A 4UDYX 1T3GA 4QODA 5TPWB 3H2IA 1CZOA 1XZKA 3GY0A 2FZLA 1HEIA 2GJ4A 1K5PA 2GZHA 4X1YB 5E9QA 5L3ZA 2X0JA 3NBUA 3VR6A 4HT3B 4R40A 2MTBA 5GJVC 3QBEA 1CCWA 4MKFA 4I4TF 5EFZA 4QVGA 3TVTA 1VLHA 1U8XX 4NBTA 3MGBA 3KL2A 1D7OA 4K6CA 5JNVA 2Z6VA 1DWPA 1NZJA 2PGDA 2HBYA 3BIXA 3HV2A 3I2HA 4E2FA 1BXGB 2ZIAA 2N47A 4O1MA 2QGNA 4V39A 1N57A 4HDNB 3TLGA 3O1LA 4UXJA 1MIOA 4WACA 2I6GA 5AK6A 2IDJA 2X6TA 1QQBA 3FDZA 2P65A 3BM5A 1J9EA 2FPGA 4K28A 1C7FA 4BECA 1WHTB 1ZGJA 3EUEA 1CY8A 3G85A 3RFFA 3QLUA 5EJ5A 4XDYA 4I81A 3RS4A 4K0RA 2GILA 5KU7A 5KYUB 1E3WB 1T2VA 2O57A 1BIFA 1EK2A 4ZJZA 2FH5B 4US0R 1PLKA 1MJ5A 4OIFA 1U2TA 1IN4A 3D6TB 5EIOA 2BMFA 4YMWA 3EMKA 3IUQA 4FN5A 4UEJA 3RARA 3WMRA 4PFSA 3EC7A 3NWEA 3VDNB 3CXUA 1H6DA 1BKYA 2IYYA 3WQSB 3DXXA 2QW8A 4L75A 4Y2TA 5IAJA 2WG1A 2X77A 1HM5A 3FLEA 3FB4A 3WGOA 2E55A 1CE8A 1VCOA 4FMCB 2CLSA 4OHVA 4ND2A 3WXBA 5AK3A 4RK4A 5C5EA 4I3FA 4P3YA 3ZNOA 6ABPA 1ABBA 1QYIA 3NT5A 3GFTA 5AK4A 2E4ZA 2GKSA 1NJGA 1T6BY 3AETA 3URMA 2QORA 2RGUA 1GADO 3KQNA 3N6RA 4ESOA 1A8PA 3CN7A 5JXIA 2HXYA 4Y2VA 3DBRA 4AZVA 2FZGA 3H8WA 1NN0A 2OVFA 5CM2Z 5AFSA 2X7JA 1RQRA 1L4YA 1G1MA 4P38A 4XB2A 1T4MA 2K2WA 2PZEA 3P19A 3A28A 4BQEA 1T9AA 1XTSA 4U5QA 2IHJA 2VXOA 3AHCA 5DWVA 5EJGA 1VZ3A 4B7XA 4HNUA 3LT2A 1N5IA 1CS0A 4E31A 1XCLA 3DDWA 4B74A 3FW1A 3NORA 5L4LA 3NGXA 4OH7A 4ID9A 1FLDA 1NKTA 4CF6A 2MSCB 2IL1A 3LNCA 3K8QA 2QVCA 1UJNA 1T4CB 1IBSA 4K9KA 3X1YA 2DQKA 1A9QA 3G2QA 2ODBA 2O2HA 3FWNA 2YFKA 3IBFA 4HNAB 4M1SA 1T6NA 4Q9JA 4Z4HA 5LOVB 2ID8A 2ISQA 3KBOA 2XW6A 5IBCA 1G6HA 2EFJA 2FB9A 4AUMA 1NTRA 4PIPA 5K6RA 1JP7A 2YN2A 2QUIA 3EISA 3HRKA 3MTQA 4NEHB 3HYSA 2HZ7A 1HL3A 2RG7A 3A1VA 1ZNXA 3GFFA 4NCIA 4R05A 1PO7A 4RY0A 4ZGGA 4U1RA 1A4RA 1G98A 3LLMA 1CUSA 1JJ7A 4JWTA 4NK4A 3RVJA 1FZTA 3AU9A 1M34E 5HQ3A 4DBVO 1L8OA 4IVQA 3FB1A 2IUUA 2UVPA 4HG2A 1MCZA 4AJEA 3G8AA 4MCIA 4Z54A 1SBZA 1QCYA 2WT8A 4OHPA 2GJKA 2WW8A 1DC6A 2CF5A 4EG5A 4BLVA 3GLQA 4X65B 1OZGA 2YDXA 4J0JA 5FB3A 5ETJA 3RVOA 4EKIA 1E1KA 1AURA 1QNFA 1NXSA 3AWDA 2IKSA 2VSQA 3K8OE 3D8BA 3QXJA 2EOAA 4P9NA 3EGVA 4ZO8A 2GJ9A 5E1OA 1YZKA 3NU1A 2QSZA 5E4YA 3JPYA 5E6SB 3RC2A 4RJTA 2IIPA 3C39A 3ROPA 5ELXA 2WTXA 3WICA 2B4QA 2UYHA 2N3ZA 1EWRA 4M1EA 1W30A 4TT3D 1FQJA 4Y2RA 4DR6B 2VNHA 3ER9A 1EFRD 4PAWA 3IURA 4HAIA 1QZTA 1AS0A 1FFXA 2QX7A 4D0SA 2P2SA 4CE6A 4AY6A 2GZMA 3RU2A 2IYFA 4A2QA 4L0DA 5K8JB 5B30A 2N1MA 4E1BA 1FU4A 3HLYA 4Q3BA 2V6BA 2Z3WA 2VAVA 4J7CA 1U4SA 4RL4A 2H17A 4IXMA 4N65A 1MO3A 4NE2A 2VOJA 4JEIA 4X97A 1K97A 2QW1A 3OPYB 4MCHA 1NUHA 1XVAA 4J9VA 4E11A 3HN7A 2EGHA 1F5SA 3DPIA 1F6BA 1M6YA 5ALRA 4X90A 4BFVA 1FIUA 2I4OA 5E4FA 5D87A 1Z68A 2N1BA 3OIYA 1O08A 4F2PA 1IMJA 1CK4A 1Y4AE 2EWMA 2WTAA 2A6PA 2ZBVA 3PPIA 4KXMA 2RKBA 4MA0A 4XQCA 2ZBGA 2BGMA 3DUFA 2O23A 2ZSIA 2FHSA 4X1IA 2WFMA 2Y93A 3RSOA 1BDBA 2WSMA 4XKJA 5DYTA 1FTSA 3Q0EA 1OTYA 3DULA 4UMEA 1JG3A 2D2XA 4AXBA 1QQTA 1UP6A 4RGYA 3G2OA 5EY5B 1IUPA 1NVGA 3U4GA 5HBRA 1ZZEA 4I0WB 4YPVA 2DEUA 2Y1CA 5BV2P 1P75A 1OH5A 1VYHA 2CE2X 4FX5A 1B15A 1G20B 3OHPA 4UREA 5BVHB 3PC8C 3OZFA 3KVYA 1K92A 2VO1A 3MJEA 1DMSA 2PT6A 2QVZX 1YR2A 1H8EA 2Q0SA 5AW6A 3VGJA 3EVDA 2WHPB 1BVYF 3NKVA 1US8A 4L5AA 4TVOA 1WUJS 4UMFA 5K3DA 1P1HA 3AUFA 4KKVA 5ALEA 3ZGYA 1D7AA 4EFLA 1K5HA 1E1RA 2XMCA 4XD2A 4BBAA 4ZI7B 2OMKA 4JBGA 4CLRB 1B16A 1IIRA 2HDWA 4EGCB 1H2WA 1IATA 4JH0A 1UT6A 4R0VA 4AYTA 4C0AC 2XXBA 1FW6A 3D6NB 4GZ3A 1K8ZB 1Z5WA 5L9AA 1DPFA 1OUMA 1TEVA 2X5JO 3PCRB 3B1WA 1NJ8A 4HFJA 4P36A 4GIBA 2EBFX 3MJVA 4C3OB 2XNSA 3QLTA 4GI2A 4IIEA 4N39A 4GO1A 5TGTA 5D5QA 3WFIA 2D0PB 4E30A 3I9FA 3EZLA 4MULA 3TDMA 1K2VN 2KI5A 2SKDA 1EUDA 3D02A 1ORDA 4JK3A 2GN9A 4N6NA 3TXAA 2EYQA 3CIOA 4G9GA 3RVBA 2ZDGA 5KWSA 1CR2A 5JLAA 3E82A 4NFYA 1YRAA 4DY4A 4FE3A 2C97A 2XMRA 3AB3A 1QK4A 1GKYA 4OHBA 3Q6NA 3SZRA 3VXKA 2Q50A 1CQZA 1VMIA 4ND8A 4XWGA 3N5CA 1G16A 2CVOA 1P77A 3MBOA 1TYDE 1AQLA 1U3VA 2R6HA 3ZDRA 1Y98A 4A23A 3V6LA 1MA3A 4BYMA 1Z25A 5FPKA 1UJCA 1HTTA 4MVJF 4MVJP 5IX8A 1EZ1A 2DUUA 1WXQA 4R1UA 4YRFA 4ZVLA 4J2OA 4ANFA 1OXVA 4HB3A 4BJ5A 3SZOA 4MW1A 3C7TA 3E3AA 1GZVA 3BQMB 3MT0A 2GERA 1KO4A 5JC1A 4AI6A 3WTCA 3K5PA 4RMHA 3OTWA 1X7YA 1P0QA 1WUTA 3PC7A 4Y0NA 4ZJYA 3E53A 3PFFA 4MX8A 2LPMA 4M36A 1A76A 4MRNA 1M2KA 3AUTA 1GNTA 2XF2A 2JATA 3MLEA 2WYIA 2XI4A 5K51A 4DCMA 1NVEA 2X4LA 5FLKA 5TF4A 3HDTA 3KEOA 3OE1A 1CEEA 1JMYA 1BXZA 3BSWA 4QGBA 5CVVA 3RIGA 2HTFA 4OI0A 2A4KA 3M5PA 2ZI9A 1SOAA 2D0DA 4GU5A 5J5VA 2IHTA 4MB0A 4PSAA 1EESA 2X22A 3CE9A 1J20A 2CL6X 2ZUCA 5B7QA 3I39X 4LYFA 2PH7A 5TQ0A 2J8ZA 3V7FA 3WHIA 1GCUA 3SHTA 1NBOA 1M8GA 2ZATA 1IVYA 1Y5LA 2CE7A 4UQLA 3GGOA 3H9UA 4XW2A 4BLUA 4I3HA 4YJ2A 3HYCA 4FYIA 5A1TA 2QE6A 2XVYA 3KXPA 1ZN8A 2VHWA 3FJ1A 4ZVVA 5KTPA 3HU2A 3PLNA 1IHDA 3GLHA 4PC6A 4IPTA 1AS2A 1Z35A 1D9ZA 3AEXA 3FPGA 3V8QA 4F1JA 2QMHA 1V0JA 3H99A 4WGGA 1Z62A 2J45A 1LZKA 3AEUA 2GPJA 3TZLA 5EXDA 4ID3A 2C07A 4F6LA 1MQ9A 3F7NA 1VJTA 2Q2OA 1D6JA 3HV0A 1X70A 1MENA 2GQ0A 2JARA 2BWJA 3EGXA 4AJIA 5DTMA 2G28A 2AR0A 4K81B 4YFVA 3LA8A 5INTA 5CAEB 2QXYA 4X1OA 4ENWA 4NK5A 3C6ZA 4BQQA 5JXGA 1VPVA 3JQEA 4NYJR 2NU6A 1FYEA 1BE0A 1R6TA 1BD3A 4FMPA 5KWJA 3OPQA 2PAAA 4EUNA 1OLOA 2OGTA 2R7LA 2Y3IA 1W5BA 3T1QA 3TRKA 4QIHA 3I2YX 4WA7A 1AUPA 4OK6A 4NCHA 4X20B 1W34A 2PJRA 5IWCA 1RQLA 5CIQA 2CXSA 3OM0A 1NXOA 5SZKB 1QP0A 5IBRA 1C7IA 1V4NA 3RUFA 5LMNB 4HDKB 3HO1A 4DKJA 3FYTA 1T5LA 4HWRA 4IY1A 1IJKA 2B1IA 1IAQA 4RHXA 5FADA 3WHPA 3KUCA 3GEGA 2IYPA 2FDXA 5BW4A 3WRWA 2OP1A 2XE7A 5DZSA 3V7YA 3R75A 2AYZA 3RHZA 3S2ZA 3ZH9B 5FOVA 5KKCA 3A70A 1CLUA 1HLFA 5DTJA 2H1IA 5IVHA 5K8TA 1UJ4A 3F97A 1CUZA 4PZDA 1GPH1 1Y3AA 3B1JA 3PV0A 2D2FA 4N7JA 4YV7A 4LDZA 4E32A 1IMOA 5JZOA 4IX1A 1KI8A 4B81A 1J8FA 1I80A 1O97C 4RV9A 2OUIA 4DRXA 4U7JA 1HXHA 3V3TA 1GKKA 4BV3A 1TD9A 3BEDA 3U3MA 3TQTA 3CUTA 4TL9A 3D1VA 5G0VA 3H2BA 2ZP1A 1VKOA 3A6KA 5DISB 3FTDA 5YASA 5BSKA 1CNMA 4HS9A 2OO3A 3C3MA 1V8FA 4NZ9A 2JIZD 3KDAA 4EKGA 3VC1A 1IN1A 2PWPA 3W2TA 5KREA 4ZQGA 3LBFA 1GWNA 1NQWA 2HBQA 5CLIA 2WHQA 4RSRA 1MO4A 1N2OA 1U7ZA 1XZMA 4D8TA 4DSAA 3VR6H 1KQGA 4LYDA 4UZSA 3KBBA 4KW7A 4FW9A 3IUYA 3N5KA 4NIMA 3WQRA 4EB8A 3LYAA 2ZUTA 1W85B 2RFLA 1X7XA 2Z5FA 1MUUA 3L1UA 5FULA 3HBFA 5ECDA 4BKOA 1E5TA 5CVDA 2ZUDA 5DIFA 4BNNA 2W2LD 1XZNA 4OHRA 3SFTA 3PDHA 3INTA 4XYBA 1XR3A 3C3XA 2JJ2D 4HMQA 3K0FB 1PHRA 4R0NA 1QRRA 2HGZA 5KKAA 2YYZA 3FHOA 4UTZA 1Q12A 2FUG1 3QX7A 4L0QA 1C9JA 3RNOA 2DHCA 2JEOA 3RADC 3PD7A 3EZGA 2QVXX 5KOJB 2ZZMA 1CF2O 1X0XA 2VA9A 4FBLA 3RVMA 4EPWA 1JR3A 1T5TA 3SFZA 1HYEA 2PCLA 3O4HA 4QLAA 2HO5A 1RYDA 3EWSA 3K0KA 3K2BA 4MMZB 3ZBTA 3E84A 4E88A 4TV8B 1VE9A 3DBLA 1ZD5A 2H9AA 3KQVA 3HXQA 4FE4A 1MJGA 3EX7C 1O9GA 5DSZA 1F2TB 1SOUA 1R1DA 2GM5A 3C85A 4ZHQB 4HLNA 3W8EA 4F2WA 4QFBA 3CUWA 3EMBA 1C4WA 3BILA 3EZ2A 1V5IA 3DD1A 5THKA 3GGPA 3EQ2A 1FNNA 2QRJA 3T3MB 3UG6A 3UN1A 4NU0A 3E3NA 1EFVB 3Q12A 4CG0A 6ADHA 3AIMA 3CA8A 2V7QA 2FLWA 5AVXA 5KX5B 3F3MA 4FFWA 4Q02A 4GZMA 3QHAA 3T34A 4DV4B 10MHA 3H11A 1DWUA 3A4YA 4RTNA 1EUCB 3F4LA 1M7HA 4IICA 1O4VA 1U8EA 4JBXA 5TSDA 2ZIXB 4Y9RA 3DE7X 2BIFA 5JRJA 3UHFA 4ZP1A 5BRAA 5BWMA 5TLSA 1D4ZA 3AEYA 1Z18A 1C9KA 2G0TA 1DBWA 2XIJA 4XJTA 3VJLA 2ZWOA 2OSBA 4FM9A 3QFSA 4UCXA 5ISMA 1I4DD 2YIJA 3FPCA 1EX1A 4XWYA 5A02A 3CT6A 3BWBA 4PYLA 5F3DA 1EA5A 2ZULA 4JJZA 3F2IA 3V32A 3IBCA 3X1JA 2DPXA 3DOJA 1M8KA 2HNAA 4Q7EA 1KYXA 3K9CA 1MC8A 1OAAA 1RNLA 1USKA 4PG7A 2R3SA 1EG2A 5F21A 1VFNA 4BZPA 3T5DA 5KVAA 4G23A 1SKAA 1Q5PA 2HA3A 3L7BA 4XCQA 5J2TA 5IJ9A 3T7IA 1E2HA 3FPJA 3RVSA 3QXSA 3TVDA 2B83A 3JQ6A 1ITZA 5G41A 1QYVA 3DZHA 3NDRA 3OZGA 3UKOA 1VPLA 4R3UC 4RGVA 3VYTB 1HYHA 1U99A 1XFDA 2FF5A 4BDSA 3WGVA 4IL5A 4E14A 3WGGA 3UAXA 4PONA 3RUCA 3ZD8A 3M1IA 1F4LA 3GPBA 1CD5A 1UFOA 1VL5A 3HB0A 3P9KA 1Z4PX 4ITUA 5FOUA 3W5VA 3OUUA 1ZRMA 3HZHA 1W36D 3HCAA 1P4RA 1W75A 2YV2A 3EZXA 3KYJB 4P98A 4U3JB 5AKLA 1KQNA 3VR3D 4CFZA 1KJQA 1DTSA 1BQ3A 2NZJA 3K9GA 4OHWA 1Y6GA 1NSYA 3AVPA 4IDGA 4MV6A 2GEDA 4KNYA 4MQEB 4FGSA 4ZDKA 4GWLA 3QNUA 1C4OA 1H66A 1VI5A 1VMKA 3JXEA 1DMRA 4HYQA 1YFKA 5CA1F 3GCDA 4WN9A 2JIBA 3CTPA 4C5CA 3N2IA 3MK31 1QP4A 1BZYA 4LY9A 3VU8A 4DQDA 5DB4A 3QJ5A 4KZPA 1Q57A 5BQ5A 2XZDA 4FGLA 3KT8A 4OLBA 4DNOA 1IL0A 2WD8A 3ASVA 4ZRDA 1U0TA 4WLVA 4G37A 4NNPA 4ACAA 5L3SB 3UXMA 2RD2A 2VT7A 1LU9A 4Q9AA 4MS4A 1PBNA 2QGFA 5AJHA 1FX0A 1C7JA 1CWUA 2DBRA 4PHHA 3WXMA 1V11B 2EHJA 2IXFA 4G5HA 4GSKA 3GXBA 1LW6E 4JCOA 2QM0A 4N76A 1ZGZA 5C8VA 4GZ5A 5IVPA 3WIDA 2PEYA 3D3JA 2XQFA 5B7NA 1UK6A 3WIBA 4E46A 5FV4A 3NXKA 5AHXA 3ZVLA 3RASA 3Q9UA 4LZWA 5CM9C 3DFMA 1VG0B 2C0PA 2YWEA 1JIUA 4N5LA 4E07A 4QUJA 3OLXA 3I6BA 1UBUS 1S2DA 4W82A 2NM0A 4K88A 2QN9A 4M9RA 3HVKA 3UT5B 3K70B 1POWA 2COKA 3I61A 3R0IA 2O8FB 5KPJA 2DB3A 2FP4B 4BVFA 1IY9A 4ZKEA 3QSYA 1LW7A 4DMRA 1D6SA 1L7NA 3PGKA 4Q4HA 3ZUGA 4B6OA 5TPZA 4YCMA 3ZLJA 4F8JA 4H1VA 3G1WA 4D8VA 5C7IO 1QHXA 5IXSA 4CMAA 4HN9A 5K4GA 2CJWA 2HYDA 1R0YA 2GOYA 1A5ZA 2CFCA 1QM5A 2IE8A 2WF5A 1WD5A 2Q6OA 2GAIA 2IZZA 2M98A 2WYOA 4UCQA 1JQJC 3FF1A 1HFWA 2QI9C 1NE7A 1HT1E 5K0CA 5KYGA 2OYSA 3U3KA 2EZ4A 4DG8A 3QLJA 3BUSA 1F7VA 3R74A 4BV2A 5EMMA 4MYDA 1MJGM 2QQGA 2Q1UA 1HRDA 2E6UX 1QQ7A 1USVA 3WYEA 2XYQA 2XB8A 3TRJA 1ZIOA 4JXKA 5H0IA 4IO1A 2HHCA 4MKIA 2YHIB 1H4TA 2FSIA 2B7LA 5ICGA 1ATZA 1FVOA 3FPSA 3ZW7A 2QP4A 3PYXA 5AXAA 3AJDA 2B1RA 4A03A 3UXHA 1GLNA 3HSSA 5T4BA 1ZVMA 2C96A 2ZIWB 1T2NA 3JQRA 4ABYA 4OSPA 3MTAA 4U2BA 3LZCA 1JSZA 1Q3HA 2KBEA 2QT9A 3IP7A 3M9LA 4EHAA 2EW8A 3QVVA 4C04A 1M3SA 3EBOA 3DC2A 4UNSA 3BHIA 2H92A 3T5BA 1B73A 2ZWVA 4MTCA 1OWLA 3I6YA 1KVSA 1V16B 3MB8A 3UJCA 1HT0A 2G0AA 4KODA 1LNQA 2IHZA 3B3GA 1X8JA 4FD3A 1WCIA 5IT9A 5JI2E 5KC8A 3WADA 2AFIA 3BZWA 2PAFA 3H1PA 2VYND 3ND9A 1NVUQ 3TCNA 2SCUA 5HNKA 3ACDA 4QPPA 2OBNA 1Z73A 3H3FA 1FVXA 1PR6A 2PUJA 3EDMA 1RACA 2JVIA 4HFRA 3VZRA 2ZSBA 4JR2A 1Z0KA 4FOLA 2BFDB 3QITA 3JVIA 3L7NA 3K4QA 1HBJA 3U0BA 4GPAA 2IKQA 4J7UA 1JKMA 1R9MA 3NM4A 4KPUB 1YKSA 1WZEA 2C4HA 1FU7A 5EIBC 1NIPA 2FZCA 2ZIFA 4K26A 3SJBA 2GN1A 1LBHA 1NZDA 1RFLA 1J0EA 3QHQA 4FK8A 4KIUA 5KOIA 4F4FA 2FRDC 4E12A 1VL2A 2A5DA 1DQPA 3GFVA 4BIIA 3ZPXA 2ZETA 7REQB 5CIYA 3ZJVA 4REQA 5L4SA 3G17A 1NLYA 2PXXA 3L7JA 5E4JA 1CX9B 2C77A 1JXOA 2BM1A 4E3ZA 5ALWA 4X3OA 1SBYA 2Z5VA 5BV0A 3P45A 5FV7A 2QRNA 4KQGA 1FQOA 3IEPA 1YAHA 1BWPA 1ZSVA 1A4UA 4WW0A 3T1OA 1E3IA 2EKZA 4MHSA 4XCXA 5HBGA 1K63A 4NJMA 2PS3A 4URXR 4P7BA 4BN4A 2W6MA 4LNUA 3PUZA 4H31A 1JDBB 4CNBA 4BKUA 1M34B 1EJBA 4LVUA 3O74A 4ZPJA 4D0NA 3I8OA 4YAGA 3UFXB 3PUIA 4RENA 3DEIA 1X86B 3A1UA 4E15A 1GU1A 1DT3A 3PRJA 5ALTA 2RGNC 4BEVA 4HGRA 3VR5D 5JRDS 2GJ8A 2QK4A 3QQPA 1JHYA 4OYHA 3GUHA 4EVRA 3ZCVA 4LZJA 3S2UA 2G82A 1VIYA 4N7BA 5C34B 5KSOA 3FIJA 4XB6B 4LF7B 3JYPA 5F2OA 4G5OA 4RD2A 4PC2A 1SCNE 1PNQA 4TYMA 2X23A 2JHPA 3ES9A 3O8NA 3OUZA 3VR0A 3TIXB 3ROXA 3G0DA 2D7CA 3BMQB 1DRVA 3GUCA 3QVOA 3I4LA 4CM4A 1NAIA 2XNDA 1SO8A 3ILHA 3MFQA 3DWEX 4RPLA 3PA8A 4OSEA 3NWPA 1LVUA 3S3TA 3KXIA 3QF7A 1VLJA 3DMNA 1FFAA 3C5EA 4NBSA 3VYUB 2SKEA 1O3YA 2F59A 3AILA 5LU9A 4GFDA 2JI9A 3DTVD 5TJHA 2H4YA 2RKOA 1IN6A 5JXJA 5KTOA 3FPHA 4ESEA 1G9XA 4DR4B 1N3IA 2OXTA 5TE9A 4L08A 1GUDA 3CMMA 3V6MA 2C04A 3D3QA 4FINA 4GMDA 4BO5A 3MAGA 3CUUA 1JPUA 1REQA 3DZCA 1X2BA 3NHKA 1UIMA 5JAPA 1ICEA 1RXUA 1BOOA 1ODJA 3RIHA 2VDMB 5JNRA 1SQ5A 4KZKA 3QOXA 2ZUFA 1Y0BA 3DZ8A 1NR5A 4UTVA 4QBHA 2FPWA 3D2CA 5IYZA 4TX1A 4BVJA 1SOWA 1P8AA 4W6QA 1IOZA 1NVTA 1TC1A 3KQPA 3TQCA 3FCAA 1XOIA 4ZCRA 1LKZA 2XRYA 5HUQA 5K3EA 5B2FA 5AM3A 1KAOA 3NIGB 1JF8A 2GR9A 4XIIA 3HCRA 4FTWA 2OK7A 4PGFA 1CUVA 4UU8A 3SXUB 5C4MA 4BLWA 4Q4AA 2ZW9A 1C80A 3CPSA 4YRLA 4RIEA 3T9BA 4KR7A 1NF8A 1JB9A 2JIMA 4ZAYA 1CUXA 5CLHA 4NZYA 5CGQB 5ABPA 3R7BA 1QUFA 2Q5QA 4IDEA 4QQNA 2WKPA 3NH9A 5J47A 3L7LA 5KQPA 1T0IA 5BWLA 2DY1A 2D5LA 1L3CA 4O8ZA 3LD9A 2ZZNA 4NOJA 4TYWA 2I7CA 5EWLA 2SBTA 5IXJA 3ZS9A 1X9IA 1Z82A 1XTJA 3HWX1 1APBA 3E81A 1WULS 2R7MA 2R0QC 2ONYA 4C0HA 3CH7A 3DVRX 3EULA 5IJXA 2FFRA 3GLFB 1T4BA 5TXGA 3DE5X 2RJ3A 2VHJA 4RABA 1JIVA 1O95A 3GNLA 4YJ3B 1ZNZA 3RJMA 3QYPA 2WHYA 3FNIA 1W8DA 2J6HA 1RWXA 2HH9A 2QMZA 3F5MA 4QEDA 2X0DA 3RM3A 1HQYE 3TTSA 5CVEA 3R7WA 1UCFA 5JHHB 4JUBA 3LUFA 1RI1A 2WAAA 3H5VA 4BNYA 4PANA 2VHUA 4NFSA 2Q28A 3BGVA 5HJ7A 2K7ZA 4JFRA 1KOLA 1P2TA 1YJXA 1FDRA 2ZITA 1KL7A 3A9SA 2AZXA 4HATA 4PFKA 1WDMA 1Q74A 4P93A 4F2GA 1G38A 2Z6UA 1XN1A 1N33B 3MJCA 1FSFA 4EF6A 3G2KA 4EEKA 1L5WA 2XUPA 4DVJA 4ZK2A 1MU0A 3SNKA 3QXXA 4UKDA 5F64A 2J3JA 2X2OA 3O8QA 4CF3A 3L1JA 2PYZA 1N5KA 2GCGA 3OZSA 4KMMA 4OQDA 4OHKA 3UJ6A 2JGMA 1TKAA 1HQKA 2AKYA 1CVRA 2I3DA 3K1ZA 4BNLA 1RWVA 1WZCA 2FCAA 4IYRA 1JFTA 4LWQA 1IM5A 1SELA 2DWQA 3O1HB 3KFLA 2A9RA 1KXJA 4ZHSA 2FETA 2XDYA 1V7ZA 2X8JB 2YW2A 3K0HA 4QYSA 8GPBA 1WXXA 3FYCA 1XLVA 4XLTA 3BHNA 5IPFA 2CY0A 2IH2A 4H4EA 3TX2A 4ZEMA 2B0CA 4UE3S 4WCVA 3CZAA 4QGFA 2PL1A 2JK0A 5EJIA 1UKYA 4CJXA 1ZQ1A 1Z2CA 3V8NA 4LXHA 5DPMA 5BR8B 1BRMA 3K4HA 3LQRA 5IG2A 3MTGA 3LY5A 1LSOA 4M6WB 1NRXA 2VQ6A 5LR6A 1R0KA 3RWOA 3MJDA 5FA8A 3MT8A 4PNEA 5HKKA 5KVSA 1RRMA 3M5WA 1J6UA 4GBMA 3A37A 4RJKA 4Y6LA 3T54A 1TMYA 2J0VA 3BXEA 4QOGA 3ZE1B 4QPDA 3R7LA 2QY9A 4GQBA 4RLQA 1E3MA 4L73A 2QTCA 4YH1A 1TU3A 1NMSA 1C1DA 2FSVC 4RYDA 4NDZA 4AX4A 2J7KA 4CRWB 5ARBA 3QVKA 9LDBA 2AHRA 2PO5A 2F2TA 1NXVA 3PCXA 1PFVA 1HORA 1XG5A 3JALA 4G26A 2H06A 4I6JA 5E2AA 4AMVA 4Z3KA 1QQ5A 2NZWA 4TMTA 2FDCA 3RYCA 1UPUA 3DLIA 1D2MA 3WLSA 1AHPA 1JEAA 2H5LA 2J3LA 2WNHA 3C3PA 4F2DA 2Y6UA 4CQJA 1KIFA 2WKSA 3G8DA 1MT0A 3S0JA 1AOXA 2VCYA 1RPZA 1S02A 2I55A 4MIEA 4KN9S 4EYSA 2XTAA 3C43A 1X7ZB 2WJJA 1YQEA 4A0GA 1Y8RB 2C9BA 4KTTE 5AVQA 1ZUWA 1NC3A 3RBVA 2B4KA 3HP7A 2BM0A 1P9LA 3OSUA 4AY3A 5K3FA 5CPFA 1T3HA 3DG9A 3KL4A 2AZDA 2JD2A 4BPBA 3JQBA 3MHPA 4O2AA 1QV7A 2TYSB 4MQFA 4UEWA 1T8YA 4UU0A 4ER3A 1IBLB 4X6YA 1VP9A 4DSTA 5B3AA 2X86A 3A2KA 3NVMB 4MRMA 4FMDF 1WA5A 4KPFC 4PSUA 3F74A 2HREA 3DE6X 3LV8A 2PR2A 3ER6A 1K5GA 4ROSA 4ZZ1A 1G8HA 4KE9A 5FTNA 1M8PA 3WWPA 1V1MB 2IOYA 1TT5B 2RGXA 5CLGA 2Q3EA 3RDPA 1W1WA 2ZRIA 1TJNA 4GI3A 4UQOA 4H0FA 2Z1MA 1S8OA 4UULA 4B7CA 1QRTA 4LWOA 3L1IA 3C7KA 3PZRA 4QHYA 4PIMA 3ESCA 3B7GA 4WQMA 2WWYA 3SHFA 4WI1A 3TQOA 1BG6A 4ETNA 4IGKA 2DKNA 3BH7A 5EJEA 1BCRA 1NW8A 1MJFA 1OZ0A 1F2VA 2VJBA 3H5LA 2R9VA 4LTNA 4PYQA 3UAGA 1DSSG 4FFRA 3VC7A 2YJNA 4CM9D 3N8KA 5EIXA 1XA4A 3LC0A 1AUVA 1ISSA 1N9GA 3AEZA 4WCFC 2AA3A 2EYUA 3KT6A 4NG4A 3WRXC 3MCAA 2J3QA 1WETA 3F9CA 1PFGA 4LYEA 1FSGA 3B36A 1TVKA 4IFIA 4LXIA 1KZ6A 1JU9A 1T0PA 4CIDA 4OXIA 1SD2A 3GAZA 3K9FC 2V03A 1L8LA 5EXXA 1XMSA 1E69A 4KFRA 3INRA 2GLUA 1V8DA 1E2IA 2A0UA 3I0ZA 1BS2A 2GTIA 3ZE2B 1YB1A 1XTPA 1QLJA 2X9QA 2RGWA 3TTWA 1ZSYA 5KI6A 1E94E 1EK5A 5BW5A 3P2OA 4DCSA 1Z6AA 5IK2D 3OZCA 3QE2A 4X8MA 3KELA 4RFSA 1ENZA 3RS3A 2AN9A 4KBGA 4NICA 1BWRA 1NM5C 5J5AA 3CUVA 3ROTA 4ARZA 3OQJA 4JLMA 1I3LA 4L74A 4PLZA 1ZMBA 5B1YA 1PK7A 5D1NA 1MB4A 2VDKB 1NUSA 4G0YA 4UM7A 5L4NA 1ZG3A 3COJA 2OQ2A 2IYSA 3OC6A 3SLRA 4G5YA 4KPEC 5KAPA 3T35A 4GQIA 2AG1A 3DAGA 3JCZA 1OSNA 2ORYA 2XPCA 1M6HA 3DMFA 5G4LA 2XUKA 4Q3CA 1KWKA 3SC2B 1V7PC 1RC8A 1EFDN 4JCCA 1MW8X 3O82A 2D5BA 3FNGA 2XQVA 3WLIA 3WGNA 1IXSB 1BJKA 1XZCA 3N8GA 4HJRA 3PGMA 4U7PB 1TM4E 4JS0A 1HTBA 5CEFA 1HG0A 4KQKA 4UU7A 3WJ1A 2JC3A 3PQDA 4FYHA 4L95C 5LQDA 2X42A 4Z9XA 1KJWA 9ATCA 2YWHA 1ZHOA 2G76A 3QVLA 1EP3B 1DIBA 3GPIA 3LP8A 1LF0A 4IJWA 1ULZA 2AG6A 4DVGA 1IY0A 4NONA 721PA 2NADA 3FYHA 5DEOA 4WKBA 3RE1A 3SDSA 1MO5A 3WB2A 3L4EA 4OL9A 5DRYA 1OZHA 3MF4A 3B1KA 5KBYA 1JBKA 4JSYA 1B41A 4N3CA 1ONSA 1HETA 3D3WB 1T4DA 4EJ0A 4MKGA 2GVZC 4P5DA 3V8RA 3LT5A 4L4UA 3HKDA 5LA6B 4C20A 2Z3ZA 4FLMA 3ZCUA 4LPSA 1CUWA 5BSFA 3UOGA 2CW5A 1YH3A 3H4VA 3L4BC 3O3OB 4BLRA 1KR5A 4YNBA 3CLTC 3BJEA 4OP2A 3BD7A 1RAHA 2G7ZA 2C2GA 3LQYA 1FDOA 2C8KA 2WJAA 4TRRA 4YAKA 1RAEA 1QH8A 2PMDA 4A36A 2JFYA 4H6VA 2JAUA 3SP1A 1NASA 1T8PA 3K96A 1DO8A 3ZZNA 4EENA 5JCZA 3GZTB 3PI6A 4XOUA 3SI7A 2GZ2A 5DI3A 4D9EA 4RIFA 4YDHB 3S55A 1N1DA 1XB2A 1L7PA 1EVYA 4FYKA 4EPXA 3NM6B 5A5VA 3BB1A 3P8ZA 5ITVA 2CNWA 2F7SA 2XWBF 4JUAA 2YV1A 1SU6A 3RUPA 1YGYA 3LQKA 3WMEA 1MH9A 2W2PA 2ZRDA 2X9GA 2IT1A 1VKJA 1I13A 2QS9A 3R0ZA 1N34B 1IZ8A 1X8KA 2B4YA 4GNRA 3II6X 3KQSA 3B8HA 2VRBA 4L2IB 1QF9A 1VA4A 4QPCA 3KR2A 3FYUA 5I48A 3TQHA 4FI3F 2VJMA 1KJYA 2PRJA 1KI7A 1ZVQA 2C2KA 1J70A 2SHKA 4KQXA 4LBWA 3EIOA 2OWEA 2QHXA 2GAFA 2AOWA 1SU7A 1JG1A 1W4CA 1GG8A 3GEIA 1H6AA 2QYHA 4BGIA 3OQOA 4GPBA 2QM3A 4IDHA 4NAHA 3SEAA 4YDRA 1TTQB 4C06A 1H2FA 4H1WA 4KWEA 1ZLYA 5K5EA 5KHLB 4DUZB 1ADFA 4RH3A 2CYBA 1Z28A 2VPIA 4JJAA 2NACA 1UC4B 4MW4A 4U2FA 2QDKA 1OVGA 3KM0A 1GZ7A 2BI4A 2A1UB 4FILA 4TWRA 3W7VA 1TM2A 3T7JA 4CW7A 1W5SA 1GFZA 1M2OA 4CG3A 3S2SA 1I3CA 3KKOA 3MPUA 4OBWA 4LDPA 4GKAA 3EPRA 4AF8A 1M1NA 2V5VA 2CNLA 3A2MA 5LP6C 1DC3A 4X91A 2B61A 1B8PA 1XVIA 4MOWA 4R1MA 5BN4A 2A9QA 1K7XB 1YI8A 3JQCA 2VC2B 4KACA 3L6CA 4FOTA 4O4JB 1EXNA 1G4AE 1OGJA 4EQZA 1T8TA 3AIIA 5AJVB 4OI1A 2VNJA 3M4XA 1NN3A 4FFBA 3AJ9A 2BEUA 4IJ6A 1Z5VA 2P7IA 2W6PA 4ND1A 3WOVA 2KYRA 2GRJA 2ZYDA 3ED1A 1NUTA 3PRHA 4M9XA 1EM6A 2C4VA 3R5SA 3HKEB 1Q11A 5LZ4A 1HDIA 4CDNA 3WIOA 4QVIA 1W7AA 2H3EA 3NKFA 4NR0A 621PA 4UJ5A 1IY2A 2VUSA 1QH1A 3DEKA 1V4BA 4YRSA 5IDXA 1FDSA 5LQSA 1R0BA 4A92A 5GV8A 1DP4A 1YQ9A 2IHUA 3P0EA 1W4AA 3VVBA 1I4OA 3P9NA 4QBFA 4TTTS 3KWMA 3K6KA 5IBQA 1Q20A 3V1UA 2WMOB 3FMFA 2CFTA 2FHPA 1BYIA 3B52X 4X8HA 5K2OA 1RPJA 5COBA 3AERB 3M6UA 2V96A 3F71A 2QMYA 1E77A 2GBPA 2M6KA 4C78A 3BWYA 2P5UA 2ZE6A 1LK0A 4A0HA 4EY6A 5IAAA 1W36B 5J4KA 1TVCA 3F3YA 1O5OA 5I51A 1Z12A 2XWPA 3I73A 2CVFA 2Q5LA 4I4TA 1Y6RA 1B74A 1SKYE 3MJSA 4X95A 1QQ6A 2SNIE 3ZWVA 4DR5B 3FFTA 1J99A 1ONBA 4HB2A 4HWPA 1XD8A 2HNKA 1CHDA 2B20A 2XMSA 4ROTA 2WC1A 5I7OA 2GARA 5FBQB 1QH0A 4RMNA 1RQ7A 3TX6A 4F3CA 2P11A 5FIUA 2QN8A 4I55A 3K8YA 2OV2A 1Z3IX 4Z4QA 3A04A 2QYOA 1JZSA 2Z58A 4BHTA 4QPNA 2HNBA 3EVZA 2WIDA 3G49A 4N5IX 4GDFA 1XMVA 1L4HA 4NMMA 1N78A 4E3WA 2ZXEA 2POCA 2LR0A 4QRHA 1GYPA 3VSAA 3U7FB 4ICIA 1KJIA 3NM5A 3NTLA 3OX1A 3VSDA 1W59A 1VCMA 2J1LA 1FNCA 4WBNB 2VBCA 1ZDMA 3DLAA 3IJ5A 3IUSA 5AHKA 2QX8A 4F6RB 1T5BA 4INAA 1UKZA 1CQPA 2GT1A 3PPVA 4ASUD 4CT4B 4YUYA 3WKCA 3PDIB 3KOMA 2ZEJA 3R4CA 2B8NA 1C0KA 4G5XA 2YJ3A 4KK3A 4P5EA 4WT7A 4D5GA 4JEMA 4XOIA 1R5NA 4F8YA 1G8KA 1YWGO 4XUDA 1ZL0A 1ATIA 2KHZA 3N07A 3K1TA 2DWPA 5JZVA 1I4TD 3U6BA 2YW9A 1P9NA 3BJMA 3JYOA 2CMHA 1U28A 4C3UA 2XR1A 1K08A 4Q03A 5HP4A 3M8KA 1Y1SA 1W9MA 2V7WA 3MQ2A 4G1FA 5C4GB 3R9WA 5SYNA 1HKUA 1U7HA 3DV9A 5FORA 4J07A 2GSDA 4I9UA 1SCDA 2YNMD 3IXQA 3BIWA 3ETNA 1ZD3A 4TRMA 4X61A 5ILGA 5CDFA 3UC5A 4CMIA 1R0CA 3ET4A 5JRZA 1BX1A 2ALJA 1ND6A 3UAOA 3CM0A 2HRZA 2A0YA 4A73A 5CFMA 4XASA 1YD7A 4GUAA 2YVUA 5LWHA 3IUNA 4DSUA 4RTJA 4IOMA 2WMYA 5JXWA 3M6WA 1RHRA 4EQ6A 1RFGE 4G5RA 1IB0A 3KZNA 4D9CA 2CBXA 4G0VA 1Y8QB 4N3BA 3R9KA 1QG6A 3H42B 1PGQA 4X64B 5A0TA 3BXOA 3OAAD 1T8WA 1WRBA 4EHHA 3I1IA 3LU1A 1G5FA 1DIOB 2GRAA 3ORHA 521PA 1Z0SA 1Y9ZA 4P53A 4RU1A 4BQOA 4L9AA 3A1WA 2MU1A 1TJ5A 4PNZA 1AH2A 3KTAB 2VAPA 1U7XA 1IONA 2UU9B 4FC7A 4CM7A 3ZJ4A 1HUQA 2PKWA 4FR0A 4D4KA 3OOHA 3VV3A 3PJFA 1K4MA 2JGAA 2QRHA 4CQMD 4ZFNA 3W3ZB 1A7JA 4LBYA 1ZUIA 2A1IA 1IQ0A 4MGIR 1RW4A 4HD8A 4C1BA 1QOPB 4UCWA 3ANXA 6CHYA 5IN4A 4LVOA 1GP2A 1P5HA 3IE2A 2PRYA 3TMAA 5TY0A 4G24A 4S04A 4X6LA 4ZZ2A 4H3HB 5EQFA 4BO3A 2HK9A 4WAUA 3OZ7A 4IBOA 3UMVA 1AY0A 1VPDA 3ASUA 3K05A 1KJ9A 3TIGA 1SQFA 5KNDA 2H2DA 3I28A 3DHVA 1W2WB 4OQEA 4G2NA 4X3CA 1WMFA 3QU5A 2QN7A 3AC0A 3CE6A 3MRTA 1N8KA 4JYCA 1M6VA 3LCUA 1SKBA 2OWDA 1HE4A 2WJ4A 1C3OA 2X0EA 1TKCA 1N1MA 1ZIDA 3OI7A 3C45A 4JDPA 3IOCA 1QXSA 2OCIA 4H1UA 4KR0A 5T41A 5JEDA 3TQQA 1XMQB 4UNQA 3EARA 4R1OA 3EY9A 3OJEA 4QTYA 2UYYA 2XVZA 3JTEA 1FTGA 2R8ZA 2GZSA 4E03A 4LZOA 1WZ2A 1G42A 1USGA 1QIHA 1TVMA 1WUHS 1T9BA 1DKMA 2R6DA 3DWIA 4NG5A 4OY3A 5GJCA 2HRDA 4BY9E 1YSCA 1XWFA 2BEKA 1MKYA 2VDOB 4Q3EA 5AHRA 1S3FA 2UKDA 2AIRA 1FXUA 2Q1SA 3OE7A 3V33A 4TWAA 2HUPA 4ACBA 1ZR2A 1EUYA 1C4XA 2GVNA 3RS9A 2QXTA 3PQEA 3AZPA 3WO0A 7ABPA 1VJGA 1Z83A 3D3KA 1G6KA 4J0IA 4CMJA 2CDAA 2F48A 4KDFA 2XGSA 2WIJA 3I34X 3GA0A 3HDGA 4G1VA 2ZRAA 4MLZA 4RE6A 4YRCA 1SCUB 3DLCA 3HA3A 3QLUC 1I6KA 4RQAA 5LDGA 5AXBA 3WWZA 5GIOE 1NT2A 2DWUA 2G77B 2MOKA 3FCSB 3NHSA 4Y18A 5D01A 4ARVA 2G6TA 5B4TA 3KQKA 2R751 3QYJA 4C4AA 1C8BA 2VKQA 1JDNA 2HCBA 1ZK1A 4PE5B 3USCS 4O2BB 5L3RA 3RTCA 1ZVJA 3GFQA 1VXOA 2WU0A 3I23A 5JIBA 4BO4A 1DBVO 2C7RA 1E3TA 3ZGZA 1EA7A 1TJYA 2GBLC 1M1YE 3VO1A 1L5HB 3TK1A 3ADBA 5A03A 1HDOA 1BU5A 4MYUA 1IG0A 2WJ6A 3CKKA 3LC7O 5AOBA 5HIKA 3PJGA 3BFKA 5G40A 4OEHA 1PKEA 1Z8NA 2H4JA 5SZIA 3SJCA 2A67A 4OQQA 4OUKX 2VQEB 5KQMA 2CGEA 3K2QA 2FQWA 1QTRA 1EWTA 1YBHA 3KZ1E 1HSZA 2FN7A 3HMQA 4L07A 5J59A 1OKKA 3N7AA 1E0AA 3QU9A 5C81A 3GG9A 3KCQA 3P2EA 4Z99A 2W2KB 2W37A 4ZYUA 5IJ0A 2CSXA 2B92A 4DIBA 2YUTA 3GP8A 3N70A 1UP7A 4BEJA 1AQJA 2GTPA 2HIAA 1XROA 2JJQA 2WWIA 3HBJA 2Q9UA 5ICEA 4I9NA 1SXPA 1OAKA 2BFWA 4R5HA 2IOQA 1GQRA 4RLHA 3UXYA 1P5ZB 2NNWB 4WKPA 1E9EA 1CUCA 2JGIA 4KRGA 3JWEA 4Q9DA 4QGHA 1H0RA 1PT5A 4X54A 3ZK8A 6PFKA 1JLHA 1T9KA 4GP9A 1Z4LA 4QGGA 3D8TA 2Y66A 4DMMA 1RM5A 3CEPB 2Z2XA 4FFPA 4XFJA 2CLDX 3CWCA 4RPGA 3GD5A 3G23A 3QEOA 2J9ZB 4Y0VA 4AROA 1NBMD 1Y4DE 2Q7OE 5LLTA 2WM3A 2IRWA 3DO6A 2GESA 1FOEB 5E6UA 1U8TA 1XZGA 3DTVB 5AMXA 4OQ4A 1RZRA 1CDEA 1MB0A 4O63O 3U26A 4DABA 1BH6A 2PXCA 1KY2A 3C8DA 4G4SP 1KYWA 1TJ3A 3T61A 4BVKA 2Q6TA 4X24A 2N9UA 5DBFA 5I47A 3HJFA 1N0WA 3BH0A 3C8ZA 3IELA 2QWXA 1YUMA 4Z4EA 2W2OA 1X7WA 3BN3A 4QDZA 1RXWA 1DAHA 1DAPA 4AF6A 1RLOA 3AVVA 4HAOA 3UUFA 4UM5A 3UXEA 4DLUA 3K0AB 4XEUA 1SIWA 1K86A 1M0WA 3G8BA 3EDRA 3KYIB 2QU8A 5AVVA 3O4IA 3QWBA 4UPEA 2FWJA 1UBGA 2I8CA 3L8HA 3TYXA 4YXFA 5EUQB 4ZAZA 1UPCA 1CFJA 3UJBA 4GOJA 1E7RA 3VJKA 1GTG1 3PJEA 3ECSA 3WL5A 1BCSB 1K6IA 2H08A 2XQIA 1VYTA 1X92A 3D0QA 5I4KA 2PLFA 1LI5A 3QNWA 4KPGA 1AGYA 1V37A 2EWVA 2IUFA 3Q7PA 4V0QA 5DO9A 5TPWA 3O2JA 1SU4A 2G5PA 3GWGA 4FDLA 3VAYA 2BDTA 4X1YA 4COKA 4LRUA 4YMVA 3OQNA 2QMQA 2DOKA 5E3IA 2I3ZA 4UHJA 4DAOA 3UK0A 3PR1A 3AOGA 4BYGA 4ECEA 4M0DA 1JL3A 1LB1B 2G80A 4MQLA 2KQUA 3BRWD 5L7YA 5EZSA 5I7WA 4RJJA 4D82A 4HUTA 3WNCA 3WKBA 4BBJA 2G5TA 1N4DA 1BXGA 1L4NA 1LXCA 2JLCA 2OV4A 4HDNA 4QOHA 4R7ZA 5C1PA 4YUXA 4MW0A 2FDRA 5AUNB 4GMKA 3E05A 2OV6A 1NBEA 3QMVA 4N3AA 3C41J 3E7PA 4DLPA 3KLNA 1WHTA 2IEAA 3UV3A 2VNIA 1U3CA 4PCAA 4F84A 1RQGA 5JCJD 1SXJC 5CU7A 3JZMA 1G5RA 4BVGA 5KYUA 2KBFA 4NE9A 1E3WA 1NSTA 4TXJA 5H9VA 4WZAE 3TPZA 3WP0A 3I2KA 5AXCA 5B2EA 4JYAB 1N5MA 1UQTA 1FF9A 4NFHA 1P60A 3H5RA 4NQRA 3H05A 2AN1A 3R3YA 3SC4A 1EINA 2ESRA 4F96A 4XFKA 4RCYA 3R5KA 1ZOPA 4I8IA 4KQWA 2CDNA 2VEDA 1Z0IA 4Z4CA 5IVIA 4NCJA 2XMZA 3PUJA 1N2CE 3GRZA 3I76A 3B9QA 4NENA 2NXNA 4A2PA 3FTEA 2WWRA 2LGJA 5EXEA 2NPOA 4ZI2A 1NQ5A 1JYFA 2H4FA 2XA9A 4URHA 1RXEA 1LNSA 1FRQA 5ULLA 2PPVA 2ZBQA 3ZWMA 4I9HA 4JJIA 1L4FA 2QI9F 2V7EA 4A8PA 4XSVA 1KYQA 4C43A 1BMFD 2WYWA 4I50B 4ZZ0A 1G21B 2YXDA 1FP7A 4LYJA 2VT6A 2GN4A 4FEGA 2IP2A 4DIUA 1GGEA 1BEZA 3P0HA 1GRNA 4PC1A 3M81A 5AHWA 5ERGB 4YRIA 4CL2A 1SULA 4QDUA 4C6TB 3AFOA 3FNQA 1JAHA 2O06A 4EFDA 5IFLA 2CVPA 4LXYA 5BXYA 4UUMA 1NAHA 4RTKA 1QO7A 1SK9A 3EA0A 2NWQA 4RTPA 2ZREA 1X8XA 3L8CA 4IV0A 5AVWA 1GITA 2CNNA 3GWZA 3BKXA 5F3WB 3CUSA 1T36B 1TB4A 1NRIA 2HJRA 1RIFA 2R86A 1YRQA 1T4CA 4Q0MA 4TV9F 3PNQA 5E1MA 5TRTA 5EE0A 2F8MA 1QU2A 3TAHA 1HTWA 1GKUB 2B4AA 1X2EA 1XWIA 2AWNA 2ZE7A 4M87A 2OESA 1NLUA 2YXBA 2WJWA 4R7GA 1BW9B 3U4QB 4RF4A 3ABQB 4D9HA 2VSXA 4PO3X 4DSZA 4AY2A 4YN3A 1C1YA 2VAMA 3DP9A 2IVFA 2RBGA 2ZLBA 5HFJA 1D4AA 1K4KA 2Q6KA 3CS3A 1SKQA 3EJWA 3OY2A 3SYRA 4BOYA 3HJUA 3CZRA 4W1PA 1NQOA 2JAHA 2XYPA 1PR1A 1PYOA 4PX9A 2FW6A 2G3YA 5HM8A 3ENVA 4BX2A 5I8ZA 3SQXA 3L5KA 1PSWA 3O3NB 1JZTA 3ODPA 4IIDA 4Y30A 3WRYA 3TFOA 1TMOA 4G0QA 3G3EA 1J1UA 3M6MD 3CU5A 1G6OA 2ICAA 4PBSA 5HCNA 5HA5A 3LBHA 1RDFA 1E2GA 2Z5LA 4B3JA 4TS1A 4JVLA 3T5MA 3ZHCA 3D3EA 1G3QA 5FTKA 4C4SA 1SH7A 3U3OA 3RWBA 1ZUD1 2CK3D 3PHGA 1LJUA 1DDIA 1PR0A 1L4KA 1VL6A 3DBHB 5JZSA 1Z4OA 5E6SA 4QJ5A 1ECJA 3T7EA 4D8YA 2E85A 3DNPA 3MCVA 4JELA 2ZI4A 4DNFA 2RHOA 3CRNA 4WTOA 4ESVA 1PL8A 3T3DA 1DJMA 4P7FA 3RBXA 2CFSA 3P9SA 2IPOA 5ANRB 3TH5A 4EJSB 4OKIA 3FVRA 2UYCA 2CT8A 3BDIA 1H2XA 4NYIQ 1A9TA 4W1QA 5D8DA 3D5EA 3GLIE 4PF1A 1X1QA 2V9ZA 4EB6B 1HEYA 4ENUA 4CUJA 5B64A 1CY6A 1BHSA 3EYWA 4R8VA 1KY4A 4TMKA 3QBJA 3UJNA 1O4WA 3OPYA 5AJZA 2YFQA 3JYNA 2VBGA 1GPDG 3UA3A 3TCXB 1KNQA 3RROA 1SBTA 5EYPB 3E7XA 2O0KA 4F4UA 1RAAA 4MDEA 3ONFA 5CX1A 1EE1A 1CJTC 5AVZA 4B3HA 1P1IA 3Q5EA 3PNKA 1INLA 2YL2A 3ICWA 1GYRA 1ZNQO 4G3XA 3EQZA 2D3TA 4WLNA 1ESCA 2ZS9A 3BTSA 4XX0B 4RTLA 3M6VA 5JJIA 4NCKA 1HGXA 4N4AA 3W6ZA 1WS6A 3MUEA 4F3RA 4K9LA 3L4JA 4B4VA 3NONA 4PCVA 4Y2JA 1JAYA 4AY4A 5ELLA 2F1HA 1LC3A 2O3JA 2PS9A 4BWYA 4B84A 1NIJA 2VI5A 1YL5A 3V48A 2R79A 5AW0A 3UJ8A 1CC1S 3KOYA 3P0RA 4RHEA 1T26A 4ZYLA 3ZGOA 221PA 1NYLA 4YP6A 1G20A 5BVHA 3BRCA 4IF6A 1JSRA 4IGIA 1L3BA 2D2EA 2BGTA 2JI7A 4M1MA 3L07A 4NHEA 5F98A 2PWYA 1KKUA 1GUZA 3SN6A 2ILTA 5HFAA 4BFLA 3DO5A 1QK5A 4DHWA 3PPXA 1FDWA 1GRVA 1X1AA 2WHPA 1PVVA 1A1SA 1A9SA 1SUAA 2B1JA 3PFIA 4LSZA 2HR1A 2Y77A 3P32A 4HB0A 1CTQA 2EFYA 4JYZA 1GZ5A 1RRFA 4OXXA 1KS9A 5EWMB 3WWYA 3E8XA 2RHWA 3W0LB 4UVDA 1ZM7A 2QLLA 2QENA 3FFBA 1DOAA 3CGGA 5C8YF 5JR3A 2FI1A 5K0SA 4WESB 1HH4A 2O0JA 1O97D 1XTIA 3CUYA