2I3AA

Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
344
structure length
344
Chain Sequence
ATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHPHLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAVWERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAVTVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFTPVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAHIAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of N-acetyl-gamma-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP(+).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords N-acetyl-gamma-glutamyl-phosphate reductase
total genus 104
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2i3aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i3aA01
2PD4A 1ID1A 1ZUD1 1DC5A 2HK9A 3DDNA 3NT5A 4AJEA 1DC4A 4N5MA 4GVLA 3IKTA 2H6EA 3B1FA 3DBRB 1XLTA 1PEDA 5IFLA 2Z1NA 1H93A 1PL7A 4WCFC 4XQEA 1Y8RB 1C3VA 1EVYA 4J43A 3WFIA 1HDZA 3IMFA 1TI7A 3U5TA 3GNSA 1ZJZA 5L4LA 2YHIB 3WLEA 1WMAA 1QYVA 2IXAA 3QE3A 3WQRA 3VH1A 3IJPA 3Q3CA 4N18A 1PWXA 5GZ3A 4MDHA 3ZU5A 3NTQA 4BNHA 4E5KA 4CLRA 1BRMA 2FPPA 3BTUA 2GD1O 7ADHA 3MTJA 1MC4A 2X0RA 4M49A 1BDBA 1K3TA 3JQFC 4BNIA 2CDCA 1XQ1A 4PG5A 3O4RA 1ZMTA 2JFFA 4A27A 2Q99A 1X7HA 1SO8A 4NG5A 4E2WA 2RBEA 1ISFA 1PJBA 1PTJA 4NFYA 3RI3A 1I32A 2NTVA 4Z3KA 2WE8A 1PGQA 4EDFA 1QMGA 4X54A 4AJJA 1NHWA 5L95A 2VWHA 5CFZA 2B35A 1ZZEA 2DM6A 4E21A 2HK7A 2PH3A 4WCFA 2Z95A 4DQVA 3W6UA 5CEFA 3O8QA 1UXKA 2C5AA 1R0KA 1RM5A 4K9DA 1ZEJA 3G79A 3GUYA 1KEPA 3VZSA 1B16A 1ZK3A 1C1DA 3A06A 3O03A 1EK5A 4U0JA 2QRKA 3HADA 3H3JA 4BKUA 2C0CA 1VSUA 4Y6PA 1QV6A 1ADFA 3OSUA 4OSOA 2RHRA 1R12A 4FB5A 5DBGA 3OEYA 4CV3A 1ADCA 5F5LA 4HNGA 1I0ZA 5COBA 3CZRA 1G1AA 3KOUA 1ZNQO 2HRBA 3AUAA 3EMKA 3GVCA 5HA5A 1ZK0A 3VKUA 2OFPA 5JY6A 1QKIA 2HK8A 2PLAA 1BMDA 4RDHA 5L4NA 3OICA 1YRLA 4CLOA 2NACA 3PHGA 2P9CA 1HE4A 4FSHA 1O9BA 1B0AA 1ENOA 1Z45A 2AE2A 2YHUA 3NDIA 1QLHA 2HKIA 2ZTVA 3L77A 2Y1EA 2IXBA 4LSMA 4ND1A 1ZIDA 2Y1FA 3ADOA 4QTZA 5ICSA 1JDJA 4ZHSA 4JROA 1I10A 3L9XA 4IXTA 4B8WA 4CMCA 1B14A 4O6VA 2BGLA 4RPHA 5I9LA 1ISGA 2VOEA 4R5HA 4HFMA 2YV2A 3RU7A 3TZ6A 3OHSX 2AQ8A 3K2EA 5KOIA 5L45A 1T1RA 1ZXBA 4R51A 4H15A 2J5KA 3JQ6A 1R6DA 3QVWA 1TB4A 4YDRA 3V8BA 4HKTA 4J1TA 3KEQA 4GAEA 5ILGA 3RIHA 4BUCA 4OL9A 1SB9A 4YJFA 5FYDA 1J6UA 3JQ7B 3LK7A 1TT5A 4I08A 4QECA 1GY8A 4IQ0A 1LDNA 4JIGA 1SPXA 4BQRA 1WLYA 1NASA 2WDZA 1VJTA 1LSJA 2HRZA 2QHXA 4P38A 1TLTA 1EQUA 4UVGA 4R1UA 4ROSA 2ZQYA 2IDZA 3F47A 4NDNE 1GUYA 1X14A 2FP4A 1ZBQA 3DBRA 1V3TA 3KBOA 4FPXA 4RVUA 2ZTLA 4ALLA 3LC1O 2O3UA 3BMNA 2IZZA 3R3SA 4ZN6A 4ALMA 1E92A 1E5LA 3PYLA 5G4KA 1DB3A 4NBTA 4XB2A 5IN4A 3O9ZA 2FMUA 2IE0A 2NTNA 3ST7A 4BB5A 3PRJA 4CM5A 3NT2A 5EL0A 2FPIA 1DC6A 4UUPA 5GY7A 3LDHA 4L73A 1T2DA 3GEMA 1R0LA 1U3TA 3RSHA 3UW3A 4GH5A 4GKVA 4RF4A 2VZ8A 3DEYX 4W99A 4NH4A 2QZZA 2VQ3A 3FPLA 2W98A 3C7DB 3PZRA 2Y66A 3OJLA 1DIHA 3RAJA 1V3UA 1MFPA 2AQKA 3WS7A 1K6JA 2X5OA 4M87A 1I2BA 4ZJUA 4MIEA 1UJMA 4ZICA 1QR6A 3DMTC 4KQWA 4CQLA 3GNTA 1Y1PA 3AI3A 5G0UA 3UH1A 1ISHA 2Q2VA 5U9CA 1UDAA 4OJNA 1PSDA 1KEVA 2Q2WA 4YVFA 1GYPA 4FDAA 4RVDA 4HWKA 4XDYA 1EE2A 4OQZA 3TWOA 2I65A 2DU8A 3JD1A 3I6IA 2V7PA 1XSEA 4KWHA 1KBZA 3K30A 3C1TA 3ON5A 5LDGA 1CRWG 2B37A 3V1TC 4AJHA 4NK5A 8LDHA 3GVXA 3W8FA 3ONDA 2VYVA 3H2ZA 2HSDA 4A5OA 2B4RO 4GLLA 3CE6A 4WJZA 2BD0A 3A1NA 1KVRA 4IS2A 4E30A 1U1IA 4L4XA 4XGKA 5JO0A 3QQPA 4EUEA 3GRKA 4HXYA 2V6BA 4Q3CA 1FDWA 1QRRA 1WPQA 2YFQA 1YO6A 1N92A 2VHXA 4QT0A 3TF5A 4BIIA 4J3FA 3JD4A 1PQWA 2FY8A 2Q50A 2H9IA 2XPCA 3DFUA 2YY7A 4R68A 2OUIA 3GN2A 2BELA 3KHUA 3S2GA 4JCOA 5C3MA 1JVBA 2Y67A 4EW6A 3KSDO 5CEEA 2GN4A 3WIDA 3QJ5A 2Q22A 2A4KA 3GF4A 3WGTA 4HADA 1X7GA 2X9GA 4U7WA 3PHJA 3H4VA 1YBMA 3VTFA 3U4IA 5CG2A 3JQEA 4JBHA 1XCBA 2OP1A 3C24A 1I33A 3VKVA 1O5IA 2H63A 3DBLA 4RPLA 3B1KA 2ET6A 3O26A 2GPTA 3WJAA 2F00A 3E18A 4Y6SA 5CPBA 3QA9A 5I7FA 2X7HA 1WP4A 4BNYA 5CDTA 2EJWA 2HDHA 3ZCXA 1RM0A 4URFA 2YJZA 4CLRB 3RUDA 1EBFA 3F5QA 1NQ5A 2X5KO 4F46A 3NUGA 4UAGA 1F8FA 3ZDFA 3W4JA 1ULUA 4FQ8A 1LSUA 4MVJH 4UEJA 4B4VA 1P31A 1I36A 3IKVA 3DBVO 3UGKA 1UXIA 3D64A 4AJNA 1NVGA 1UAYA 1D7OA 5FI5A 4BVAA 5J23A 2UAGA 4MVJM 1E3WA 3ZWCA 2V65A 4DLAA 4M8SA 1PZHA 3F9IA 1XU9A 3AI1A 3LLVA 3NX4A 3NJ4A 1IZ0A 3WYEA 1F8GA 1IUKA 2JAPA 5DDIP 3LSYA 3JQAB 2W2LA 5I9MA 5DCWA 3TN7A 4O59O 3H5RA 4RDIA 2VHVA 4DPLA 2XOXA 5A9SB 1SC6A 2DC1A 2C20A 2NWQA 1PGOA 1WZIA 1Q0LA 4MVJF 2EF1A 4NIMA 4P4LA 1GL3A 5JYDA 4MVJP 1GEGA 3MJEA 5JNLA 3DHYA 3HB5X 5KJFA 1X15A 4D3FA 2D4AA 1HZJA 2JCYA 4Z3DA 5EJ2A 3BMQB 4BMNA 2EG9A 4DVJA 4GQAA 4CUKA 2W90A 1UDBA 2AG5A 3DC2A 1SNYA 1Q0QA 3STHA 1UP7A 2GN6A 1J4AA 2EW2A 3MOIA 1VE9A 3QLJA 5AXBA 2VHZA 2OOSA 5IZCC 4NFHA 5ER6A 2FR0A 2G1UA 1L1FA 4UEKA 1LLCA 3TOXA 3M2TA 1OOEA 4J4TA 3GPDG 3PJGA 1EUZA 3F46A 4OXNA 2ZJ0A 1LLUA 4B3JA 4P4GA 4L75A 2P4HX 5DBIA 2NVUB 1DO8A 5DNAA 1PS0A 3TZCA 1H5QA 4CR8A 3GY0A 5CEJA 4JJFA 1A7AA 4O1MA 1PJ3A 1MXFA 1XEAA 1W73A 5CG1A 1HDCA 3HFGA 3N58A 2Q1WA 2NV6A 3RC1A 3WYCA 1IYZA 4NBUA 3AY7A 4GGPA 1DHRA 1GU7A 5F1OA 2ZYAA 5G0WA 4D0SA 5GMOA 3QW2A 3V1YA 3Q1LA 4Q3NA 1GQ2A 2CDAA 4J2OA 4MKRA 4NU5A 3P19A 2EEZA 1QYWA 4UREA 1U8XX 2CVQA 3DOOA 3ZU3A 4G81A 4D3SA 3FBTA 1PIWA 2GN8A 3RFXA 1NVMB 1EFKA 4MO2A 5ENDA 1Z7BA 1E1MA 1O95A 4TRJA 1QYXA 1LDYA 2UDPA 3W6ZA 1VL8A 2X8LA 5TJ9A 3ADPA 3AU9A 4NU6A 5FI3A 3I6QA 4NJOA 1GQQA 2PFGA 1YL5A 2ZYGA 1BTOA 2NUAA 2PH5A 4CR7A 4FOOA 3H9QA 3VHRA 4YJDA 1NPYA 2H5LA 3GGPA 1GADO 3CIFA 3WDSA 2D59A 1YXMA 1AGNA 4XRGA 4PGFA 4EJ6A 3WBFA 1EUDA 3C8MA 5TGDA 2RHCA 3ZHYA 1PJCA 4MINA 4GBJA 2DTEA 2BMAA 3SLKA 3VH3A 1ENPA 5G4LA 2EKQA 4B7CA 4PLCA 1UZLA 3IDSA 3WFJA 3GFBA 4Q39A 3GAFA 1BSVA 2Q1SA 3Q6IA 1N9GA 3O38A 3RKRA 3F4LA 5GZ1A 1EZ4A 4H7PA 1BXGB 4GVXA 2QYSA 2D3TA 5AOVA 5LC1A 3VAZA 1PJLA 1I3NA 4CMAA 2YFHA 4ZD6A 4XQCA 3H65A 1HLDA 3PI7A 5U1PA 5TLSA 4KOAA 4KWIA 3UN1A 2ILTA 4K26A 4YT4A 1B3RA 3GT0A 3ETGA 4CLHA 2Y1DA 4BO8A 1T2CA 5COAA 2OZPA 4WK6A 3AM4A 4BB6A 3I4CA 4EBFA 1DFHA 2OORA 4QQRA 3AU8A 1MFZA 1M67A 3F3SA 2FZWA 2ZATA 1E6UA 3ZV3A 5BSFA 5EQDA 4OM8A 1T25A 3E5RA 5J9GA 1ZK2A 3DOJA 3JQCA 4RF5A 3CINA 1B8PA 1FXSA 4D41A 1EK6A 1OC2A 5DF1A 4QFDA 4TKLA 2O7QA 2O50A 1MG5A 4Q3EA 3TPCA 3ZWMA 3E9MA 4KDEA 4D0RA 1MP0A 4B4UA 5EERA 5T8KC 1CDOA 1A4UA 1R4MB 4JX8A 3DHEA 3LQFA 4YAIA 2DKNA 3AOEC 3BMCB 4EJMA 3MZ0A 4H3VA 1L7EA 3HDYA 5KNLA 4H16A 4JBGA 1PJ2A 4XZ3A 3EVNA 1NFQA 4YR9A 3Q9NA 2B5VA 1KVUA 1U3UA 1NR1A 4NHEA 4F6CA 4R4JA 2EP5A 2BLLA 1RWBA 2O3RA 5I8WA 4A7PA 3NKLA 4GKBA 1JU9A 2ZB7A 3WWZA 1SCUA 1CQJA 4O0LA 2AMFA 4BNZA 3QVOA 1NPDA 2AXQA 4PLYA 1LRKA 5JAMA 1AN9A 1G0NA 2VRCA 3KYDA 4PLZA 3IJRA 4YEDA 3FWZA 4YTEA 4MKZA 2YUTA 1DAOA 3U3XA 1YGYA 1ARZA 3UCEA 3C3XA 1B3BA 4BO5A 3WTCA 3CXRA 4R41A 1JLLA 4YBZA 1SBYA 2X9NA 5A3VA 4Z0HO 3DZFA 3NJ8A 2VUTA 1H6CA 3RASA 3KSZO 4E3ZA 3INGA 5JCJA 5B4UA 3C85A 2NLOA 4YRDA 2O23A 1GZ4A 2ZKLA 3I3OA 3FHLA 3I5MA 3R6DA 4Q3AA 3ZWXA 5ENVA 1ONNA 1UR5A 2JKVA 3K2BA 4LCJA 4R69A 4YRAA 3NV9A 2Q46A 1PZEA 2PZJA 3S2EA 1I8TA 3OA0A 4GWGA 4G5HA 5DOZA 3AOGA 1MV8A 3K73O 4EJ0A 4IGFA 3BAZA 3FTNA 4TZTA 1UXJA 2A9FA 4RF3A 3ZNPA 2VYNA 1KC3A 3ROQA 4XQ9A 3UCFA 2OHXA 1V3VA 3UFXA 3WTBA 1BXZA 3FCOA 4BL5A 1LUAA 3L6DA 1HE3A 3A14A 5G0VA 4TWRA 3JSAA 4B7UA 2QW8A 4BNVA 2CY0A 1O89A 2G5CA 4MOWA 4DA9A 3AUTA 4IJWA 3WGIA 2EP7A 3QVSA 2FPGA 4R9RA 1WAMA 2I9PA 4EEXA 1P0FA 5L7TA 1U28A 3GA0A 3SC4A 3HZZA 1CETA 4OSPA 1R37A 1X0VA 5TF4A 4BNNA 1Y8RA 2O4UX 2I99A 5TT1A 3QY9A 2PY6A 1Y81A 2WMDA 3OMLA 3ZWYA 4CQLB 4PG6A 1YOVA 4J4BA 2J3IA 3ETDA 3LU1A 1NWCA 3D4OA 1ORRA 4FFPA 2EXXA 2FZEA 3GH3A 1SEPA 5L51A 1HDRA 2JD1A 3PGXA 1I30A 3VOSA 3ZU2A 4CM1A 3BXXA 5KJCA 5MGBA 2P68A 4MP3A 2BHLA 4L9RA 3BHJA 3H2SA 4BO7A 4PLVA 1SEVA 3GZ4A 2JCVA 1J0XO 1V6AA 1VI2A 1H6BA 1VPDA 4TQGA 3IQDB 1GZ3A 3WQQA 1Y5RA 2V6GA 5L3ZA 2RIRA 4LN1A 5BSHA 3HDJA 4XR4A 5DCUA 1KIFA 4I5GA 4AJ1A 2LDXA 2NTJA 4I5FA 4LVUA 4WPGA 2X23A 5EQFA 4CM9A 3G1TA 5C5IA 3TFOA 5IDXA 2NQTA 4W82A 5JAQA 1WWKA 3ZN2A 1R4MA 2QIOA 3LF2A 2IODA 5I7EA 1PJSA 1YS4A 3KVOA 3HB4X 4KDFA 3PJFA 4EI2A 4QX6A 1J5PA 4LW8A 4CLDA 3V1UA 2ZTUA 3W8DA 4E31A 4J16A 3CUKA 3EK2A 1CYDA 3A4VA 4FR5A 2W4QA 1E3SA 3ENNA 4E0BA 1VL6A 1DEHA 4FFLA 5L53A 3WJ7A 5IXYA 2EGHA 1IB6A 4FC7A 4UUMA 4ZVVA 2CFCA 4JBIA 3BMQA 4YYZA 4L76A 1G6KA 3QIVA 3ITKA 5BT9A 3BZUA 3WGYA 1NR7A 5THQA 4J1SA 1YJ8A 3UKOA 2JFHA 3PHLA 1K0UA 4W9NA 2WYWA 1E77A 1X13A 5BNTA 1UH5A 3JD3A 3JYQA 4EUHA 2EV9A 2PGLA 4XD2A 5KVSA 4FJ2A 4OIMA 4YJHB 1HDGO 4BKPA 3X2FA 1I2CA 2QRJA 4L4RA 1YVEI 4L8VA 2O2SA 4JJGA 4MVJA 1IHXA 3HUDA 3VTZA 3IS3A 4FCCA 1NFRA 1BXGA 2AEFA 2FSSA 4JK3A 5T67A 1BGVA 5A3JA 4WOJA 4BNMA 3Q9UA 2DTDA 2Z5LA 2YHIA 1QXSA 4YRBA 3NDJA 3GMDA 1CWUA 2IZ1A 2WD7A 2DPGA 2NSDA 3TOZA 3TFQA 1IHYA 4FN4A 3KLPX 4JQCA 4KTTE 4HV4A 4R3NA 1U4SA 4WECA 2UYYA 3NEPX 2A94A 2HQ1A 3V2UA 4NMHA 1VLLA 1ZVMA 1WXDA 1H9AA 3HN7A 4IZHA 5TRTA 1NVTA 3JD2A 2CZCA 5HS6A 2HMVA 5HTOA 5HWSA 2Z1MA 4B8ZA 5K6AA 3QVXA 3DTTA 1NAIA 3OJEA 2X4GA 4J4HA 4E13A 5THKA 1ZH8A 3EW7A 3JYPA 4XR9A 3WB9A 5MDHA 4EUFA 2PKQO 4XB1A 1GFSA 2D5AA 1NPTO 1LRLA 3KYCA 3PQFA 1Z74A 2DFVA 4Y98A 2NU6A 4CMBA 5KIAA 1N1GA 3P5SA 3U62A 3ZV5A 2AE1A 3WGGA 4TRRA 4NBVA 3H8VA 3ULKA 3D0OA 3ZW9A 4DWVA 4YJFB 1UP4A 4FFNA 3ASVA 2EERA 3OF2A 1EFLA 3KXDA 3PXXA 3D3WB 1I01A 2WSBA 3DO5A 1NP3A 1HEUA 1XYGA 4WNIA 2PGDA 2WYVA 1JN0A 1LBEA 5A9TA 4A03A 4RL6A 3VZQA 3MOGA 4FS3A 4DRYA 1UZNA 1I24A 4TVBA 1H2HA 3G49A 3M1AA 2V6MA 4R54A 2J5RA 3U9LA 3TDKA 3OA2A 4BNWA 4YQYA 5G4KB 1HYHA 4BNUA 3JYOA 3TQHA 1M6WA 2BGKA 1XA0A 4YB8A 3QV1A 4FBGA 1PJQA 4M55A 4A10A 5JDIA 5L40A 2JHFA 3ZWVA 2QZ9A 2FRDA 2DVMA 4GX2A 4BO4A 1M6HA 1P3DA 2CVZA 3VZRA 4XYBA 2VZ0A 3DXFA 3H9JA 3NYWA 3ZGYA 3OH8A 1KEWA 1NYTA 3MCVA 1SOWA 1UZMA 5JS6A 2FN7A 4RLHA 4TMFA 4YT5A 3ROMA 3H9EO 1DLJA 3K6JA 4XJSA 1LXCA 3UAGA 4PRLA 1VC2A 3PLRA 1PZFA 2JL1A 4DIFA 3LT2A 3RQSA 2WYUA 2NVWA 3M1LA 4CPDA 1Y9EA 3BA1A 2ZB4A 1I3MA 1YONA 1HF3A 3WICA 4E6PA 4FOSA 1P44A 5AYVA 3ICCA 3RBVA 3ANNA 5CDUA 4EZBA 5HRUA 3ZU4A 4PG8A 4HBGA 5JYAA 3ICPA 3INRA 1UP6A 2C2YA 5JE8A 1RM4A 5G0TA 4RCVA 5GZ6A 2DLDA 3KYBA 2C5EA 1C0LA 1OMOA 4IINA 4YAEA 3T7CA 4R5MA 2WM3A 2SCUA 3UICA 4DQXA 3UCXA 1PQUA 4XGNA 1EQ2A 2GO1A 2XXJA 4MP6A 1DIBA 3CZMA 5A5EA 4UEOA 1Z6ZA 3DWFA 3FTPA 4IQGA 4CJXA 3DAFA 3NGLA 5L4SA 3CMCO 3E1KA 5JSFA 2OP0A 1DIRA 1R15A 4NI5A 1VL0A 4RZIA 1H2BA 1WDLA 5CAEA 2ZTMA 4QO7A 1AE1A 4RGBA 4Y67A 3L4SO 3OIFA 2HLPA 3C1AA 3IAHA 4PCVA 5ITWA 3BIOA 1UDCA 2VTDA 2GSDA 1BG6A 2OBNA 2PD6A 1TEHA 5G2OA 1OC4A 2O2YA 1QP8A 3GGGA 5IDQA 2VYVD 3DBHA 3DL2A 2VHYA 3ZHXA 4AJPA 4WLUA 4EEZA 1LNQA 4C7KA 1DBVO 3FPCA 1XKQA 2AQIA 2CF6A 4M86A 4XYMA 3RUIA 5TNXA 2XAAA 1KETA 1ZK1A 3IP3A 3GGOA 3MJVA 4A73A 1CQIA 4GX1A 4HY3A 1ENZA 1E7QA 4KUEA 4MJLA 4GX5A 3KM0A 3UXYA 2NQ8A 4FIZA 3JQAA 4QFCA 4TZKA 5F1PA 4WLNA 3B6ZA 4NR0A 1E7RA 3SBOA 1U2GA 4PG4A 1A9YA 2JCXA 3AUUA 3KSUA 4MP8A 4J2HA 3CPSA 4NFSA 4Y9DA 5F5NA 3RUAA 2Q49A 3HDHA 4BGIA 4WUVA 4EYEA 4DL9A 2I67A 3ZHZA 4Y6RA 3WMXA 5F21A 2IYPA 2I3AA 3D1LA 3TZHA 3DZHA 4WE3A 4Y8VA 2X0NA 4KUHA 2PKQP 5COQA 1K2WA 4IJUA 3S2FA 3K9QO 2AEJA 1H9BA 2GF2A 1UXHA 1LU9A 1JTVA 1CF2O 1WZEA 2JD0A 2RCYA 3WGOA 2O4CA 3TZKA 1EMDA 2DQ4A 4ALIA 2VRBA 2UV8A 1I2ZA 4R1SA 4IM7A 1BHSA 3F1LA 4PLPA 1QYCA 3EZYA 2Y1GA 4KMSA 4OHUA 3U49A 2X0IA 3H6KA 4WLEA 5AVOA 1GYQA 2C29D 2NVUA 1V35A 3N7UA 4I1IA 1RJWA 4GWKA 2B69A 5T6BA 2CDBA 1HSZA 4D42A 3U0BA 1XWFA 3VDRA 4XRRA 3DZGA 2HU2A 4B7XA 1D3AA 1GV1A 3RC2A 3CTMA 3U4CA 4ALNA 1K5HA 3ANMA 3FWNA 1SOVA 1R0SA 4UVEA 4ITUA 4RLSA 4W9NC 3D4NA 2HO5A 3COSA 5A9RA 2Y99A 2YYYA 3GG9A 4RORA 3Q2KA 1KY4A 3WSVA 3DMYA 4Q3DA 1C14A 1LA2A 1LSSA 4C7JA 4Z6KA 3JYNA 2Q4EA 4J7UA 4N7RA 4YAGA 1Y8QB 5TQVA 3L6EA 1P77A 1IZ9A 3ETEA 3H9UA 4BGVA 1DJNA 2B4TO 3B20A 3LF1A 4CLEA 1RYEA 2DTXA 3VPHA 1ZKMA 1AXEA 2VHWA 5KJEA 1TVEA 2R00C 2PV7A 4LK3A 4ZA2A 4RQTA 4R1NA 3I9NA 1C1XB 4E2ZA 2FR8A 1FMCA 4PLHA 2GCGA 3Q0EA 4QO8A 1QLJA 3JQBA 3PJDA 4JLWA 3PIIA 2PA3A 9LDBA 4HNHA 3LT0A 3MWDB 1TT5B 4E5YA 2G0TA 4DYDA 4WEOA 2EHDA 1E6EA 1A4IA 1ZFNA 2P5YA 2C7GA 3IUPA 3QWHA 4E2XA 4NPCA 4DLLA 5TIIA 3VVCA 1Q7BA 1U7HA 1YB4A 1GAEO 3OP4A 4KUGA 1HYEA 2JD2A 3EUWA 3RUEA 3WOHA 2YDYA 4CV2A 1NAHA 5JCXA 4CMEA 3WBBA 1LI4A 4I9HA 4BGUA 3R3JA 1E0DA 5TSDA 2YQ5A 3KETA 2UVDA 1GDHA 2C7VA 4OH1A 1UUFA 3SC6A 3SX2A 1EUCA 4GSLA 4YPOA 3T4XA 5T57A 3GDOA 3EHEA 1DDOA 2ZB8A 3MEQA 5KVCA 4K6FA 1RM3A 4XWYA 3OIDA 4D43A 2P9EA 3QRWA 1K6XA 1T2FA 1F17A 2E82A 1MC5A 3EZLA 3GRPA 3DR3A 3H5AA 3I4FA 3RUHA 4BV9A 3JQGB 4CV1A 1ISIA 4C4OA 3WYBA 1EDOA 1ENYA 5B4TA 2HAEA 4WEQA 4ND3A 3RUFA 3JQFA 1HYGA 4IMRA 3AUSA 3I83A 3K8ZA 4I9UA 2VWPA 4DREA 4WCDA 3SJUA 4BS9A 4RVGA 1ZJYA 2HMSA 1XHLA 3A9WA 3PWSA 3M2PA 3U09A 5AXDA 5BR7A 2DBZA 3GZNB 1D4FA 5A4DA 3G0OA 4S3MA 4CMIA 4DC1A 5ADHA 1XIVA 5G0SA 4GMGA 1NQTA 2GERA 5F3RA 2Y68A 4RJTA 2VOJA 2X5JO 4MIOA 1B26A 1Q7CA 3D5QA 5HS4A 3WGHA 3AFNA 3ABIA 3LC7O 3I9MA 4UULA 1N2SA 4B3IA 3IC5A 3JYLA 4IZIA 1J49A 3ZWWA 4Z9XA 5KVQA 4RVFA 4IDAA 3HSKA 3E6AA 1NXQA 1P74A 2NU8A 1KERA 2P9GA 2CD9A 1MA0A 4WLFA 3ZWAA 6ADHA 2PZMA 4XYLA 3PVZA 1KVSA 4CR6A 5ILOA 3SJ7A 2R2GA 3ZNQA 1L7DA 4AJ4A 2P91A 3FR8A 1Y7TA 1X0XA 2UUPA 4U5QA 5HM8A 1N8KA 2Q1TA 1ZMOA 3KZVA 4ZQFA 3ZWPA 3H3FA 4D45A 1DOHA 3R1IA 1SB8A 4RF2A 3WQSB 4XIJA 2YDXA 5TT0A 1P1HA 2YZ7A 3L0DA 3P2OA 4D46A 1XG5A 1FK8A 1HDOA 3JQ9C 5B37A 3LVFO 3PWKA 1V9LA 3RD5A 5TX7A 3PWZA 3DAGA 4R01A 1HXHA 5A03A 4IIVA 4E2YA 5DCYA 2CVOA 3JV7A 1C0KA 3ZWBA 5ICMA 4OGWA 1E1KA 5B12A 2CNBA 3V2HA 5FWNA 1GZ6A 3JQAD 3E48A 5IN5A 4Z0TA 1ADGA 3QHAA 5TC4A 1DXYA 5L7YA 3TL2A 2J3JA 4KTVE 1OZAA 1PGJA 4GGOA 1BW9B 3LT4A 4DIOA 1QYDA 5BSGA 3ENKA 5T8KA 3ZNOA 4MIYA 4PG7A 4II2A 4P8RA 1FDUA 1ONOA 5JMWA 3FBGA 4NJMB 1LQUA 1GV0A 3VH4A 3LYLA 3PLNA 4LRSB 1PX0A 4JNKA 4PLFA 4CM9D 3LC2O 2EKLA 3LT1A 4UVHA 4FGSA 3BMOB 4ALJA 4S1VA 4OYRA 1CEQA 4WLVA 2D2IA 1GPJA 4J90A 1E1LA 2PZKA 3VDQA 3GVHA 4CQMD 5KKCA 4EGFA 5BSEA 3WIEA 4OAQA 2VT2A 3DBHB 1IOLA 4EITA 5C37A 1Q1NA 4XA8A 2P5UA 2WJPA 4JGBA 4YT2A 4U6QA 1WMBA 4DLBA 4RO0A 2FSVA 4E33A 3DB2A 2VWQA 1NHGA 2ZJ1A 4MVJG 3RBXA 3WX0A 3SXPA 3ONEA 3K92A 2QQ5A 3GN1A 1YL7A 3AW9A 3TSCA 3AM5A 3E8XA 1I3LA 2EKPA 2OBYA 4CMHA 1PQPA 2CF5A 2B0JA 2NU7A 2VN8A 1ADBA 3DFZA 4OO3A 4G65A 1DIAA 4AJ2A 3QVTA 4PRKA 1JW9B 5JCJD 4IPTA 2X1HA 3E03A 5HBRA 4CQMB 2BH9A 4KZPA 4PLTA 4DBVO 3G1UA 4LSWA 4BGEA 3KLMX 5JAZA 2ZCUA 5CDYA 1YBVA 2D1YA 3UVEA 3NAQA 1LX6A 1LDBA 3SVTA 1M2WA 3ZV4A 3GHHA 5U4QA 3KYCB 4RPKA 4XYGA 2DPHA 2VWGA 1NFFA 3PK0A 2BF7A 4PZEA 2GUGA 4AJLA 4E5PA 2B4QA 3FF4A 4A0SA 2EW8A 1GD1O 4FD3A 3GQVA 4JJIA 3PEFA 1FJHA 1MLDA 2DBRA 3IP1A 4K1LA 4ZRMA 4CM8B 1E7YA 4II3A 5BNIA 1Z75A 1QG6A 4AL4A 5JW6A 1ISJA 2E48A 4YWJA 4IGEA 2RH8A 3ZNNA 2GDZA 1ZO8A 5FEUA 3AJRA 4PLWA 4BO9A 1JQBA 4DXHA 1KC1A 5JDCC 1TXGA 3F4BA 3GLQA 4J7XA 4ZRNA 3T7EA 2Q45A 3VPFA 3AWDA 4JP2A 3INTA 1VRWA 4ND5A 1HZZA 1DC3A 4IDBA 2GZ3A 2TMGA 1P0CA 4BKQA 2Y0DA 4E5MA 4O63O 4L4SA 1SAYA 3K5PA 1QORA 1YDWA 4LRTB 1C1DB 3FI9A 1I5RA 1K89A 3KUXA 1P9LA 1B8UA 3IL2A 1E7WA 3MJ4A 3FRJA 2V6FA 3GG2A 2BKAA 3PFFA 5JXWA 3I1JA 1W8DA 1VKOA 3F6YA 1ULSA 3JQBC 1Y6JA 4NZ9A 3CH6A 3MJCA 1O94A 1AXGA 1F06A 2DT5A 3FNGA 3DZIA 2TMDA 1KOLA 1ZXLA 5JC1A 1V0JA 1WDMA 2VUUA 1ZEMA 5F1KA 3VVBA 5TS3A 3RCBA 3RC9A 3AOEA 3BMNB 1QSGA 3D5TA 1PGPA 4ZQEA 1CJCA 3WSWA 1KVQA 2A92A 4WGGA 3GFGA 1LEHA 3B1JA 1ONPA 3JTMA 4YA6A 3WLFA 3OJOA 2RH4A 1OFGA 4J6FA 3PHIA 2GZ1A 4GPD1 4Z9YA 4DMMA 4TROA 1B7GO 5FF9A 2P2SA 4AVYA 1MGOA 1YB1A 5T5QA 1XGKA 3UOGA 3OIGA 5KWEA 3JQ8A 4D7AA 1Q0HA 5K0ZA 2ZQZA 4AICA 3PTZA 1VM6A 2E6UX 4IXWA 4XYEA 1PR3A 2PZLA 1N1EA 3S2IA 2DUUA 4W4TA 2WD8A 2YV3A 3GUCA 1G0OA 5DP2A 4M89A 1GCUA 5T73A 1Z7EA 2J3HA 1U2DA 5CDGA 3NDRA 4L74A 4W7HA 3FNHA 1UAGA 1NBOA 3D7LA 2ZCVA 3C7AA 3O8QB 2D8AA 4K6CA 3QP9A 5IF3A 2I6TA 2VNAA 5A04A 3TRIA 4CMGA 1K6IA 2HMWA 2OXIA 4TRNA 4XIYA 5JLAA 1H94A 1FDSA 4J1NA 2B5WA 1VKNA 4IQ8A 3OECA 3F1KA 5DBFA 2QYTA 4J1QA 1GPDG 2C82A 4I5EA 5H83A 1PL8A 4BNKA 3WR5A 3PYMA 1ZSNA 3FNFA 3JQ8B 3FN4A 3CMMA 3OQBA 5DZSA 4IY1A 3JQGA 4CM7A 1U4OA 1XR3A 1LJ8A 1R4NB 4GI2A 3FNEA 4FC6A 2CSUA 4GSKA 1U7TA 1GR0A 3KTDA 4OQYA 4IBOA 8ADHA 1IL0A 3OETA 3AY6A 1P1JA 4U8GA 3GPIA 2BI7A 4BKRA 1RKXA 4AJKA 2PKRA 2VCYA 3KYDB 2PNFA 1ZCJA 4AJIA 2X9VA 2Y93A 1GQYA 4N54A 3GDFA 5BNFA 3PZBA 4NBWA 2FR1A 3ORFA 3GR6A 1HETA 1EVIA 5C7OO 1DRUA 3GVPA 5IG2A 2O48X 1KVTA 1X1TA 3Q11A 2PK3A 2BFOA 2Q2QA 3HFSA 5TJHA 3RU9A 4B79A 5B1YA 3EY4A 1M75A 4GX0A 5A05A 1NWHA 4LMRA 3BHMA 4R16A 1N7GA 4WKGA 1WVGA 4AG3A 4RPJA 5ITVA 2XF8A 5JYEA 4YXFA 4RVSA 3ITDA 1E3WB 1IULA 5IZ4A 2EIHA 3CKYA 9LDTA 3QWBA 5DULA 2ZYDA 4GL4A 3MTGA 3UUWA 3BYZA 3C7CB 2DBVO 4BO0A 2I5PO 1GEEA 3F5SA 4IJKA 2LDBA 2VT3A 4U0KA 3EC7A 4CLOB 2VRCD 3OM9A 4CMKA 2ZB3A 5C7LO 3BHIA 5A1TA 1F0YA 1GUFA 1BVUA 4HP8A 4R9SA 3PJEA 3W4KA 5H81A 1FDVA 4YCAA 3FR7A 4IIUA 3GK3A 3D4PA 1N5DA 2GN9A 4PVDA 3VPXA 3QWFA 4TKMA 3I9KA 4WASA 1PU2A 4ID9A 5I7VA 1T2AA 2UUOA 5CPFA 3V5NA 1PWZA 5JDIC 1LC3A 3EDMA 1IY8A 4JN6B 3TZQA 4E12A 3MJTA 2X22A 1YOVB 2YQ4A 4LVCA 4J49A 1MUUA 3ZWOA 1EDZA 4OXKA 2HMTA 4OOEA 5DP1A 1DLIA 1PS9A 3E9NA 1DIGA 4WCFB 3TNLA 5L9AA 2D5CA 3IOYA 3RFTA 4QUKA 3W4IA 1M76A 4ND4A 1HT0A 2C59A 2F1KA 4ESOA 2GASA 4YAKA 1BW9A 5H82A 1HWYA 4DQUA 1KEUA 5ER9A 4PN3A 1HKUA 3GVIA 4Q9NA 2D0IA 3WGZA 2IEDA 4F45A 3DAPA 1DRVA 3X2EA 3VPSA 3OEWA 2GGSA 2QX7A 2X0JA 3WMWA 4HFNA 4XKJA 1HLPA 4MPDA 2JFGA 4DIBA 1C0PA 4UVIA 1E7MA 4TSKA 1P1RA 3HNPA 2Y1OA 4CUJA 4F3YA 1UXGA 4I8XA 2DBQA 1KYQA 1PL6A 1X7DA 2I66A 3KEOA 5JO9A 1H6DA 3E82A 3ZV6A 4BKOA 5I8ZA 1NX6A 1E3EA 3NTRA 1NM5A 3HQ4O 3RJ9A 2PD3A 2GR9A 3GHYA 3EYWA 3JD0A 3HDQA 4O5OA 4ZQBA 3ROKA 4OMUA 1HL3A 4F6LA 2B36A 1U3VA 2AG8A 3DZJA 5JMPA 1EEHA 4DYVA 4BNLA 1LTHR 4E4YA 1YQDA 3I9OA 4ONEA 2YV1A 4IUYA 4I5DA 2J6IA 4CM6A 4WOKA 2CUKA 1B2LA 2PWZA 4B4OA 4Z0PA 2Q3EA 1DJQA 2DFDA 3HE3A 4LMPA 4DGSA 4BO2A 4FFRA 2JAHA 4HFRA 1A27A 5DT9A 1YWGO 5JBIA 4ND2A 5ES3A 3IIEA 4P22A 1U5AA 1TA4A 4WNCA 1S6YA 3OJ0A 2PR2A 4XGIA 1Q7GA 5AQ1A 2BFMA 4B3HA 1JKJA 3RVDA 4DBZA 3RJ5A 5IDWA 2J3KA 1HE2A 2WEKA 3L4BC 3D3WA 3MWEB 4IDGA 4JXKA 4BNJA 2W8ZA 3GC6A 1ZSYA 1E7SA 4ZGWA 4CMEC 2GYYA 1C1XA 5EPOA 4P4NA 1DPGA 2WTBA 1A7KA 1RYDA 2B83A 1LQTA 3HN2A 2Y0CA 3QWAA 4Q3BA 2IYOA 3ZH2A 1M66A 5CHEA 3L6OO 1N7HA 3JQDA 3L4BA 2PTGA 3I9LA 1PJ4A 4BNTA 3HWRA 1A9ZA 4XJTA 3WGQA 3E5MA 2X86A 2E49A 1EVJA 4BMSA 1Z82A 1BVRA 1U3WA 4RZHA 4UVDA 5B4VA 1V8BA 1MX3A 2FWMX 2AEMA 2IRWA 3RKUA 2GZ2A 4DTIA 4R1TA 4MVJD 3ZZNA 4PIVA 1EVZA 2HJSA 1MXHA 1P1KA 1T2EA 1WNTA 3JQ7A 4LGVA 1E1NA 2W2KB 1X1EA 4LCEA 4YJGA 1A5ZA 3A28A 1W4ZA 2O7SA 1JKFA 3L9WA 2Y0EA 3GAZA 3GEDA 3VH2A 2YW9A 2ZIZA 5AXCA 3DQPA 4R3WA 1OI7A 2QG4A 3H7AA 4TRMA 3WG9A 3OBBA 5KJ6A 4J91A 1AUPA 3AFMA 3VZPA 4A2CA 6LDHA 1BDMA 1LDEA 1NTOA 1F12A 1O6ZA 3ZWNA 3JQ9A 3NRCA 4FGWA 5IDYA 1YL6A 4XQGA 2VZ9A 3DTYA 4RVHA 1PGNA 3H5NA 1E6WA 3L07A 4MVJI 4HX5A 4INAA 4AJOA 5KJ1A 3PGJA 4HUJA 2R6JA 1GYRA 3T4EA 1W0CA 2DAPA 3GZNA 1LC0A 2J8ZA 1YE3A 3HG7A 4MKXA 3D3EA 4CMIB 5EESA 1T24A 1DFIA 3H9GA 1HDXA 3OJFA 1A71A 3EAGA 1MG0A 4DPKA 1TT7A 1DFGA 4FJ1A 3TJRA 4J9VA 5CDSA 3PDUA 2BGMA 5C7IO 1DAPA 4DMLA 3SLGA 4CM8A 3AM3A 2OMEA 1Y8QA 5A02A 2HUNA 4CQMA 2Y1CA 1VJ1A 3B70A 5K9ZA 1WDKA 3ONFA 4NBRA 2O3TA 1E3LA 1NQOA 1U9JA 3V2GA 2CMDA 3LLSA 3C1OA 1BWSA 2Y05A 3WNQA 2GLXA 3PP8A 4BQPA 3BMOA 1ZSVA 3DBLB 4OXYA 5JYFA 3GOHA 1DSSG 1JWAB 5EN4A 4CV0A 2AA3A 1T1SA 2W2LD 4HFJA 4KQXA 1VJ0A 2BFAA 2XXBA 4BO6A 4IDDA 2G82A 3G3EA 5JFOA 1YB5A 1T26A 1Z73A 3EVTA 1D1TA 1P1IA 3S55A 5IXSA 5EINA 4FFOA 3PQDA 3ROPA 2QRLA 1WW8A 4GLOA 5AXAA 4M54A 4BMVA 4PLGA 3LZ6A 3ANLA 2G76A 3WXBA 1R16A 1PJTA 3P7MA 4IS3A 3DONA 4GMFA 2OL4A 3SEFA 1VSVA 3JCZA 3RFVA 4ZU3A 4BHTA 2EGGA 5IZCA 4J7CA 3VC7A 3R0IA 3BMCA 3TL3A 1LSOA 4LISA 4AFNA 2E37A 2H1SA 3VPGA 1CERA 4FJ0A 1R66A 5T64A 1YKFA 4XDZA 2FOIA 1AHIA 1T4BA 4QSMA 3S8MA 5KVVA 3BTSA 3FD8A 4XCVA 4CM4B 4PFJA 1YQGA 3DZKA 5A5FA 2G17A 1JVSA 1N9GB 3RC7A 2HJRA 3BTVA 4U6SA 4XEHA 3K96A 2GNAA 4YT8A 5L7WA 2HCTA 1B8VA 3KV3O 2ZK7A 1Q2XA 1PZGA 1KY5A 2C2XA 1SZJG 3OFSA 3DOCA 4NK4A 3U4HA 1NQAO 2GRAA 4D3DA 1MB4A 5CP8A 2X6TA 4BNXA 1DRWA 1LLDA 7MDHA 1NNUA 4Z9FA 1E3JA 4IMPA 3AK4A 1H0KA 3I23A 2W2KA 2VUSA 2WD7B 4YJGB 4DC0A 4J9UE 4YAJA 1O8CA 1T4DA 4J0EA 1D8AA 4BO1A 2HMUA 3PHHA 1PR9A 2NU9A 4N5LA 4UUNA 1SMKA 4QEDA 3ASUA 3ZW8A 5IAAA 2BI8A 4TVOA 3GDGA 4PVCA 1E3IA 3KRTA 4ZQGA 1GTMA 2Q4BA 4BNGA 5JAIA 1CIVA 4RPGA 4YACA 3PQEA 4K28A 5JDCA 3KB6A 1FF9A 1JWBB 4NJMA 2WE7A 4OKNA 4BNFA 2DUWA 5KKAA 5KCZA 4ILKA 2VTEA 4YQZA 3RBZA 4DPMA 4IJVA 1JAXA 5LCXA 1PS8A 2NM0A 1P33A 4ZQHA 3I9JA 2NADA 4QXMA 2VNSA 1D1SA 1LDMA 1XQ6A 4XX0A 2A35A 1KS9A 2OGUA 1YBAA 3GEGA 4ALKA 4BV8A 3PYXA 5I9NA 3UHAA 2EJVA 2E4AA 3CSDA 4NNJA 4D44A 1JKIA 4CL3A 3DMTA 3GNQA 3FSRA 1HSOA 4CLXA 5A9SA 5DN9A 1ML3A 2R00A 2BRUA 4N5NA 2I3GA 4CL8A 3Q2IA 1B15A 3NTOA 5LDHA 2Q1UA 4KP7A 1JAYA 3NGXA 1P1FA 3BTOA 1LRJA 1YQXA 3DZBA 4CM3A 4CMJA 2I76A 1EE9A 2NNLD 2FHSA 1RPNA 4CODB 1A72A 3W8EA 3M6IA 3RWBA 3ZI0A 4E32A 4A26A 1I3KA 2O3SA 1OBFO 1LLQA 1JA9A 1GUZA 4CUZA 5IJZA 5KTKA 4L0QA 3PFWO 4J0FA 1HDYA 1IE3A 3PPIA 5JY1A 1P45A 1ZW1A 3E9QA 3HHPA 3P2YA 1IPEA 3EGOA 1IPFA 4IDEA 5I7SA 1U8FO 3K31A 2C07A 3AI2A 3OQ1A 4BOYA 2AQHA 3I52A 2EWMA 1S7CA 5JPIA 1FDTA 3PDJA 1HRDA 3GMSA 4OKIA 2IEBA 4FFMA 1HE5A 1F14A 2VYND 1ZK4A 2AW5A 1HTBA 3AY3A 2C54A 5JC8A 1GCOA 5EIOA 4G2NA 3S1LA 3W1VA 1Y5MA 3DHNA 3ZHBA 2JHGA 4W7IA 4FW8A 1OAAA 3NT4A 4IDCA 3QWIA 1H6AA 2NVBA 4MVJE 3OQ6A 4WLOA 1ISMA 4CM4A 4RV9A 3QSGA 4BO3A 3U4DA 2J5QA 4E5NA 2IZ0A 4PZDA 5K6AC 2OO5A 2BFPA 1EBUA 2O3QA 1DHTA 5M6DA 2X58A 2JJYA 1R4NA 3HJAA 3IUSA 3CEAA 1YH3A 3KO8A 3UF0A 1LDGA 5EMHA 1W6UA 4PZCA 4RQUA 1Y9AA 5DOVA 1YDEA 3G17A 4M1QA 3MJSA 3RUCA 2P4QA 3WNVA 1C0IA 5A06A 1XU7A 4I9NA 2O3JA 1BXKA 4W6ZA 5FFFA 3WWYA 1E5QA 4B4WA 5BQFA 3PIDA 2POQX 2AHRA 1XDWA 1XELA 4YJHA 3RROA 4JP3A 1QV7A 4OOFA 4NQZA 2PGJA 1AHHA 1O0SA 3N74A 4D79A 1U5CA 1YJQA 4DUPA 2WWRA 2RAFA 4IDFA 4UUOA
chains in the Genus database with same CATH superfamily
2P6NA 3C3EA 2C9ZA 2C97A 1M34E 3DCNA 1FE8A 5CLGA 3VAAA 4LYGA 1BU5A 2ZSIA 3AERA 4CGZA 2CHGA 1WPRA 1NKVA 3PUWA 3LO8A 2PUAA 1TE2A 3V8MA 2D0DA 4QE3A 4D9FA 2F59A 4XQEA 1PL7A 4QC2A 1Y8RB 1C3VA 1QH8A 3WFIA 4J43A 4BUJA 1MENA 1HDZA 4DB2A 1NW4A 2XZTA 2XMPA 1SRRA 1TI7A 3U7GA 1C7JA 1VSTA 5DXFA 1R1DA 1QYVA 2IXAA 5F7JA 4YMTA 5A0FA 1OBVA 5C8YF 3GFRA 2H06A 3WIUA 4N18A 3JRWA 5CFMA 4MW2A 5GZ3A 3ZU5A 4E03A 3NTQA 1V8DA 4AMZA 3P9SA 4CLRA 1BA2A 4L50A 2FPPA 3PR2B 4X61A 3BTUA 3W0LB 4D1YA 4E51A 1M1ZA 3MTJA 5DX8A 4P3YA 5EJFA 1OREA 4ACBA 4CYMA 3I0NA 3TJMA 5LYJB 1XXHB 1C30A 2WT8A 3LUGA 1XQ1A 3OIUA 1ZMTA 4PCAA 2Q99A 3OZBA 4PHCA 4YLEA 4ZT3A 4CTMA 3ABSB 4ER0A 3N0XA 3LPDA 4ZVMA 2W48A 1TYEB 4LA4A 1ISFA 1PJBA 1PTJA 3GQBB 3HN6A 4C30A 1NW5A 1I32A 3RI3A 1YMVA 2FQWA 1YR7A 4DQLA 2Y1XA 1A7JA 1Q77A 1CKEA 1HEIA 4W5JA 1G1MA 1MAVA 1QMGA 3GP5A 4BMYA 2YTZA 3EIQA 2VQ6A 1ZZEA 4LC0A 1CVIA 2YXPX 2HK7A 1L7QA 2PH3A 4L6AA 4YAOA 3I34X 4JWKA 3W6UA 4MW7A 5CEFA 3LYAA 2NU6B 2X4IA 1X70A 2R62A 3AF2A 5G3YA 1R0KA 2J3QA 1OB5A 1KEPA 2WTAA 1ODJA 1RVV1 5AOBA 2AKAB 5JQGB 2I87A 4LOJA 4D0GA 5G1OA 3CWQA 5B58C 2QRKA 1PF7E 3HADA 3DL0A 3ZDYB 3E3AA 1LTKA 2LUOA 2C0CA 3V9AA 2G06A 2EX4A 4Y6PA 2O0MA 4F60A 4TSFA 1TVKB 2CL0X 3MWJA 2IYQA 3LT5A 3I30X 4UBNA 4DGQA 4FB5A 3STUA 5FPTA 5AESA 3IO3A 1ADCA 4WUTA 2D1TA 5F5LA 3TB4A 4BPRA 4FYPA 3DM5A 1PNOA 4V0ME 5COBA 5DEIA 4D26A 3KOUA 4KXQA 4DUZB 4DJJA 1QHEA 4E5SA 2I03A 2RKWA 1VJGA 3QXJA 5JG7A 5BN4B 4EHAA 4HAWA 2I6FA 2OFPA 3MMPA 4MRNA 1R9JA 3FFWA 2HK8A 2AD1A 3N7TA 3TYXA 1TNDA 4AZ3B 4IDHA 2PLAA 1BMDA 5FR1A 5L4NA 3OICA 3J81k 1ZIXA 3BK7A 2NACA 1FEZA 1USWA 4GYYA 1DIOB 4FSHA 1ENOA 2GEFA 1E6CA 4HQKA 4XIIA 5JVDF 2P1ZA 1QLHA 2ZYTX 3L77A 2IYWA 5IKPA 2X42A 3LA8A 4LSMA 4UNRA 4QTZA 1JDJA 1XMJA 2C2KA 4ZHSA 2YL2A 3AQ4A 1I10A 3TUZC 3DNFA 4IXTA 4NNPA 4B8WA 4CMCA 3M6VA 4O6VA 1PJAA 2FMIA 3PNYA 2EG5A 4C06A 3AF0A 3DTVD 4O2AF 3T1TA 4KRFA 3PNBA 5KTRA 3MFQA 3TTSA 5AW6A 5JBQA 3K2EA 3P5BA 4PXAA 2ZI6A 4MAFA 5EUCA 3ADCA 5J5AA 1G60A 1XRRA 4M36A 4NYMQ 4PS0A 2WF8A 5BN5A 1AV6A 4PSCA 1E2IA 2J5KA 2NYRA 1R6DA 3IEVA 4D9NA 1TB4A 5D3MB 3V8BA 4J1TA 2AN1A 1Z2OX 1E6LA 4GAEA 4BUCA 4Z4EA 1TDJA 4AUKA 1YA6A 1SG9A 1SB9A 2RC6A 4MYHA 5DW0A 4K9LA 5EIBD 4PZYA 4TOIA 4V3CA 2ODBA 3H6GA 2QTCA 3FKJA 2CVPA 1NUAA 2WTNA 4KAXA 4DY6A 1NASA 2SCUB 1VJTA 3D2BA 1XTTA 2VKQA 1TLTA 3GMIA 1HI9A 2H2GA 1FRFS 2ZUTA 2XE7A 2DJIA 3DULA 3L18A 1PFKA 4EAQA 5FWYA 4IMIB 3H16A 2KM1A 1GUYA 2HYDA 1JEAA 4OHVA 2W11A 3HB1A 4PZPA 4F8YA 3ORHA 4F8JA 3BAFA 3BMNA 3JATA 3R3SA 5FOXA 4EKEA 4ALMA 1E92A 2FWJA 3PYLA 1MBZA 1N5MA 2LKDA 2ZI5A 4CNQA 1WMSA 4DKJA 1H9CA 3FYUA 1BOFA 3H04A 1EVKA 4D0NA 5SZIA 4XB2A 5HFJA 2IE0A 2NTNA 1NUQA 4I0WB 4BB5A 3PRJA 3WP1B 3BH6A 3LIPA 2QVXX 4JLBA 3UZUA 4UUPA 3K8YA 1P6QA 3LDHA 4LYJA 4UFPA 4MW9A 2AF3C 4NAUA 4X6LA 2PRZA 4KXXA 2V8BA 1XAGA 4TMYA 4C3VA 2JFXA 3H1TA 1KEEA 4R9UC 5KSZA 3ZQJA 3N59A 2ZDHA 4GH5A 4GKVA 4RF4A 4V0QA 5LQCA 5DH9A 3IQXA 4NH4A 5CFNA 1NG9A 5CH3A 1A69A 1TCCA 1A9XB 3PZRA 2Y66A 3LX6A 1A82A 4M0KA 1HRKA 2YJGA 1MFPA 2AQKA 1K6JA 1G5TA 2H4HA 2X5OA 4UFOA 1I2BA 1J56A 3DVRX 1U1GA 4MIEA 4LYDA 5KREA 2JLUA 1R50A 2WWWA 2XIQA 3RPEA 4YDHB 1MB2A 2H0AA 1BGWA 3FUVA 5ALFA 1QYRA 3GNTA 1Y1PA 2PIDA 1U3FA 5G0UA 3UH1A 7GPBA 2D7JA 1E94E 2OILA 1F5SA 2J9ZB 1XF9A 2Q2VA 2YASA 4KI0A 2QTBA 2YRFA 3BQ9A 4KO1S 5CDHA 1Y9ZA 4NESA 3U16A 1GYPA 2WP0A 1JAZA 2P6UA 2IBTA 4OQZA 5DLEA 3NTXA 4EMTA 3OE4A 4R8SA 3HY4A 3JD1A 4M1SA 4ZCPA 3ZCSA 4KWHA 5KQPA 3Q7TA 1E58A 3K30A 2A4MA 2AJLI 3C1TA 3BJZA 2XRFA 2H59A 3JZIA 3R09A 8LDHA 1SKBA 4H7FA 4EAAA 1NVVR 1XLWA 2BYTA 2YY5A 5H70A 3ONDA 3N8DA 3WBJA 1X92A 2H92A 4NMXB 4EY5A 2B4RO 3QEMA 2HCRA 3DJYA 3UGQA 4MV7A 2FNAA 2XNCA 3KUKA 5C34B 3UQYS 3A3YA 3CH5A 3SSNA 1Q15A 3ZJ5A 3MAAC 3C98A 1KWKA 4DMUB 4EUEA 5TQJA 3GRKA 4NCIA 5IX8A 2V6BA 1KDOA 2H7XA 1FDWA 2VDPB 3CLTC 3HCEA 4MI3A 5ECYA 4P3PA 4PYRA 5AVVA 4CDGA 2JAOA 4J3FA 3REOA 4BIIA 4KQKA 4BUZA 4ZI3A 4X7MA 1NUUA 4UDYX 5L6MB 5JTTA 2Q3CA 3SDZA 4V1CB 4NYMR 5IKMA 1V41E 2OUIA 3NAGA 4BYMA 3EGDB 1ICIA 4BLVA 4V0OA 1BH6A 3S2GA 1IBKB 4JCOA 4HSGA 1PBNA 5AIAA 3T4PA 1IONA 1ZXXA 1Q7TA 3DLTA 4EW6A 3KB2A 2H08A 5DSTA 1L0BA 4UHJA 3QJ5A 5EXPA 1IJBA 5KTOA 2Q22A 5EE1A 3HB9A 1BVHA 4Y7CA 1QGED 5IEJA 5FAXA 3LCUA 4HADA 1KO8A 1ZUIA 5HG0A 2XADA 4EJMA 1X7GA 2X9GA 1TEXA 3H4VA 1BDJA 3VTFA 1JR2A 1PV4A 2GAJA 5CG2A 2IY9A 3BSSA 2YJ3A 1T9DA 4JDPA 3BWVA 2OP1A 1AKNA 1I33A 2WTEA 1K63A 3UV7A 1O5IA 3VKVA 3HUUA 4UM7A 1OIXA 3CQ9A 3GNLA 4Y2HA 2NUTA 4O2BF 3W2IA 3NVKI 3RANA 3E9YA 2VI5A 4B7AA 2H2AA 1FIUA 5ALTA 3I9FA 3FSGD 1L5QA 3H2HA 3D2CA 5AJYA 3RU3A 1NXOA 5F12A 3IURA 4JVOA 1C7RA 1CU1A 4BNYA 4CKEB 2BFDA 2REQB 3RK0A 1LJUA 3L05A 1RHJA 1Q11A 2HDHA 2MSDB 3FNRA 4C5BA 5HUHA 3ZHCA 4YHBA 3RUDA 2C2ZA 1EBFA 2YVQA 3BK1A 3K0AB 5AM4A 4JI1B 4F9FA 3GLIB 2BTEA 3NUGA 1F8FA 3ZDFA 1ULUA 5EMMA 3KR0A 1EH5A 4UEJA 4U00A 1A9QA 3FOAA 4I99A 5DE3A 1E4VA 3W5DA 4O5AA 1VBNA 1SZCA 3D64A 1YIAA 4AJNA 4C07A 1NVGA 1QGZA 1UAYA 3CH4B 2IS1A 2ZYVX 1OZFA 3HPRA 1E3WA 3LCJA 5H7XA 4TS4A 3ZWCA 2XVXA 1PZHA 4JJ4A 1XU9A 3WRXA 3A1TA 3HI4A 3F5MA 1SU8A 4HVAA 5FBZA 1V1RB 3LLMA 5LUAA 3ZD9A 1IXKA 2ABWA 1F8GA 3DGEC 2JAPA 3LSYA 2BGGA 3KYJB 1RFLA 2DY1A 2HDOA 3GZTB 2A5FA 2B4KA 3LG2A 3OCCA 5HOEA 3TW4A 1Q50A 4Q7KA 1XN1A 5J47A 3M5DA 3FZYA 4LDNA 2I8CA 1OAOA 3H5RA 4P3OA 3TSZA 4GP7A 4NC9A 5L3VA 5KTTA 1NYLA 3WLQA 5CA0B 5K3BA 2YXNA 1GZHB 4MZXA 1E62A 2QUKA 2ZJ5A 3OOSA 2WI8A 4H1UA 3ZCPA 3HEMA 5JI2E 3MJEA 1UMCB 2WHYA 1MQAA 3TK1A 2ZAGA 4D3FA 1FLDA 2IKSA 2JCYA 4A82A 1UPBA 5KYTA 4DR1B 3BMQB 1I9CA 1TX4B 2EG9A 4GQAA 5CX4A 2ADFA 4YCDA 1Q0PA 2AG5A 3USCS 3G6KA 3STHA 1VHLA 5FNZA 3S2UA 4TUYA 2ZRIA 1N2GA 2ON6A 3CYFA 2EW2A 3ETCA 3NALA 1KYWA 1KSHA 1M1YA 2G1AA 3KKMA 1TYBE 2YVUA 1GFIA 2QD1A 2ZSEA 3EE6A 5D3ZA 5AXBA 4EB0A 4YLGA 1SFRA 2IPOA 2OOSA 3VJLA 1NVVQ 2G1UA 3I58A 1EU1A 3M2TA 3DV9A 3MAGA 5EG5A 1XOIA 2ZJ0A 3CUWA 4P4GA 4L75A 4B3JA 5BSKA 5DBIA 2I2AA 4CCAA 5BMVB 1W48A 3U17A 2HSGA 5JH7B 1EGVB 4JJFA 1FNCA 1U2ZA 3AR6A 3ENVA 1WMFA 3JASB 1MXFA 1W73A 1G8FA 2JCGA 2JLSA 1HDCA 3ESAA 1YCFA 3FTQA 1AF4A 3GDHA 3D6NB 3ZDZB 1O0BA 1I7BB 3WYCA 1IYZA 3LDUA 8ATCA 5G0WA 2AZDA 3R3HA 5GMOA 3FDXA 2CE7A 2IYUA 4ZMRA 2CDAA 5EJ5A 4NU5A 2IH5A 1NT2A 3V42A 4JI3B 5HJ5A 3B3JA 1AQ6A 1QZUA 4RKFA 1WZCA 3PUVA 1GNPA 4IHJB 3RS8A 2CZGA 3DOOA 3GLIE 3C4JA 1BD3A 5SZKB 5HJ7A 4YMIA 5F73A 3RFXA 1NVMB 2JC3A 3R7WB 5ENDA 3Q7SA 2W0SA 1PRYA 5CB4A 3A1WA 4ZEOA 5JWHA 2ALJA 4TRJA 1B76A 2FQXA 2W4IA 2BFCA 3W6ZA 2HPZA 1H1LA 2HLHA 1G55A 2WJAA 4MWZA 4NU6A 4EZEA 3CNLA 2C3PA 2NT3A 3I6QA 3B82A 3UMGA 4RK7A 2C4MA 1GQQA 2PH1A 3ENWA 2C04A 1T9BA 2NUAA 2MWMA 2PH5A 1ULBA 5DGIA 1ODIA 3ZZMA 5KQRA 3MS2A 5AI0A 1JLMA 1NPYA 4TVKA 1V5WA 5KQLA 1TO1E 2FX5A 2OGSA 3BB1A 1FNBA 3CIFA 3EQ6A 3FGOA 4WBXC 4Y6LA 5MN4A 3D0QA 1J7KA 4PGFA 3RVMA 1CVLA 2BHRA 1EUDA 2O1WA 2EQBA 3C8MA 1WQ3A 3KCQA 4N8SA 5TEWA 3TAHA 2GXAA 4GBJA 1KJ8A 3QU2A 1H2WA 1YF3A 3G9TA 1MB0A 4IKOA 5F4ZA 5IUNC 1V2GA 4RYLA 3HWWA 3RDPA 4TV9A 5K8UA 3WFJA 5BSTA 4UTNA 3RKRA 1NMXA 1BSVA 4CDNA 1N9GA 3ET5A 5GZ1A 1P2UA 2BZSA 3BFKA 4M3NA 4P4SA 2D3TA 3V6MA 1DZ3A 5HKLA 2VBCA 1GQFA 2YFHA 3FXAA 4RIHA 4XQCA 1RZUA 1K4KA 1HLDA 2C8JA 3PI7A 4Y18A 1OFTA 1W59A 1SIWA 2QP3A 5ALIA 4KWIA 5BN5B 2ILTA 2PMEA 4CKCA 4YT4A 3C4VA 3GT0A 1QIHA 2W4MA 1KDRA 4CLHA 4B81A 1GUAA 2HSZA 2PGNA 4EFDA 4C3ZA 3CUYA 2JB9A 3RU2A 4M8KA 1D6MA 1X1AA 2PSFA 1MORA 1T2NA 3MIZA 3R74A 4EBFA 1U7OA 4MYRA 2UUAB 1EFVB 2OORA 2VIIA 3AU8A 4GZ3A 2IU0A 5JFTA 1QU2A 3N6VA 5BSFA 1KYIA 4A8JC 1QTIA 5EQDA 1T25A 3E5RA 1ZK2A 3MGBA 3WDLA 5B7PA 1AC5A 3CINA 1B8PA 2DWUA 4QQFA 4D41A 3HKDB 4XWWA 4FOTA 1QVWA 4YMHA 3UMBA 3UPDA 4TKLA 2CJPA 3ESYA 1ZUNB 3T9CA 2KMLA 3TPCA 4AECA 5GVRA 1FFAA 4MHTA 1OLSB 1RKUA 3GJ4A 4TPKA 1MP0A 4CG0A 1U4NA 1JJVA 1ZH6A 1XXHE 1DINA 1R4MB 2CXTA 3F3MA 4JENA 4JX8A 4M6WB 3QUTA 2HA6A 2LV8A 2G70A 2E87A 5EJAA 2XD4A 4H3VA 1L7EA 3HDYA 5JJBA 3QHPA 4H16A 1GZVA 3B2EA 5KNLA 3TTYA 3EVNA 1VCMA 3HGQA 1NFQA 2NXJA 3LQ1A 4HWOA 3CW2A 4TTQA 2LNDA 5PNTA 4H17A 1QH1A 1Z8HA 2ZR7A 3PC7A 4O1IA 2PX2A 4PPQA 5D84A 2YIVX 3EXHA 5FWDA 3ROXA 4R4JA 3A6EA 4PZAA 3SSAA 2AR9A 2X1VA 2FKAA 4YV2A 5B2EA 1UF9A 1W5AA 3AP2A 1RTTA 4ER3A 1FMLA 3L82B 4NOJA 4PXSA 2C7BA 3E7WA 2ZJ6A 3EZ6A 3O0DA 5I8WA 5KSWB 4P9NA 3NOQA 1C9EA 2I4NA 3ZDDA 1EP3B 1PSZA 3E53A 1O7JA 1CSEE 3IMKA 1YZQA 5KCMA 4ZO8A 3U9SA 1KJZA 1D0VA 1XD2B 2ZS7A 3LLUA 1CE8B 4PX3A 5DTEA 3V1KA 4PR3A 2PBRA 3HJGA 4FEGA 5J5CA 2AXQA 1L8AA 1TUGA 2VRCA 3NH6A 4JUBA 1W0KA 3FWZA 5B1DA 4MKZA 3WLTA 1ZJ4A 3KBBA 2P30A 2V7GA 3I72A 4V03A 1DAOA 4QDJA 2QN3A 2PUEA 3E1GA 5DMXA 1T8PA 2L19A 4L0CA 4QWMA 3DKKA 3OFNA 3TJZA 2D5LA 4LF4B 4BO5A 4X3OA 4GPZA 2SKDA 4R41A 4DR6B 4HNRA 4C0HA 2REBA 1SBYA 2EFCB 2VF8A 4WZBA 2I3BA 3N0VA 3OCYA 5IVIA 1BQ4A 3N0WA 2VUTA 3RASA 5JTUA 4EFNA 5B4UA 1FB5A 1J24A 2QL6A 1NZFA 2CXXA 1DJMA 2NLOA 2QTVA 4L4ZA 5JV5A 1ISSA 1EDEA 2NV2B 3R6DA 4Q19A 2ZQ5A 1CS4C 1NDUA 1ONNA 1NW3A 4LE2A 4R69A 3H5WA 4YRAA 3NV9A 3T3HA 2Q46A 1E2GA 1PZEA 2PZJA 3S2EA 3OA0A 1HH4A 4G5HA 4YFYA 3TQSA 1KQGA 5ALVA 5BORA 1W2WB 3D6VA 3GLRA 1FPQA 4NEQA 1C29B 1F2TB 4TZTA 4L85A 1UXJA 2GZDA 4RF3A 1WEKA 4KQ9A 4A6DA 3S44A 4IX9A 4U2FA 3FOCA 3ROQA 4KMRA 4LQLA 1L4GA 3L7CA 1BXZA 1H8EA 1XJWA 2WC1A 2UYOA 1LUAA 3DAOA 3RH0A 1HOTA 2GCOB 2C2GA 2FZ4A 1G7RA 3EY9A 3A14A 3HJFA 2P7IA 1THGA 1XK6A 3TFWA 3KK0A 3SC2A 3Q6NA 2R6GA 4B7UA 2QW8A 4F2DA 3UKDA 1TZCA 3WGMA 3J80A 1YRQA 2G5CA 4MOWA 1N0UA 3ZBUA 2JAWA 2P62A 2PKEA 4HGPA 3FM9A 1SUSA 3WO1A 2IHJA 2PCLA 1IH8A 3NTLA 3QVSA 3GCXA 4L28A 3KJIA 4ZVSA 2FPGA 3H4TA 1JB9A 3TAXA 4EEXA 1TO6A 3MCZA 2YIJA 3SBDA 5HSGA 4BKQA 3G2PA 4OI0A 2AFIB 1C3LA 1KNXA 3HZZA 1P0MA 3F78A 3O4HA 4JJAA 2WT4A 4NU8X 1N6KA 2GBPA 1B74A 2J0UA 4B76A 1F4VA 2WVAA 4BNNA 5I6DA 1ZRSA 2X4DA 3NFYA 5TT1A 2ASVA 3ISJA 2I1WA 1KKLA 5A3QA 3ZWYA 2CUZA 4MA4A 4BPBA 3ETDA 4JC4A 3LU1A 1NWCA 2R4QA 1RAFA 3L7BA 5K8VA 1RQRA 1E8NA 3P9KA 3QV2A 1ZI8A 1PDVA 2CNLA 2JNWA 3R6LA 3E2IA 2O8FB 1SEPA 3KZNA 4QPPA 5AKXA 1MQ8B 1I30A 2NO5A 4HLCA 5H3HA 5LQJA 4NS1A 5MGBA 1L1EA 1O57A 4EG0A 1LI5A 2XE6A 1MOPA 4JWTA 5BO5A 1JJ7A 1L4KA 2LXNA 4XM1A 2HA5A 3GJYA 3PHCA 1GZ3A 4FDVA 5EMLA 1BGXT 1U5BA 4F84A 4M1KA 3C39A 2XNSA 1D2MA 4GXTA 3F7MA 1H2FA 3HDJA 2PMWB 2JI6A 4KQMA 3O2SB 1C8KA 2VTBA 2ZZNA 1E2KA 3FFAA 4AJ1A 5CBPA 1JHMA 1GNQA 2DHQA 3G1TA 1N33B 1JG3A 1GPAA 1MC1A 3AVWA 5JAQA 1XZMA 2WU1A 2JGRA 4P84A 4UBOA 3LF2A 2XTJA 3G2KA 1MNAA 2EQ5A 3HB4X 2R66A 1AKEA 4KDFA 4PQEA 4DAEA 1LPPA 2WU8A 3B51X 1AUVA 3QUQA 4DMHA 1VHDA 2R87A 3EWNA 3MILA 3SMQA 3C74A 4LW8A 2OO3A 1H5UA 5GINE 3B6MA 2GQ0A 3CUKA 1CYDA 1U3CA 2W37A 1BX3A 1FVOA 3D54D 2ZS9A 2QM3A 2C5HA 3LPMA 1VL6A 3AJAA 1SXHA 3WB0A 4FFLA 5L53A 1AMNA 2OTCA 4DB4A 2LZ0A 3VR5D 1JDTA 1TQHA 3FUCA 4N8DA 3SSOA 1IB6A 1OPXA 1WHTA 4AMGA 1Z16A 2VXCA 1QZXA 1DCFA 4UUMA 2WWTA 4ZDIA 1EX1A 2PJRA 3UB3A 4DEYA 1USGA 3BMQA 2G9RA 4GICA 1E5TA 4WVLA 3ICQB 1G6KA 1XCGB 2UZIR 4G5GA 1V71A 1Q92A 4WBSA 3BZUA 3WGYA 1NR7A 1O9HA 1DUSA 3CURA 5DRYA 3TB6A 5THQA 4AM8A 1VE7A 5LQAA 3PHLA 1GNLA 1K0UA 4HUQA 1QVRA 3VYUB 2OG1A 5LBTA 3MBOA 4HVTA 1SVSA 1A5SB 1UH5A 3JD3A 2PGLA 2WR8A 2H31A 3CX8A 1PTKA 3ECSA 4FJ2A 3L2OB 4OIMA 4QOGA 3K1AB 4C29A 1I2CA 5DWVA 3MCTA 1H22A 5EWMA 3BBPA 2B8JA 1NOIA 2G07A 2QPAA 3ANSA 2O2ZA 3AFIA 5AI4A 4RGQA 4BX2A 4CN8A 8MHTA 3IUMA 3VTZA 3H84A 3VSBA 2VAVA 3EW9A 3NHAA 1N5IA 4JK3A 1SQ6A 2PXXA 3D0RA 4WOJA 4H6PA 1ONSA 1V43A 4TM8A 2ZIGA 2VP5A 3NDJA 1TKCA 1G20A 2IZ1A 1QC5A 2DPGA 1PVVA 1Y7HA 1QH8B 2J9FA 1JHZA 1QCYA 4AQDA 1BE0A 2MIIA 3TFQA 2GKOA 5C32A 2Q6OA 4WY8A 4OCZA 3HEBA 4KTTE 4HV4A 1SWWA 3RARA 1X8XA 3JWJA 4KGZA 2WRZA 1Z38A 4L4YA 2M98A 3EP7B 1U4SA 3IJ5A 1JIXA 4OK3A 1QU3A 3K3PA 2A9JA 1NI4B 5F78A 3NEPX 2HQ1A 4G1FA 4NMHA 2PX6A 1KO1A 1VLLA 4LV6A 3K35A 3QG5A 1ZVMA 4PBSA 1H9AA 3HN7A 4XM2A 4LBVA 4URHA 1GRNA 3DL4A 1MJNA 2HREA 3CVOA 2I2FA 1IIRA 1A04A 1C3OB 1G5RA 1NM5C 2H8GA 2R6DA 3KL2A 3OZXA 1EE1A 5AQEA 2EFHB 3SFTA 3EH2A 1Q84A 2GDJA 5HWSA 2Z1MA 3FLEA 1RADA 4ZI7B 3DTTA 1NAIA 5I01A 2SKCA 5JQGF 2X4GA 4TS1A 5THKA 1ZH8A 1TMYA 4XCXA 3O1IC 2PKQO 4HRXA 2D5AA 3PQFA 1NPTO 1LRLA 4OJQA 5D3QA 4ZT7A 3DL7A 4IIYA 3UUEA 2O8DA 1AKRA 3D6TB 1R00A 3P5SA 3U62A 3ZBPA 1E4OA 3KJQA 4MX8A 5I9TA 2QPTA 2QLFA 3DE3X 3H8VA 4KSCA 4U3JB 1DQNA 4QJIA 3FB4A 1VA4A 4QKQA 3S7TA 5I51A 4OBBA 1VIVA 2ZJ3A 3JWHA 5DHUA 3UAWA 3ASVA 3ZVNA 1EFLA 2O20A 5AUQA 4JYPA 5DW3A 3IAM6 2AK2A 3PXXA 3X1DA 4PZUA 3D3WB 4MW6A 5IM4F 5L6LB 5H4GA 2WSBA 2ORYA 2NPIA 3WK7A 2P78A 1HEUA 2VPTA 3PUZA 4HNSA 2VXBA 2WYVA 3GJRA 5CT6A 3SP1A 2JJ1A 3WO0A 2PLNA 1JR3E 4QHTA 1ODTC 1LBEA 1HORA 4OX9B 3ILYA 2FZ5A 1AGRA 1ZICA 4CTJA 4O3MA 3HYRA 2XUJA 3ZIAA 2RKOA 3K9WA 3UV6A 3AETB 2C2BA 1DEXA 2BE7A 3M1AA 2G1PA 1MPXA 3AEQA 5AJTA 3V46A 2WTMA 4BNWA 4G2TA 2D0PB 2X8JB 3KU1A 3MK31 4UM9D 3WYGA 1UJ6A 4U7GA 1HYHA 5LUBA 2XA9A 1CULC 3JYOA 1M6WA 2F9MA 2PUDA 4YB8A 3QV1A 4FBGA 1PJQA 4KBGA 5JRZA 3FYTA 2BR4A 4A10A 3BE6A 4CFZA 4LAFA 4PS1A 3SDBA 2XE8A 1FZQA 2H0QA 5DI3A 4BO4A 1M6HA 3VZRA 5AD1A 4BNDA 3DXFA 3H9JA 5GP1A 2QMEA 3BILA 3U4MA 2ZYUX 1KEWA 3DPUA 4P35A 4EKDA 1NYTA 2VP3A 3V1MA 3UT0A 1O97C 5JS6A 2YZKA 4L5JA 4X0EA 3QYPA 3D6MA 1KDZA 3Q41A 4Q39A 1HX7A 2P4SA 2F48A 4FDUA 4YRJA 4ZODA 2JL1A 4CKYA 2NVWA 2JI7A 3M1LA 3KAPA 1VJ5A 2IV7A 2QJFA 3GYGA 4QU9A 4E6PA 2Z4SA 4FOSA 1OLOA 3GUZA 4D9IA 4C08A 1IY2A 3IVGA 4Y1EA 1QIDA 4DSOA 3VKHA 1DAKA 3NHFA 3UGJA 3WL3A 2D62A 4O2RA 5KDOA 4RCVA 3LAWA 4K1XA 4MTLA 3ZW7A 1FRQA 1Z6YA 3QFSA 2GZAA 2CCGA 3SZRA 2XXAB 4AUNA 1FQOA 2J33A 2SCUA 2UVQA 3L7NA 5GM2A 3UCXA 5JMOA 4Z4QA 1NVEA 4G1EB 3N05A 4ODIA 3WV4A 2V6IA 4QXPA 1GCGA 2BEVA 2W71A 3ZCTA 2X7XA 3PWTA 1WQ1R 1Z6ZA 1MO3A 1BHO1 2VDOB 3DAFA 4CT4B 2G80A 2OESA 1C41A 3PF8A 2JFYA 5CJPA 3E1KA 4WVFA 3MMSA 5B5SA 3GLGE 1UBRS 4WA7A 4LF9B 1R15A 3HY3A 1NIPA 4J2TA 5F23A 5F9MA 2XTMA 2G72A 1PKXA 5IC5A 1IDOA 4MV8A 1P18A 1P2TA 2B92A 4FIDA 3TO5A 4AMBA 4YJ2F 5DM60 5CAEA 2XNDD 4LKRA 4PV7A 1H1DA 2ZE6A 1LPBB 3C1AA 1VCOA 2A14A 3NBZC 4PCVA 5JJ5A 4RTJA 5J2UF 3TVDA 2VTDA 2QY6A 2OBNA 3DVAA 1PSWA 3HNOA 1OC4A 3P2EA 3SJCA 2VYVD 2XBMA 5ECDA 3DL2A 2ONKA 4AJPA 2OM6A 2XF2A 3B38A 4BFVA 1HDIA 4WLUA 2ZGVA 3HBNA 4RD0A 4EA9A 3FZNA 4EEZA 1OB2A 1DBVO 5EUMA 4TWAA 1WUKS 3TEFA 3RVKA 5TNXA 3CFYA 3O2QB 5E3HA 5KTNA 3H1BA 4MGZR 4JI7B 5FO0A 3N2GA 3PCRB 1CQIA 1TADA 2JLQA 1UDXA 3VSCA 2XMQA 1AQYA 4KUEA 2Y8EA 4ITRC 2FHPA 2ZPUA 3UXYA 4ERNA 1SUWA 2FEXA 3CVJA 2V58A 1SHLA 4FIZA 1MO2A 4ARZB 5I9IA 2YVAA 3GAAA 4MQBA 3JQAA 4QFCA 3MT7A 5F1PA 3HGMA 1YCGA 3BCSA 5L3QB 1DGQA 3SBOA 3C5HA 4PG4A 1A9YA 3KNZA 2IOFA 3K32A 4ABYA 2Q49A 4EMUA 3KSAC 3GJQA 3KUCA 4WUVA 4C43A 1KI8A 2ZUEA 2GJ8A 5NLLA 2I7TA 4YCSA 5F3DA 2QAGB 1NW9B 2XCIA 4YMWA 4GZMA 1OX4A 2FUG1 3U1TA 1GL9B 2I3AA 1TZMA 2IZOA 1Y6GA 3GAMA 2OCXA 1ZNZA 5H9VA 4KUHA 4MNTA 2PKQP 2PL5A 4JI6B 4A6EA 5B6PA 1PX2A 2X2EA 3CUSA 4IJUA 3F90A 1VLMA 1H9BA 1UXHA 1NA5A 4Y2JA 5F2NA 5JAPA 5LXTB 3IKMB 2UYHA 3O8BA 4A1FA 2O59A 5D7BA 2OHIA 3N75A 3FAZA 2DR0A 1YR3A 1KYXA 1J1ZA 1G9SA 4ZO7A 5SY6A 3ROZA 3TZKA 2FPIB 2PEYA 2VRBA 2QIPA 1UBMS 1YOBA 221PA 5BWLA 4PLPA 2C5LA 3VR0A 3HL0A 2Y1GA 1S8OA 3CNOA 4KMSA 4KIFA 4OHUA 2ID8A 2X0IA 3U49A 5AVOA 3LTEA 3C2QA 4JT8A 2C29D 4G0NA 3IPRA 2NVUA 1V35A 1U5BB 2OCAA 3N7UA 4I1IA 3GJ7A 1WSDA 3B5EA 3DPSA 3OKPA 3PNQA 2J9RA 3COPA 4C04A 1YQUA 4RD3A 1TJ4A 2FPWA 1CUEA 1B00A 2NYAA 1GV1A 4YO7A 3V97A 4IG4A 4FHZA 2VZLA 5GWXA 2OMKA 1KRWA 5BV2P 3CA8A 1FUYB 4G84A 1ZN7A 4RV4A 1FJ2A 4W9NC 2HO5A 3COSA 3C8HA 4KACA 2Y99A 4ZTBA 5A9RA 7REQB 1W5EA 2F1HA 3QENA 4RORA 2I4RA 4GOND 1KY4A 3R44A 4RA6A 4DVGA 4AC9A 5G53C 1AUXA 2RGNC 4Z6KA 4J7UA 4YMLA 3D7RA 5LNK1 4YP1A 4NARA 1IZ9A 2AMYA 3ETEA 5DJ5A 3ZVRA 2ZBDA 1T3GA 2B4TO 2P2DA 1XZ8A 3LF1A 3OEHA 1CRLA 2DTXA 2PR7A 2R6AA 2XTZA 2YWJA 3AV0B 1ZKMA 3CF2A 4M7RA 3PNKA 2HGZA 1H42A 2CKMA 3QXGA 3ZY2A 2Z6UA 4YMGA 2ZIEA 2WMNB 2ORVA 2PV7A 3NWOA 1L5KA 2H52A 4ZA2A 4JJ7A 1TEZA 3ZGXA 2FR8A 1XZLA 4PLHA 2C3UA 2GPSA 4QO8A 3JQBA 3PC8A 4BP8A 3PIIA 2PA3A 1TUBB 2HJ9A 2JI9A 3M6UA 3MMXA 4CNBA 3DEAA 3TRFA 3SKYA 1RQLA 4PINA 5DTQA 4YI3A 1NR5A 6GPBA 2QZ4A 2G0TA 4DIKA 1QMHA 3KHKA 1HGXA 2OQIA 1A4IA 1RI4A 3P9IA 2C7GA 5F1YA 4EKNB 4NPCA 4TV8A 4YAUA 3DEKA 3KXPA 4LJ6A 2YHAA 5EHIA 4MWBA 4BV2A 5ARBA 4MDYA 4X6UA 4WHMA 4QLBA 1DBWA 4ENUA 3VVCA 1U8TA 4Q9AA 1YB4A 3ZQKA 2R11A 4CIAA 1AF7A 1CQJB 1ZM3A 3KKLA 5DEOA 2ZI9A 3IEXA 1HYEA 1YDGA 1CR6A 3NC4A 3A9RA 4UHBA 5HMMA 4L8YA 4HGNA 5D86A 5AI6A 2LCQA 4ITVA 1BO6A 1OX6A 2WJGA 3ZY5A 4CMEA 3WBBA 3IMGA 1P8AA 1EIZA 3ZUGA 3KETA 3QVGB 2DHRA 1VB3A 2OKGA 2R8PA 3NHWA 4OH1A 2W43A 3TRDA 1RWQA 2Q4TA 3BS4A 3SC6A 3NWJA 2Z2YA 5LWHA 2XZDA 3I3SR 1N0WA 1CD5A 1DDOA 4OA8A 5KVCA 5GJBA 3T0IA 1DQZA 1RM3A 4Q02A 2GD0A 4XWYA 3OIDA 1COZA 2BISA 3T3DA 4D43A 721PA 3S1AB 3QRWA 1H4TA 3ESDA 4IV5A 2FPKA 1M1YB 3TKLA 1IHOA 1MC5A 3QKSA 4JLMA 1N6LA 1QJCA 2MSEB 3ONNA 4U4AA 4V0MA 2J67A 1L4YA 3ZY4A 4F6RA 1TTQB 3CW8X 3OWOA 3RYTC 1G5PA 5LA6B 3K09C 3RUHA 1FNSA 4EYOA 2ECKA 4BV9A 1GNSA 1HMYA 3JQGB 3L1JA 2ZUCA 4RGYA 5B4TA 2AKYA 5FRDA 1KI2A 2WABA 1CIJA 3F6BX 4Y6QA 2GWHA 4BEWA 1V5IA 1HYGA 3JQFA 1G6Q1 4IMRA 3IR7A 1ILEA 3K8ZA 3HACA 1A1SA 4G0OA 4WCDA 3OTQA 1FYFA 3T9FA 4YMUA 1U7PA 3W3AA 2FZGA 1IN6A 3A9WA 2ODTX 3CZAA 3M2PA 1P73A 5GM1A 4I3HA 3MLBA 3OPNA 1T1JA 4ZVLA 3GZNB 4OB6A 3WOVA 4B4KA 3R9XA 1TKRA 2YCBA 3FRIA 3NCTA 3RVRA 4S3MA 4WOCA 4LOHA 2QMOA 5D1HA 1IHUA 1JSCA 1J2YA 2JA1A 5G0SA 4IJMA 1NQTA 1X7ZB 4CKEA 4F5ZA 4EHDA 1MOZA 1ML4A 2VRNA 1IQRA 1Q7CA 5AM1A 5JMTA 1BE8A 2QNBA 4NE9A 4ZMSA 1QRAA 3VNUA 5AR1A 1M5TA 1WVMA 1BN7A 1ZH2A 3IC5A 5KWIA 1APBA 2B8TA 3ZK9A 1ND5A 2JIMA 1N3BA 3MJRA 2H4YA 4RVFA 3W79A 2A0FA 1LPMA 1P74A 2NU8A 2IPXA 3RS7A 2IHBA 3WRXC 1CG6A 1KERA 1VDZA 2EJBA 3HRHA 1Y3HA 1MA0A 4M1EA 1KK1A 2P2YA 5BOVA 4TT3A 3RRMA 4ER6A 1GZUA 4GLBA 5AKJA 2FN8A 5LMUB 1T6ZA 1YDMA 2MHCA 3A3KA 3IVXA 3P2JA 3QXCA 3VSDA 3M5PA 1JF8A 3KJEA 3N0TA 1NMQA 4EHLA 4I6EA 2X7JA 1FSFA 1Z0UA 2AN9A 2P91A 1MA3A 5FYQA 4EVSA 3O8NA 4B9EA 1FFYA 4QASA 4M2LA 3RHTA 5IJWA 3SY8A 1V1JA 1QIMA 1L5RA 1V7ZA 1VJCA 2EZTA 4MWTA 3EGXB 4QTUB 1HKHA 4XIJA 3UJPA 1GCAA 2A9QA 3OCUA 5LQMA 1JMYA 1REQA 1ZLYA 3L0DA 1YVUA 3P2OA 2XE4A 3SICE 3SLRA 3L8YA 1Z6AA 1AVTA 1NULA 4JKOA 4TYQA 5I7UA 2PU5A 4HGOA 3MRVA 1DG1G 1HDOA 3D8RA 1ECPA 2ZUUA 4C6TB 1V9LA 1MEJA 5TX7A 2V74B 3PWZA 3DAGA 3BJMA 4KR7A 1HXHA 1KR2A 5FQNA 3DP9A 3H86A 3JSXA 3OLQA 3C3YA 5AW5A 3ZGNA 1UPTA 4TTAA 5AICA 3JV7A 1FOEB 2AWNA 4OQ4A 3EXIA 4OGWA 1E1KA 3E9CA 3N2KB 3FDFA 4G89A 1WUTA 4L08A 1EXVA 4Y9TA 3V8VA 1EFAA 4P3XA 5IN5A 3QX3A 1VKJA 1GKKA 3GLGA 2J3JA 4KTVE 4XB6B 2XKAA 3OCWA 3KYIB 4EFLA 1GWNA 1QYDA 2QTNA 3SZ3A 3DVQX 2HBZA 3AFGA 3ENKA 4NP6A 5LD2C 5E7QA 3PQ8A 4YP6A 2YQZA 1F2UB 3VDXA 4UNNA 2GCNA 4II2A 4P8RA 1HE1C 1ONOA 5LZ5A 3FBGA 4B3BA 4Y2RA 3DYVA 4A1OA 1Z18A 2P1RA 4W5TA 1BC5A 2A2ZA 3X0DA 1T3LA 3R2JA 3VH4A 2FN9A 1CB0A 4HQNA 1PNVA 3H1EA 4LRSB 1PX0A 4JNKA 3A0UA 4KPGA 4CM9D 4PC3A 5CCXA 4YCLA 4FGSA 1MD9A 1XTJA 3OTWA 1EJ6A 4NCXA 4OYRA 5DHSA 1CEQA 1NBIA 4WLVA 4BMDA 1V7PC 4IIDA 5K2MA 4J90A 2RGWA 4Y1GA 1J09A 2VDKB 4C2BA 4XXHA 4D8TA 1ZNWA 2ISQA 2PZKA 3CLSD 1IATA 3DCIA 4A16A 1OBCA 3O9MA 1B73A 4LCBA 4UXHA 4CQMD 2TMYA 2B8EA 1IEVA 3X1KA 5BSEA 3WIEA 1K0FA 4MQEA 4CHGA 1A0OA 1NONA 4Q3LA 4XPIB 4JODA 1P2VA 5C37A 2GBCA 1U1FA 1K88A 4BLRA 4L3WA 4MUHA 1Q1NA 4JGBA 1RP7A 2A33A 3NHMA 4BDSA 4YT2A 4YXWD 2V4MA 4ESVA 4A3SA 3K0FA 1YUMA 3OUTA 2J3MA 2VWQA 3OT5A 4PZ9A 3EFEA 5IJAA 4RTOA 3CLTD 1NP6A 4YJ3B 5AVQA 2B30A