2I3AA

Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
344
structure length
344
Chain Sequence
ATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHPHLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAVWERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAVTVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFTPVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAHIAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of N-acetyl-gamma-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP(+).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords N-acetyl-gamma-glutamyl-phosphate reductase
total genus 104
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2i3aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i3aA01
3GVXA 4GKBA 1J0XO 4DGSA 2J5QA 4GI2A 3GHHA 4HFMA 2GYYA 4YJHA 4PLVA 1O89A 3MJ4A 2ZB3A 4DQXA 4E5YA 3Q6IA 1ONOA 2HMVA 3ICCA 2ILTA 3W4IA 3WG9A 5A06A 1FK8A 1EUDA 3E8XA 2C2YA 2ZTUA 4TZKA 4CMAA 2B5VA 2VYNA 4IDDA 1I3LA 4MVJA 5JXWA 2BFPA 3RI3A 2J3JA 5F1OA 1PQPA 1HE2A 2DUUA 1VC2A 1X15A 4XX0A 5A02A 2Q46A 3EHEA 1IE3A 1KVUA 1KEUA 3QE3A 1CEQA 1EUZA 3H3JA 5AXCA 4B79A 4ALMA 5GZ6A 1WAMA 1ZZEA 3DOCA 1NAIA 3LC2O 2EGHA 3BMNB 2C29D 4W9NA 4CLOB 2VT3A 2E48A 4J3FA 4OJNA 1DSSG 3VOSA 1ZSNA 4XZ3A 1C1DA 4JX8A 2GO1A 2IRWA 3FNGA 4IJWA 4YPOA 1H9BA 4IDGA 2EKLA 1P3DA 2QRJA 2AA3A 1NQAO 3LK7A 1U1IA 3SJ7A 4DVJA 1TVEA 5I7EA 1XR3A 3ZZNA 5KWEA 2Y0DA 1YB4A 5DBIA 4J1QA 1XU7A 4RCVA 1LU9A 3O8QA 4HXYA 5L4NA 1AUPA 4ZQHA 1MP0A 5CDTA 5MGBA 2Y1DA 1ISJA 3ADPA 4J16A 3FNEA 4Y8VA 2IE0A 2BELA 1X7HA 3H9GA 5KJFA 4WLOA 3SC4A 4D3FA 5T57A 4R1SA 5EL0A 2Z95A 1FXSA 1E7YA 1IHYA 5CEEA 1DRVA 4R5MA 3ZNOA 1ADGA 1HDRA 5EN4A 5TC4A 5TS3A 3ETDA 3PLNA 3DL2A 1HRDA 4YAKA 1QRRA 2G5CA 4BO2A 5DN9A 4GWGA 4DA9A 3JD4A 2BFOA 2Y05A 3GPIA 5CHEA 5JO9A 4BB5A 5KKCA 2EXXA 2ZATA 4I9HA 1EVZA 3PQDA 3RFXA 2Y68A 3LLSA 4CV0A 5AQ1A 5FEUA 4ESOA 3LVFO 2EKQA 5CFZA 1MFZA 3RSHA 4BNFA 4CM1A 2E82A 5IZCC 2VTEA 2B37A 3CZRA 3RUAA 3GF4A 4YVFA 2VHVA 1SAYA 4JBGA 4IM7A 4G81A 1P0CA 4M87A 3PJGA 5IDXA 2W2LA 1BVRA 2JD1A 2O7QA 4FBGA 3DTYA 4XQEA 3S2GA 4L75A 4DREA 2W90A 1EQUA 4Q3BA 3K96A 3D1LA 4J2OA 4RL6A 1Z45A 1PGPA 3BHMA 1PU2A 2I3AA 1NVTA 3DZIA 4FDAA 3VVCA 4HV4A 1ZBQA 1XYGA 4UREA 1PIWA 2NSDA 4FOOA 4PCVA 3CINA 3MJVA 4XIJA 3NDIA 4YB8A 3MJSA 1DHTA 5DCUA 3DXFA 3UFXA 3JQAA 2Q99A 3H7AA 1YQXA 5FI3A 1Y1PA 1X0VA 3OSUA 1PS9A 3PFWO 4ZVVA 4WOKA 3KXDA 5JC8A 1U8FO 3JD3A 1HZZA 2DFDA 5JYFA 3ASUA 1YL5A 1IHXA 3FBGA 4YBZA 2YUTA 4J43A 3IL2A 4IDBA 3L6OO 1KIFA 4M55A 1GDHA 4GWKA 2ZQZA 3K2BA 4QSMA 3PHGA 1O6ZA 4DRYA 1DLJA 3RIHA 3ZV6A 1OC2A 2BFMA 4YYZA 2X9GA 2P2SA 3NT5A 1YB5A 4J7UA 1GR0A 2NVBA 3MOGA 4QX6A 3QWHA 4FFRA 2AQ8A 5CAEA 1F8GA 5G0SA 7MDHA 2YDYA 1XELA 4Z0HO 4QFCA 4FOSA 1HE5A 4CMJA 4KOAA 1KYQA 1WVGA 2JCYA 2PZJA 3H5NA 5T5QA 3WYEA 1N1GA 1WP4A 3JSAA 2GD1O 5L51A 3AOEC 2X0NA 2Q1SA 1H0KA 1BGVA 1E1LA 4M86A 2GZ2A 1FDUA 2FWMX 4CM9A 5BNTA 5JS6A 3E18A 1K2WA 2OBNA 4BKQA 4WJZA 4E33A 4RF3A 3B1JA 5A03A 3D3EA 3VPHA 4PVDA 2RHCA 3WGGA 2IDZA 3OQ6A 1GQ2A 4RQUA 1H6BA 1Z75A 4MVJG 2EHDA 2O3TA 4Y6RA 5JAQA 2RBEA 2NV6A 4PLFA 2DBZA 1V35A 3QWFA 3HDYA 2DAPA 2CF6A 2CVZA 1PL7A 4KUGA 2POQX 1CJCA 3BHJA 3PJFA 2AG5A 2HMSA 4IQGA 2X23A 3I6IA 1GUZA 4AJPA 3CKYA 1KS9A 5HBRA 4ZQFA 2AW5A 1DHRA 1EDZA 2D5AA 2YV3A 3RVDA 4GVLA 1ZIDA 1T1RA 1HKUA 5JDIC 4XB1A 4BO8A 1I2CA 3WICA 1ZVMA 4AVYA 2P5UA 1PJ4A 2Q22A 3MJCA 1XIVA 1E3SA 4BO9A 2PZKA 3BTOA 4I9NA 1PJ2A 1GV0A 2JKVA 3K30A 1FDWA 3L6EA 2YZ7A 4NBWA 4P4LA 3RBZA 1GUFA 5JPIA 3HB5X 5IJZA 4EW6A 4MDHA 4DPMA 1U3UA 1B26A 1Y8QB 4Y67A 3TL3A 2PZLA 2AE2A 3ROQA 2Q1UA 3C7DB 2AQIA 1V3UA 4Z6KA 5TF4A 1QR6A 3PIDA 4N18A 5GZ3A 4BV9A 4PIVA 1WNTA 4CR7A 1V3VA 5IDYA 4J1NA 3RFVA 3L9XA 5JSFA 1WXDA 5FYDA 5F1KA 4OO3A 1U4OA 2X22A 3A28A 1E7WA 4PLGA 2GN8A 1Q0LA 3BMQA 4DLLA 3O9ZA 3B1FA 3H4VA 3UVEA 4LVCA 2JJYA 4DL9A 1QV7A 4IGEA 2X5OA 3EC7A 1DRWA 3MEQA 4WLUA 3WWZA 4OHUA 4P4NA 5G2OA 1LA2A 1ENOA 4WLFA 3VHRA 3S2EA 4DBVO 1QP8A 4CODB 4A27A 4CPDA 1XHLA 3TQHA 4R4JA 3COSA 5AOVA 3BA1A 1NAHA 2E37A 1EFLA 3TF5A 4RQTA 2C5EA 4NDNE 1O95A 3DBVO 1Z74A 4E5KA 2BGMA 2FPPA 1LLDA 2FSSA 3JYLA 4MKXA 3MTJA 3GG2A 5CPBA 4D45A 5JMPA 1U5CA 2O50A 3I4FA 4RVSA 4IDEA 4TVOA 4Z9XA 3DAPA 5TNXA 3JQEA 4DIOA 3HN2A 3GN2A 1JKJA 2X58A 3OIFA 4RF4A 5C7LO 2VWGA 4Q3NA 4AICA 4IQ8A 4D42A 4L73A 3ZWOA 3VDRA 2X5KO 4EUFA 1LXCA 3F47A 1AXGA 1HWYA 3GEDA 4JJFA 3ZU3A 4P8RA 3KLPX 3RKUA 1W73A 2D5CA 3SEFA 3VPXA 1OC4A 1UAGA 3ZHYA 4I5EA 3PYLA 2B83A 2YHIA 2Z1MA 3DBRA 4RGBA 3CZMA 3OA2A 4PG5A 4ZQGA 4Z9YA 1A72A 1XWFA 4ZRNA 4BO1A 1SMKA 2DVMA 4AL4A 5BT9A 1SNYA 1KY4A 3FBTA 4PZCA 2GGSA 1GV1A 4ALIA 1J4AA 4EJ6A 1IL0A 5L40A 2WM3A 1E7RA 1VL6A 2W2KA 4OSPA 1UP6A 5DBGA 4CQLA 3W8EA 3FRJA 5ADHA 2PA3A 5BQFA 3IDSA 5K6AA 2PGJA 3GDGA 3WGOA 1IPEA 3ITKA 5BSEA 4RO0A 3C7CB 3DHEA 4B4VA 4CM9D 1EVJA 1XQ6A 3KLMX 4U0JA 4AJJA 3O03A 1KVRA 2CDAA 4L0QA 1RYEA 1RJWA 3LT2A 3TOZA 4BS9A 4LSWA 4N5LA 1VRWA 1D3AA 1JKFA 4RV9A 3NUGA 4WASA 1VJ1A 5IXYA 2GASA 4NJOA 3MCVA 2NTJA 2UDPA 5LC1A 3JYPA 4XDYA 4CUZA 1KEWA 3C3XA 1J6UA 3CH6A 3VZPA 3WMXA 4AJ1A 1X7GA 2W2LD 5TGDA 2IEBA 1PJCA 2UAGA 1I24A 5EJ2A 3NT2A 4E30A 1ZCJA 1K0UA 4PLCA 2NU9A 1NASA 1HETA 1HDGO 3CTMA 3OF2A 5BSGA 1R4NA 3WMWA 4CR8A 3GT0A 1Y7TA 4MO2A 4C7JA 4DIFA 3DMTC 4NFSA 1JW9B 3LDHA 3WQQA 3FNFA 3JQCA 2CUKA 2P9GA 4R9RA 4KUEA 1PJTA 4I5DA 3UCEA 3WTCA 3RKRA 1LJ8A 3CE6A 4FS3A 2FR8A 4WNCA 1ID1A 2VUSA 4FSHA 4XIYA 1NPTO 1J49A 1UZLA 5THQA 1LRKA 3WJ7A 3F9IA 5THKA 2IEDA 3ETGA 3H5RA 2OBYA 1GL3A 1Q7BA 3ZNNA 2EG9A 3MOIA 1PTJA 3IIEA 4CLRB 3VVBA 2Q4EA 2SCUA 3WBFA 1HLDA 3S2IA 5F5NA 5C3MA 1E3IA 4J6FA 1D4FA 1HE4A 4HFJA 1TT5A 3JQ7A 1PWZA 5HS4A 2GN9A 3QP9A 2DBQA 2V7PA 4HWKA 5KNLA 1T2FA 3STHA 1WMAA 3KM0A 3NTOA 2P4HX 2HAEA 2PKRA 9LDTA 1ZMTA 2JCVA 1K6JA 1XGKA 4WEQA 1R0LA 5G0UA 1ENPA 3FN4A 3GA0A 3D0OA 5JCJA 3VPFA 1E3JA 1LI4A 4JJGA 4PLHA 2OZPA 2BGLA 2A94A 3QSGA 5HA5A 2VNSA 2IYPA 4Y98A 1U28A 4NH4A 1HXHA 4W9NC 5B37A 4WCFB 5C7OO 3IUPA 4NZ9A 2BH9A 3DMYA 2QYSA 1E6WA 2QZZA 3DHYA 4ONEA 1Y8RB 3TZQA 3TFOA 2QYTA 1I8TA 4LGVA 2EV9A 4XYEA 3K92A 3GAFA 1DLIA 3AUAA 4Z0PA 1GAEO 3RC2A 2VZ0A 5GMOA 3RC7A 2O3SA 2XXJA 1T2EA 2JFHA 2JAPA 1DOHA 2J5RA 1CQJA 4FB5A 1JQBA 5BR7A 1Z73A 4JGBA 5FWNA 3NJ4A 2CSUA 3GVCA 1EUCA 4MIEA 1EQ2A 1CYDA 4ZRMA 3ONFA 3WBBA 3BZUA 3Q1LA 3I6QA 4TKMA 5AVOA 1LDGA 5KOIA 1MA0A 3GR6A 4EEXA 5JYEA 1LDEA 4WK6A 4TRMA 4R01A 5DNAA 2WSBA 3PJEA 1H94A 3I3OA 1DIHA 4LMPA 4KP7A 2CF5A 2NNLD 1HF3A 3ROMA 3TNLA 5A05A 3DO5A 3QRWA 3PDUA 4EJ0A 3A06A 5GY7A 5C5IA 1C1XA 3VZRA 2J6IA 2Y1GA 1HDZA 4OKNA 1WMBA 1ZK3A 3HB4X 4YCAA 2V6FA 4D46A 1H2BA 1HLPA 4Q39A 4K28A 4J4BA 3W6UA 4YT5A 1H6CA 5EERA 1QLHA 3KRTA 4HUJA 3JQ8B 5ICMA 3P2YA 4FJ0A 1H5QA 3WQSB 2Q50A 5A9TA 2HCTA 4NJMB 4BB6A 3KB6A 1MC5A 3A9WA 2GERA 5BNIA 4QECA 3ICPA 2I99A 4IJKA 2IZZA 3H3FA 1NXQA 2PGLA 4XEHA 1YOVB 3QQPA 3A4VA 1NQOA 3U09A 1UDBA 3RU9A 3U49A 1EVIA 2NUAA 1E7SA 2Q2WA 3JCZA 3OFSA 1O0SA 4YT4A 4MOWA 3I9OA 2YQ4A 4IS2A 4RVDA 1LLCA 3GDOA 2HUNA 2C0CA 1HTBA 1UR5A 3EZLA 5MDHA 3PXXA 4B8ZA 4QTZA 4RDHA 3KYDB 1DC6A 4YEDA 4NFYA 4YQZA 1L7EA 3VTFA 4F46A 4UUPA 3EYWA 4FFNA 1PL8A 4J2HA 3KYDA 4NBTA 5T8KC 2C59A 3RFTA 5DBFA 3WDSA 2YYYA 1V3TA 1IZ9A 3KHUA 1KC3A 5TIIA 3TZHA 2ZYGA 4L9RA 3R1IA 4G65A 4ZD6A 3QVTA 4YRDA 4CLDA 2GRAA 3S8MA 4EJMA 1SZJG 3IOYA 1ULSA 1PWXA 2BHLA 2VHZA 2CD9A 1JVSA 4FC7A 1PR3A 1P31A 3L4BA 4Q3CA 4FR5A 3LQFA 1Y8QA 2O2SA 4LSMA 3LSYA 3D4OA 1EBUA 3IP3A 2JFGA 3PPIA 1PS0A 5JDIA 4FGWA 4E32A 4R51A 4RZHA 3BTUA 4CM4A 2WE7A 4DWVA 5EPOA 3D7LA 4R9SA 4BGIA 3JD0A 2OP1A 3EY4A 2J8ZA 2NU6A 2HDHA 3DR3A 2FPGA 2R2GA 4OL9A 4BGEA 1U7HA 1PZHA 3DOJA 4ALLA 3I83A 4CUKA 5JYDA 2WMDA 3AOEA 5DF1A 4GQAA 1UZMA 2VOJA 2BD0A 3BYZA 2YV1A 3ENKA 1LTHR 4NQZA 3VKVA 1SB9A 1DIAA 3DZKA 3B6ZA 3UH1A 1EEHA 1QMGA 2AMFA 3LT1A 2WYVA 4YAJA 3WXBA 3HWRA 1QYWA 3PWKA 1SBYA 2EW2A 1D1TA 4A03A 5I7SA 4NBRA 2J3KA 4BNKA 1ONNA 3D64A 5CEFA 1P33A 5ITVA 3HDJA 5JC1A 3RWBA 5L4LA 4R3WA 2DTDA 3GG9A 3IC5A 3D4PA 5T8KA 2JFFA 4AFNA 3K6JA 3PLRA 3H2ZA 3WFIA 3KSUA 3NDJA 2FP4A 3V5NA 4J9VA 4E5PA 2PV7A 2HLPA 1EBFA 4ZU3A 1YO6A 2CDBA 4LK3A 2YDXA 4G2NA 3VH3A 1SB8A 2AQKA 1MXHA 1U3WA 2ZB7A 4DC0A 4HNGA 3WX0A 1E0DA 4ND4A 3FPLA 4ZHSA 2DC1A 2I65A 2X9VA 4S1VA 2ZQYA 3I9JA 5IN4A 3NAQA 1Q7GA 2NLOA 4YQYA 2FOIA 1NFRA 2VZ9A 4CLHA 5LDGA 1PJBA 4BHTA 2DM6A 1E6UA 1GD1O 5EQDA 2W2KB 1P77A 1H6AA 4MPDA 5KVCA 4PVCA 4IDCA 2DTXA 4J1TA 2AQHA 3DZBA 1ZSYA 4YAIA 4Z3KA 3PEFA 3VZSA 3Q3CA 5I7FA 1PGOA 4H7PA 1EZ4A 5FF9A 1YQGA 4FC6A 3GMDA 3VPSA 2D59A 2AEJA 3JD1A 4E31A 1TLTA 4W4TA 4CM6A 3I9LA 3M6IA 3AFNA 5TT1A 3ZN2A 1H93A 2Q2QA 1WZEA 3BTVA 1E7MA 1P1JA 4WCFC 4BOYA 3DZFA 4XQCA 4BNTA 1JA9A 4XGKA 4TRJA 1X13A 5KIAA 2Q4BA 1GU7A 2GZ1A 4NR0A 1QKIA 3CPSA 3GNQA 2DPGA 3ZCXA 4RPLA 4CMIA 1AHIA 5AYVA 1V6AA 1XU9A 2VRCA 2YFQA 4GSKA 4AG3A 3I9NA 1KY5A 3IJPA 4IXWA 5TRTA 2EKPA 3AJRA 5JDCA 4BNMA 1IZ0A 3G17A 4J0FA 1HL3A 2YW9A 3D3WB 4CL8A 3OA0A 3D4NA 5C37A 1RYDA 2HMUA 3FR7A 3KUXA 3DTTA 1WDMA 4W7HA 4AJ4A 4M1QA 3W4KA 6ADHA 1LX6A 4IJUA 3FTPA 3DEYX 3G3EA 3BIOA 4DIBA 1DO8A 3Q9UA 4OH1A 4WLEA 3O26A 5T67A 3BAZA 4XYBA 3ONEA 4BO4A 4BQRA 4G5HA 4XYMA 4OOFA 4B3JA 2X8LA 4CV1A 1F8FA 4PRKA 2DBVO 3DDNA 3DFZA 3PHIA 5DCWA 3NV9A 1MG0A 1KBZA 3AUSA 4YA6A 3PK0A 4PG7A 3AU9A 4WUVA 3TPCA 1B0AA 5DT9A 4K9DA 5IXSA 3AY7A 1X7DA 5DDIP 1YVEI 2VWPA 3EGOA 5JW6A 3OP4A 1ZFNA 4UAGA 3PTZA 4CMKA 5DZSA 1MLDA 2GN4A 3JQ9C 3DMTA 1JTVA 1K6IA 4YAEA 3IKTA 1CF2O 1BTOA 1WZIA 4Q3DA 5U9CA 2Q1TA 3UCFA 1F0YA 4NFHA 3WIEA 5DOVA 2OFPA 1UXGA 4AJIA 4CV2A 1R0KA 4NK5A 3KYBA 1X0XA 5A5EA 3RJ9A 3HG7A 4QQRA 3ZNPA 5T6BA 2VYVD 3R3SA 5G0TA 3DONA 3U4HA 2VCYA 4WCFA 4YJFB 1LSOA 2VYND 4BNVA 2NVUB 3GVIA 2WWRA 2PGDA 2Y66A 2HSDA 2G76A 1Y5RA 2QRKA 4TWRA 2GUGA 2PD4A 4W6ZA 9LDBA 4NPCA 1Y5MA 1YRLA 4K26A 3E6AA 2NWQA 1HYHA 2OL4A 4YJHB 1YS4A 4I5GA 4RVHA 4A10A 4LN1A 3UUWA 1NR7A 4OOEA 1E6EA 4XCVA 3HZZA 1ARZA 1KETA 4GVXA 3ZDFA 4HX5A 3GHYA 4NJMA 1GPJA 3WWYA 3E82A 4H3VA 1C0PA 3LU1A 2OXIA 5IZCA 2CVQA 1KC1A 1UZNA 2VUUA 4CLXA 3A1NA 2EF1A 2QQ5A 4FN4A 1DFHA 2VT2A 5JO0A 4A7PA 4CM8A 4J90A 2PKQO 2UUPA 4R16A 1QLJA 3M1AA 4YTEA 1A9YA 4MP8A 3DFUA 4CM8B 1C1XB 4YR9A 4CQMA 5IN5A 1R4MA 2ZKLA 4UVIA 4BNIA 1P1FA 3TZ6A 1PGJA 1LSUA 2NU8A 1CWUA 3B1KA 3ENNA 4OKIA 4RVFA 7ADHA 3QWBA 1PQUA 1U3VA 1E92A 2WDZA 2X86A 1SOVA 1BVUA 1E3LA 3TOXA 3Q2KA 3UCXA 1UXJA 3H9EO 3JQ9A 2DBRA 1NWHA 2G82A 3ZV3A 2XAAA 3H2SA 4BIIA 3I9MA 3R3JA 4IIVA 3KETA 1NQ5A 3OM9A 3PDJA 4PFJA 3JQ8A 8LDHA 4C7KA 5JBIA 4GL4A 1ZMOA 1T1SA 1LLQA 2ZYDA 3KBOA 5A5FA 1HE3A 3K9QO 2NU7A 3B20A 3TSCA 4BKUA 2BI8A 3WOHA 4AJLA 1TT5B 3IMFA 1N8KA 4Z9FA 1GCUA 3EW7A 4OXYA 3DWFA 5F21A 4M54A 2CY0A 4BKOA 2FRDA 1JWBB 2P9CA 4EYEA 4P4GA 1NVGA 1PZGA 4ZN6A 1SPXA 4D7AA 5B1YA 4BNJA 4UEOA 2VWQA 4NMHA 4WLNA 1FF9A 2Y1FA 5FI5A 1KERA 1YL7A 1E3WB 2AEFA 3ASVA 4BNXA 1HZJA 3RAJA 3NX4A 2EJWA 5DCYA 3VTZA 4TZTA 3E1KA 2PWZA 4OM8A 5I8WA 4WGGA 5EMHA 1ZO8A 2FHSA 1DDOA 2Y0EA 3OQBA 3KEOA 1UJMA 4AJNA 1DEHA 1MV8A 4QFDA 2A35A 2WD8A 4BO7A 3KEQA 3RCBA 2X0IA 5CPFA 4MIOA 1GEEA 1KVQA 4IZIA 3VH1A 3LYLA 2PK3A 4HADA 1A5ZA 5HM8A 3GEMA 4NI5A 4NBVA 5I7VA 1JWAB 1ENYA 3D5TA 3WYBA 3O38A 2C7GA 1NYTA 4ALJA 2X9NA 1IY8A 1G6KA 1UAYA 2QW8A 3GDFA 4XR4A 3LF1A 2DU8A 1K6XA 2YY7A 4PLTA 1A7AA 1FDTA 3RC9A 1E3WA 4YDRA 4KQWA 5CDUA 3HFSA 3SBOA 3VDQA 3WSVA 1ZK2A 5HWSA 1I0ZA 4XYGA 1EK6A 1PSDA 2PTGA 5A4DA 1M75A 4II3A 2HRBA 2NTVA 1O8CA 4RORA 1R15A 1EE2A 3W4JA 2NVUA 1YB1A 5IG2A 2NVWA 2X1HA 1VJTA 4DMLA 5TJHA 2AXQA 1V8BA 2GPTA 4LW8A 4Q9NA 3VZQA 3NTQA 4QT0A 1F12A 1YE3A 5I8ZA 3U62A 2HK9A 3AM5A 4B7UA 4A2CA 1AN9A 2EGGA 3E5MA 3G0OA 3G1UA 1P44A 5L7TA 2OMEA 4IMPA 1LDBA 4QO8A 1C0LA 1PJQA 5J9GA 4NK4A 2B4QA 3HHPA 3BMOA 3RUHA 4EGFA 2RHRA 3Q9NA 4E2XA 3JD2A 1M2WA 2WJPA 2GZ3A 1YOVA 3VH2A 5TT0A 4LMRA 4LISA 1VKOA 1Z82A 2GF2A 1YBMA 1ZW1A 3AK4A 3JQ6A 1F14A 3L9WA 3N7UA 2DPHA 3W6ZA 5JCJD 1ISHA 1DJQA 1VM6A 4P22A 4E5MA 4JLWA 4DTIA 4D3DA 4J9UE 4PLZA 2ZTVA 1DAPA 1E1MA 1ISFA 1U4SA 3F5QA 1DJNA 4R1TA 5IF3A 4YT8A 2V6MA 1OMOA 3Q11A 2PKQP 1Q7CA 5A04A 1KVSA 2B69A 3HUDA 4KUHA 1BMDA 3K31A 5ILOA 5KVQA 5ENVA 4GMFA 4L8VA 5IDQA 4N54A 4O63O 1ZUD1 5COAA 4E4YA 3GGPA 1H6DA 4FFOA 4RDIA 3W8FA 3R6DA 5ENDA 2V6GA 3LZ6A 4JBIA 4CQMB 4OSOA 4DYDA 4BMSA 3C7AA 4BNLA 1LDMA 4RPHA 2QG4A 4I08A 3I1JA 3ORFA 1LSJA 5F5LA 2NTNA 3AWDA 2D4AA 4R41A 4R5HA 4PZEA 3IQDB 1QYDA 4WEOA 3PRJA 3AI3A 4O59O 3SXPA 2GNAA 2FN7A 4AJHA 1WDKA 3NDRA 3GNTA 4CL3A 3H6KA 2C5AA 4FJ2A 2WYUA 4GLOA 2BRUA 4OQYA 1EFKA 2F00A 3RUDA 4AJ2A 1QG6A 3E48A 1L7DA 1Y6JA 2UUOA 1CQIA 4BNWA 4BNYA 4LCJA 2HJSA 4CMEC 3F1LA 1LSSA 2LDXA 1E77A 2Z5LA 2XXBA 4PG6A 1YL6A 1T2AA 4TROA 1YJQA 3U4CA 4YXFA 3DZJA 1OAAA 3JQ7B 2R00A 4RVGA 4MVJD 3Q0EA 1BSVA 3GLQA 1TA4A 3U0BA 4DPKA 1QYVA 3P7MA 3HSKA 3GOHA 3RUEA 3BMQB 3U9LA 3BMCB 1A4IA 2NADA 1DRUA 5JNLA 3NRCA 4N5MA 2EEZA 4WE3A 5BSHA 1O94A 4XR9A 2D2IA 2B35A 1ML3A 1XDWA 4HNHA 4PLPA 1PS8A 3WGHA 1TEHA 3UHAA 1A71A 2DLDA 4DUPA 1LC3A 3V1TC 4NU6A 1BG6A 3S55A 1XG5A 4QEDA 5HTOA 3OJFA 5JDCC 3PWZA 1JVBA 5A9RA 6LDHA 1VJ0A 1M67A 4LVUA 4F6CA 1R0SA 1NWCA 4A0SA 4U6SA 3R0IA 4BNNA 4F3YA 1S6YA 5A9SA 3U5TA 4BNUA 1ZJZA 5G4KB 1T2CA 4CM5A 2Q1WA 1WDLA 1E1NA 4OAQA 4GX0A 3C1OA 1C1DB 1DFGA 1WW8A 4Y6SA 3A14A 1OOEA 5AXDA 5CDGA 4HKTA 1AHHA 3PVZA 3TFQA 4AJEA 4HBGA 3BMNA 1Z7BA 1YXMA 3CSDA 5HS6A 2OO5A 2ZB8A 4YRBA 4CMCA 4CLOA 1YKFA 1PJLA 1Y9EA 2YFHA 4CMEA 4O1MA 4ZQBA 2Y1CA 2HMTA 1QV6A 4RJTA 2EWMA 1HYGA 5FFFA 3GFBA 2X0RA 3ADOA 2FR1A 1I30A 2PH5A 2QRLA 2DKNA 5A1TA 1NQTA 3C1AA 1NPDA 5IDWA 5JYAA 3QLJA 4GLLA 5ICSA 1GTMA 1OBFO 3K73O 4OXNA 2P91A 1N7HA 4UUOA 1GY8A 3UICA 3WTBA 3KVOA 2ZYAA 2TMDA 3AOGA 4J0EA 4WOJA 4ILKA 4U5QA 1LNQA 3IAHA 3U3XA 4D0SA 5KCZA 2HQ1A 3DAGA 3H65A 4YRAA 3FF4A 3G1TA 3I4CA 3ZV4A 3SX2A 1I10A 4XGNA 5JY6A 1DPGA 1GYRA 4L76A 3OETA 4W99A 3UAGA 3WR5A 4B7CA 1Q2XA 1GQQA 3TDKA 2GCGA 1GCOA 1I01A 2C54A 3VC7A 1B8UA 3T7CA 1DIRA 3CXRA 2QIOA 4RLHA 3GRPA 2FPIA 3LC7O 1Q0HA 4O5OA 5KVVA 4IXTA 3CUKA 2VOEA 4P38A 5T64A 2AEMA 3UW3A 1J5PA 1SOWA 3NKLA 4R1UA 4XYLA 2IZ0A 3PWSA 5EQFA 4UVDA 2E49A 3QY9A 3AW9A 3D5QA 3GY0A 5CDSA 3ON5A 4ZA2A 3VAZA 3F3SA 1LEHA 3P2OA 1VSVA 1R16A 3F1KA 4OYRA 4D41A 1HDCA 1CRWG 2CVOA 3OBBA 2I9PA 4YJDA 2X6TA 1ZK0A 3K8ZA 3FWNA 3GUCA 4J4TA 3WIDA 2OP0A 3RUFA 3TWOA 4L74A 4KQXA 2X4GA 3T4EA 1BDBA 1C0IA 1FDVA 2WEKA 3GAZA 2I66A 2WTBA 1R37A 3JYQA 1UXHA 4UVEA 5K0ZA 3BMCA 1N5DA 2PFGA 3AM3A 2HK8A 2NQTA 1I3KA 2TMGA 4KZPA 5H81A 1T2DA 4S3MA 4BL5A 1NPYA 2IYOA 4E5NA 1DC4A 1O9BA 3PGXA 4L4SA 1W0CA 2FR0A 1U3TA 5IZ4A 2VRCD 2X7HA 3JQDA 4GBJA 4YJFA 1EMDA 5AXAA 4QO7A 4ZJUA 1E7QA 3I9KA 4KWHA 5CP8A 4BVAA 3VPGA 4UEJA 1W4ZA 1U9JA 3IJRA 5I9LA 5JE8A 4OMUA 1TT7A 5BSFA 4XJSA 1V0JA 5TX7A 3PIIA 2PR2A 1B3BA 3CMMA 5G0WA 2ZK7A 3K5PA 1GUYA 5L7YA 5ITWA 2P68A 3ZWXA 1T24A 4F45A 5J23A 1CETA 2EERA 4INAA 3AI1A 3EK2A 3U4IA 4UEKA 4MJLA 2Y99A 4DXHA 1JAXA 3ABIA 4BNHA 3OECA 2XF8A 4HP8A 4FD3A 4BNGA 3N74A 2O3JA 3WQRA 4WNIA 1P45A 4FPXA 2C7VA 3PP8A 1NR1A 4M8SA 5G4KA 1YQDA 5JAMA 1K89A 3GH3A 4PLYA 3RBXA 2B4RO 2H1SA 1NHGA 3GN1A 2UV8A 2BF7A 3DBHA 5C7IO 2HO5A 1GEGA 2HJRA 4YJGB 1BDMA 1PZFA 4Z0TA 4JBHA 4JQCA 4E13A 3M2PA 4YJGA 5CG2A 3K2EA 4BV8A 4B4UA 4GPD1 2ZTMA 5ILGA 3TZKA 2H5LA 1NFQA 1CIVA 3O8QB 2DT5A 5EESA 3S1LA 4IDFA 3HDHA 3NYWA 2OGUA 3SJUA 5H82A 2EJVA 1DC3A 1BWSA 2D8AA 3EAGA 2G0TA 2RCYA 4U7WA 2D0IA 3PYXA 1AXEA 2JD2A 1ORRA 1B8VA 1HEUA 4BO5A 4CQLB 5CG1A 3KTDA 1SEVA 3WLEA 1PJSA 1QXSA 3DB2A 4XD2A 5JAIA 1PEDA 3G79A 1ISGA 3BHIA 3RBVA 3PZBA 3WGYA 3FNHA 2WE8A 5B12A 4MVJE 5H83A 4XJTA 4XQ9A 2H6EA 2B5WA 1NBOA 4CLEA 4EZBA 3GEGA 1RWBA 4J1SA 3GNSA 4Y6PA 1GPDG 3GVHA 1RM5A 2HK7A 2QZ9A 3H8VA 1BW9A 1L1FA 5M6DA 3RQSA 3UF0A 2OUIA 4NU5A 3ZHBA 3ZWWA 3WNQA 1TI7A 3DHNA 4ITUA 3H9UA 1R66A 5TSDA 2Z1NA 1MFPA 4CQMD 1E3EA 2BFAA 4EUHA 1V9LA 3H9QA 2VHWA 3C8MA 4GMGA 4RPGA 4U8GA 4URFA 4IS3A 5U4QA 4IGFA 3OJEA 3ETEA 4B7XA 2IODA 2GR9A 3DQPA 1LLUA 3EZYA 4D3SA 4OQZA 2AE1A 2HRZA 3IP1A 2VUTA 1GYPA 2PZMA 1DC5A 4LCEA 5EIOA 3WYCA 1ADBA 3SLGA 4ND3A 1U2GA 3V1YA 4FFLA 1YDWA 2IZ1A 3DZGA 1BW9B 4CV3A 1BXKA 4J7CA 2O4CA 5JY1A 4I8XA 3ZU2A 1K3TA 5GZ1A 5TQVA 4ND5A 3Q2IA 3RJ5A 2C2XA 3ZGYA 1N9GA 3DBLA 3SC6A 3LC1O 4O6VA 3ZWYA 1LUAA 1XQ1A 1OI7A 1PQWA 1D1SA 1O5IA 1X1EA 1NM5A 2Y1EA 2UYYA 1ZXLA 4BO0A 2EP7A 1LDYA 3AUUA 3M1LA 3ROPA 2RH8A 3MTGA 1H9AA 2JD0A 1GZ3A 2DTEA 3QW2A 2PD6A 3MJEA 4ROSA 2HMWA 4MINA 4A5OA 4AJOA 2A92A 4C4OA 5IFLA 4EUEA 4KTVE 1GQYA 4FFMA 4UVGA 1TXGA 3WGTA 1B7GO 4N7RA 3JQGA 2I67A 5TLSA 1C0KA 4IBOA 3HJAA 4ID9A 1WLYA 2ZB4A 1EDOA 4CM7A 1JU9A 4FJ1A 3QV1A 4D79A 3INGA 3W1VA 3OJOA 5F1PA 1DIBA 3QHAA 2QHXA 1Z7EA 4B4OA 4GX2A 2Q49A 4XQGA 4AJKA 4PG4A 3DBHB 3CIFA 4NHEA 3OJLA 4HFNA 4J7XA 3EVNA 3E9QA 2I6TA 2D3TA 2R00C 5I9NA 4A73A 3FTNA 4E6PA 4K1LA 2VTDA 4IZHA 3ZWCA 2ZJ0A 3JQFC 4XB2A 3GQVA 4UUMA 3ULKA 3VH4A 1IYZA 4L4RA 2Y0CA 1IULA 3ZH2A 3OIDA 2CZCA 4JP2A 3WJAA 5L3ZA 1X14A 4DMMA 2A4KA 1LC0A 4TSKA 2O4UX 4BMVA 4XGIA 3TJRA 1ZXBA 3ZHXA 3WSWA 3OQ1A 1ZNQO 1UDCA 1JKIA 1M6HA 4BQPA 2O3UA 2NM0A 3PHHA 4RLSA 1JLLA 3NGLA 1Y8RA 3LF2A 5U1PA 5LDHA 3FR8A 3NT4A 1VE9A 4D44A 2O3RA 1I36A 2X0JA 1UXIA 2GN6A 3N58A 3DZHA 4R1NA 3QVXA 1VPDA 2JAHA 4JXKA 1U7TA 3V8BA 3TL2A 1W8DA 2VHXA 4B4WA 4W7IA 3JQBA 5JCXA 1E1KA 3O4RA 2FY8A 1F06A 1VL8A 2VQ3A 4ND1A 4TRRA 1IPFA 1ISIA 3SLKA 3FI9A 1PGQA 2GLXA 3QVWA 1XSEA 4Q3AA 3I23A 1A9ZA 4E2ZA 4OGWA 3PHJA 4PZDA 4HY3A 3AM4A 4TVBA 1I3NA 1MX3A 1CDOA 2I5PO 1MUUA 2NQ8A 4DQVA 1P1IA 4TQGA 4CJXA 4ALKA 2PY6A 2AG8A 3GPDG 1U8XX 3PYMA 2JL1A 3KO8A 4R54A 3E03A 1GADO 2XPCA 3EMKA 3FCOA 1I5RA 2B0JA 1NNUA 4MP6A 3FSRA 4B3IA 3ROKA 1I32A 1D7OA 3RROA 3GC6A 3SVTA 4I9UA 3GGOA 1HSOA 3OJ0A 3PFFA 1XEAA 1D8AA 1KEPA 2Q2VA 1XCBA 4D43A 3GMSA 3G49A 3QWAA 1VKNA 2X5JO 1CERA 3AI2A 3PQEA 5COBA 4J49A 4CR6A 3PI7A 5K6AC 1ONPA 3WGQA 1TB4A 1NX6A 1DB3A 1Q1NA 2LDBA 1XLTA 4DC1A 3QJ5A 1LBEA 1P74A 3FWZA 1NVMB 4W82A 4BO6A 3NJ8A 3ITDA 4IY1A 4JIGA 3LT4A 4RF5A 2OORA 3JV7A 4MP3A 1HDXA 1S7CA 3WFJA 3LLVA 1ULUA 4OIMA 4DLBA 2E6UX 3RD5A 2JCXA 4UULA 1IUKA 1JAYA 3L07A 3JQBC 4E3ZA 4UUNA 1GFSA 2V6BA 3ZU4A 5CDYA 2O48X 2J5KA 1SC6A 3EVTA 2AHRA 4MVJH 1MGOA 4XDZA 1MB4A 1A7KA 4KWIA 3UXYA 1B14A 4ZGWA 3V2UA 2DQ4A 4TRNA 1EK5A 4YAGA 3ZV5A 1UH5A 4YT2A 1T25A 3JTMA 4H15A 5TJ9A 2D1YA 2JHGA 3CEAA 4FW8A 1B16A 4MVJI 1B2LA 4EBFA 4JCOA 4JP3A 4GX1A 5KJEA 3F46A 2J3IA 5A9SB 1PGNA 2C20A 2XOXA 2ET6A 3AY3A 2OOSA 4MVJP 1NHWA 1RPNA 2W4QA 5KJCA 2BI7A 4Y9DA 1QYCA 1E5LA 3HNPA 3GRKA 3C85A 4WLVA 1ZKMA 2NACA 4NIMA 2C07A 3NTRA 1BXGA 4WECA 2QX7A 3FD8A 3MJTA 4RVUA 3X2FA 5JFOA 3UKOA 1P1KA 3QIVA 4IDAA 3QVSA 1YGYA 1IB6A 3H9JA 4U6QA 3HQ4O 4XRGA 3W8DA 1I3MA 1YDEA 4NG5A 5LCXA 3I5MA 3CMCO 1KEVA 4FQ8A 4WCDA 2FMUA 1Z6ZA 2EW8A 3JYNA 4JROA 2H63A 3KV3O 1M76A 2FZEA 2PLAA 5K9ZA 2GDZA 3TN7A 5KVSA 4FCCA 1YBAA 1MG5A 1ZK4A 2WYWA 3OMLA 3ZW9A 4BGVA 2VN8A 4LRTB 1NFFA 1P1RA 3WGZA 1BRMA 4XA8A 4IIUA 3KYCA 2CDCA 5DP1A 4KDEA 4LRSB 1B8PA 1M66A 2DFVA 3ZWVA 1VL0A 4WPGA 2BKAA 1AGNA 1U5AA 1RM4A 1OFGA 3OEWA 4YWJA 1G0OA 5EINA 3DOOA 4N5NA 3KOUA 1R12A 4BGUA 1FJHA 2CFCA 3GK3A 3WS7A 3L4SO 1A4UA 1T26A 4KMSA 1U2DA 4BKPA 3RU7A 4JJIA 2Y1OA 4FGSA 3RASA 3E5RA 1QYXA 3DAFA 1HSZA 1WWKA 1HDYA 1ZEJA 5KJ6A 1E5QA 3PZRA 3ZWAA 4E2WA 3NEPX 1N9GB 3DBLB 4J91A 3QVOA 4RZIA 3AY6A 1YBVA 1Y9AA 3IKVA 5BNFA 8ADHA 1R4MB 1YONA 4PN3A 3HFGA 3QWIA 4YACA 1FMCA 5L53A 3ANLA 3P19A 3ZI0A 1ZEMA 4GAEA 1PZEA 2IXBA 1UDAA 5B4TA 4RF2A 3KZVA 3ZWNA 1OZAA 1LQUA 4CM4B 4O0LA 2ZCVA 3U4DA 1G0NA 2F1KA 3BXXA 5JMWA 2Q45A 4KTTE 1GZ4A 1LDNA 1DFIA 4EI2A 2EIHA 2ZTLA 4XRRA 2RIRA 1AE1A 5G0VA 3F6YA 3T4XA 1ZSVA 1VI2A 5ER6A 3JQAB 2P9EA 4I1IA 4OXKA 3INTA 1RM3A 1HT0A 4DQUA 4MVJF 1N7GA 3PJDA 4FIZA 1SO8A 1RKXA 2YJZA 4XWYA 2O3QA 1ZK1A 5B4VA 2DUWA 4BMNA 2UVDA 2C82A 4JNKA 5L7WA 1QORA 3B70A 1DXYA 1UXKA 3GGGA 4QXMA 2P5YA 1MC4A 1PL6A 2E4AA 3KSZO 1BXZA 4CUJA 1ISMA 1JDJA 2W98A 3RUCA 3AU8A 1NTOA 3GZNB 2GSDA 4FFPA 4WKGA 4MKRA 3M2TA 1YH3A 4BKRA 3T7EA 3GZ4A 4DYVA 3ZW8A 3UGKA 4I5FA 3L0DA 1N92A 3OEYA 3V2HA 3IUSA 1LRJA 1YJ8A 5JLAA 4R69A 4BNZA 4IQ0A 2HKIA 1G1AA 4M89A 4DBZA 4ND2A 3ZHZA 4PLWA 2CMDA 3RC1A 1WPQA 1ADCA 5JAZA 4K6CA 1Y81A 2EP5A 2R6JA 5CEJA 5AXBA 5HRUA 2WD7A 2YHIB 1QSGA 3DBRB 5ES3A 1DIGA 4CMBA 3AFMA 3F5SA 2VZ8A 5G4LA 3FHLA 3UOGA 1DAOA 3ANNA 3WLFA 3L77A 3OIGA 4GGPA 3ZWPA 2YV2A 2I3GA 3KSDO 4IPTA 2A9FA 4GSLA 4BO3A 3L4BC 1T4BA 5DULA 4A26A 5DOZA 1ZJYA 2BMAA 3GVPA 3H5AA 1EE9A 4GH5A 1FDSA 3WB9A 2W8ZA 2PH3A 4R3NA 4PGFA 3JYOA 1B3RA 1W6UA 2VWHA 2O23A 1R6DA 3BMOB 1DBVO 3MZ0A 1GYQA 2Y93A 3V1UA 2Y67A 3TRIA 4ALNA 1C3VA 1BXGB 3ANMA 1P0FA 4IJVA 1B15A 4B8WA 2FSVA 2H9IA 4Z3DA 3F4BA 3PQFA 4GKVA 1F17A 1UP7A 2G1UA 3HDQA 3IS3A 2HU2A 4BUCA 3HN7A 3ZNQA 3ST7A 2BGKA 5T73A 4Q3EA 4UVHA 4EEZA 1HDOA 4L4XA 3P5SA 2P4QA 3MWEB 3HE3A 1JN0A 3RUIA 4H16A 2IXAA 1X1TA 3ONDA 1M6WA 3ZWBA 4TKLA 3OHSX 1ZH8A 4JK3A 1BHSA 3WGIA 1YWGO 2I76A 5B4UA 4E21A 2YQ5A 3INRA 1R4NB 1C14A 3V2GA 4CMHA 4F6LA 4CLRA 3MWDB 1KVTA 3JQAD 4E12A 3KYCB 4GX5A 4CMIB 3PGJA 5DP2A 4ZQEA 4K6FA 5KJ1A 5A3JA 2VNAA 1LRLA 2B4TO 5I9MA 1UUFA 4X54A 3ZU5A 2VYVA 2FZWA 4XKJA 1A27A 4JN6B 2CNBA 3S2FA 3GFGA 1ADFA 1SCUA 2PD3A 1EVYA 3OH8A 4IMRA 1LQTA 1P1HA 4KDFA 5L95A 4MVJM 4EDFA 3HADA 2B36A 4GGOA 5KTKA 4PRLA 4MIYA 1RM0A 2BLLA 4DLAA 3JQGB 4CMGA 1PX0A 2RAFA 4J4HA 3BTSA 3E9MA 1I2ZA 3C1TA 4QUKA 5A3VA 3I52A 4M49A 1NP3A 1XKQA 2ZCUA 5L45A 1Q0QA 3PHLA 1VLLA 3L6DA 4NNJA 3GUYA 4MKZA 5F3RA 5IAAA 2PNFA 3AUTA 3UN1A 1N2SA 1VSUA 1PJ3A 2J3HA 2O2YA 2VHYA 2WD7B 2ZIZA 4U0KA 2ZJ1A 4E0BA 1XA0A 1N1EA 4RPKA 4CM3A 3TZCA 3QA9A 2JHFA 1HYEA 3C24A 1I33A 2OHXA 3ZWMA 2G17A 4DPLA 4II2A 3EDMA 5L4SA 4B3HA 2RH4A 3NGXA 2YHUA 1GZ6A 3VKUA 4EITA 4PG8A 3D3WA 2VRBA 1KOLA 1P9LA 3JQFA 1MXFA 1T4DA 4RPJA 1UP4A 3GZNA 4TMFA 5KKAA 3DC2A 3EUWA 4ZICA 5ER9A 4NBUA 1PR9A 3F4LA 2O7SA 5COQA 3FPCA 4D0RA 3WNVA 4R68A 1H2HA 2Q3EA 1IOLA 1I2BA 1SEPA 2V65A 4IUYA 4E2YA 5L9AA 1ENZA 3LT0A 4IINA 3X2EA 3OICA 3E9NA 4HFRA 1K5HA
chains in the Genus database with same CATH superfamily
2XSZA 5G1OA 1MJHA 2FUG6 3GLVA 1T5HX 4IVQA 4HFMA 1A0OA 1INLA 2VNKA 1EX1A 1O89A 2PX0A 3I8OA 3KBBA 1QHHA 3MJ4A 2EJCA 2O0KA 3OQPA 4TKUA 5JZ9A 1ONOA 1W49A 2VHQA 3ZY2A 5BMOA 4DDWA 2ZW9A 2GYUA 2ILTA 3ITNA 3W4IA 4I1SA 4B6SA 4BFUA 4DLVA 4HNUA 1FK8A 4GNRA 3E8XA 2GF9A 2HPHA 2ZTUA 3AUXA 1E89A 3K1JA 4C2AA 3Q7EA 4IDDA 1G291 1HT3A 3P2KA 3RYTC 2HRDA 2BFPA 2JB9A 5JXWA 4B6RA 3HTXA 4Q05A 1N33B 1XQYA 2X9QA 1PSWA 2J3JA 4UNIA 1WX1A 2FG6C 3FBWA 4XX0A 3SYKA 2FE4A 2Q46A 4O4JB 4MGZR 4ESEA 4UZFA 3H0VB 1RPAA 3B1WA 5DM70 1JECA 3A1DA 3QE3A 3ENQA 4G1BA 3DSRA 2NU7B 5AXCA 3ESAA 5CK4A 4RTQA 5GZ6A 2IL1A 2JIRA 1JDPA 1ZZEA 3DOCA 1FSFA 3BMNB 1P62B 1P2GA 2VT3A 1DSSG 3RVLA 3VOSA 5EHXA 4XARA 5K8TA 5F12A 4JDPA 2GO1A 1ZQ9A 2XQKA 1P2SA 4IDGA 4G26A 2EKLA 4BQOA 1P3DA 4IJ5A 2AA3A 1AZWA 4JT2A 3EPJA 2F62A 4CT5A 5LZ4A 1EZZA 1U1IA 3LNCA 4N40A 2G6TA 2ZVQX 2Y0DA 5KWEA 2QTTA 2PKYX 2ICAA 4LHWA 1FNMA 3R7FA 4ZEMA 5DBIA 4IEFB 1QGOA 5EP1A 1XOIA 4RCVA 1LU9A 3O8QA 2IV3A 3ZVLA 1AUPA 1GXSA 3TBKA 4EECA 1C30A 1CYEA 1MP0A 1U0LA 1YR2A 4B3GA 4OL0A 3ZXSA 4AS3A 1CVIA 1L4FA 1MOPA 2IE0A 2R60A 4H0FA 1X7HA 2CNWD 4GP9A 1Y1KE 4MS1B 4MWZA 2P7IA 2GYVA 2WHEA 1IUPA 3LBYA 4HVTA 4R1SA 2Z95A 4BKMA 1E7YA 2BZGA 3U4QA 1CQPA 1EIWA 4AY6A 4TLBA 3SEQA 1YCHA 1ZM7A 3UM9A 4N7BA 1ST2A 3RSGA 1DC8A 4P92A 4PHFA 4LV5B 4FNAA 2PBZA 4C4ZA 1HRDA 4MQFA 1Z6QA 4YAKA 1QRRA 3MT8A 3GEHA 1JBQA 4PC1A 4EVRA 1B23P 1R00A 4OQNA 1R6BX 4DA9A 4EW1A 3CUUA 1XK6A 5E6UB 5H3CA 1IG0A 5JO9A 4BB5A 3OLVA 5KKCA 2ZATA 1OPRA 4I9HA 3RAPR 1JKMA 1E9SA 2Y68A 2VH5R 2FZVA 2AB0A 1FQWA 2IH2A 1G2QA 1ILWA 2WINI 3BH0A 4WSOA 3LECA 5DKFA 3RSHA 1J9EA 3O3OB 3R3VA 4D8TA 5B6IA 4R2KA 2JANA 2WICA 2PWAA 5IZCC 1XWIA 5LOVA 1YCDA 2JI8A 4MAAA 1E99A 3ZLBA 3LLUA 4M87A 4G81A 3NXSA 3PPWA 8ABPA 3PFHA 3LDGA 4ZU6X 5TPWA 3THWB 2XCOA 2JD1A 2BEVB 2O7QA 2ZE6A 1OLUB 4XQEA 4K81B 4L75A 5B2FA 4O8JA 4AK9A 4ER7A 4QGHA 4A8HA 1TD1A 2LKCA 2O8NA 3ONWA 3QOXA 1PGPA 5MN6A 1NVTA 2I3AA 3KWJA 4HQNA 3I9FA 1XYGA 3HB7A 3KQQA 5JNSA 4UREA 2NSDA 2HF9A 4FOOA 3D3QA 4HYYA 4PCVA 2WW8A 1HOXA 4Q1DA 1XNJA 2B2CA 4RHFA 1EXNA 1L5RA 2EX4A 2IELA 3MJSA 1SZCA 2QN8A 3HSYA 4YMLA 3JQAA 2BFBA 2P6OA 3GGJA 3OQIB 3OWXA 3R24A 5FPPA 4K5QA 4DKJA 3T7JA 2AC2A 1YBHA 1X0VA 5AOBA 1MVOA 2RJOA 3ONVA 4ZVVA 4RNCA 1GGNA 3N2LA 3PNQA 3IP7A 4MWBA 2VR1A 4ASUD 3KPWA 2YXEA 2DFDA 1WCYA 3TINA 5K09A 2YWFA 4D4KA 4K0KB 3GCWA 3R6WA 5JYFA 5LB4A 1VSQA 1B93A 1XNGA 4BECA 2YUTA 2V7VA 4S1TA 2N3ZA 1JFFA 4JLMA 4RD0A 5CX1B 5TQ0B 3L6OO 2FMFA 1K7CA 2Q07A 2IGBA 4Q21A 1HFKA 2OGZA 2Y4NA 2ZQZA 2CEAA 3I39X 1FSZA 1XVIA 4JU8A 3EIEA 5JR3A 2FPOA 3DWEX 4R2XA 4O2RA 4ZRDA 5T4BA 1O6ZA 1VSBA 4DRYA 2QEQA 2J9YB 1ODLA 1FP6A 1TEZA 2BFMA 4UTNA 3OKFA 3HM2A 3B6EA 4KIJA 1XXHE 3RG2A 9MHTA 1QK3A 4LQ4A 4OI2A 1KO4A 1GPBA 3LVQE 5A0TA 1X7YA 1QOQB 1Y7LA 3QWHA 2AQ8A 4WXMA 2H3EA 1JHQA 2H1RA 1F8GA 4TKZA 4C29A 3HKEA 2Z98A 3FOEC 1EGHA 5KO2A 2XBMA 5A3SA 1O97C 4FOSA 4RU1A 2XZLA 4QDOA 3GEEA 1I6WA 3IBCA 3S1AB 1WVGA 4NLLA 3WYEA 2FW8A 4JY7A 5KSYA 1N1GA 1KZ9A 4K9SA 3N2KB 3E15A 3JSAA 1QYIA 3Q87B 3FTDA 4Y0VA 4EHHA 5L51A 4PXYA 1E1LA 4M86A 2A9PA 1XD2B 2FWMX 1ADYA 3LVRE 4W1SA 1W88A 1OE0A 3OPMA 4ND8B 2IPAB 2PTHA 4U2KA 3WOVA 4AMGA 4BKQA 1YMQA 4GFDA 5FO0A 3B1JA 4RHEA 3V9PA 2OD9A 1AC5A 1EK2A 1CIJA 3QUCA 4A2QA 2FFBA 2XQGA 3K5WA 4TGLA 3WGGA 3OKAA 3OQ6A 1I7BB 3BF7A 1XMVA 3PKJA 3HCNA 4RQUA 1H6BA 1PR4A 1DAMA 1RWMA 1T91A 2EHDA 3X2SA 1A1SA 3Q8LA 5JAQA 3PEUA 1VXRA 3H87A 4MUMA 1JHYA 1KMNA 4DV3B 1HNXB 3DJFA 3QWFA 1VKJA 2YL2A 4IZOA 2EJTA 4QDXA 1NXWA 4UE3S 5DASA 1YTLA 2OTCA 5A5DA 5JNRA 4GF5A 4F1JA 3QITA 4PYOA 2JJ1D 3E2PA 3WNBA 4A6EA 2HLDA 1O03A 2HMSA 4IQGA 3L0ZA 3N6VA 1CUUA 3I6IA 2REQB 1PK8A 4Q4CA 4OBXA 3PC8C 4MEBA 2AMVA 4M3NA 1RZRA 5IKEA 1A5AB 1I7PA 5H9WA 2D5AA 3GYGA 2PXHA 4GVLA 3REQB 3JAKA 3SXJA 1P80A 4XB1A 2F1IA 2BEKA 2CUZA 4I1RA 4MV8A 2FVXA 1XRLA 4M83A 5EWMA 3FA2A 4XJXA 2GBGA 2ZYTX 1T3ZA 2R6ZA 3L0OA 4YMGA 3L79A 5AW2A 1VHTA 1RFGE 2XITA 3MJCA 1JILA 1XIVA 1B1CA 2EW1A 2G1KA 2Y1WA 5EUMA 5FBLB 2PZKA 4BO9A 1RMYA 4EG4A 1FNBA 3U7FB 4OFZA 3SFTA 3SZMA 4W5OA 1PNTA 1PJ2A 5ADVA 1DS6A 1Z4LA 4ZT5A 4FE4A 3QE9Y 1CF4A 1MX1A 4C0LA 1CJMA 1FVHA 1C8LA 2YZ7A 3GROA 4GG1A 4NBWA 5CMLA 4K9RA 4OJKA 4HX2A 2WZQA 4ZOEA 4AN0A 2BKEA 2VS1A 4EW6A 3UOAB 3MQFA 4DPMA 3PUZA 4LZZA 5DW3A 3EARA 3GELA 2ONJA 3TMAA 2I7CA 4MSUA 2FWRA 4RFVA 5ARDA 1DTWB 3ZKWA 2AQIA 4WXPA 2ZJ4A 4PICA 4L16A 5E1OA 3G9ZA 1GPAA 5AJXA 1OUMA 4KN5A 2Y1LA 2GVZC 4BV9A 1TZBA 3B7WA 4Z4FA 3V1LA 3AUFA 2PXXA 1M6VA 4PANA 4LI3X 4ZTZB 5DXFA 3U44B 2PU7A 3PF8A 5F1KA 5FYDA 3G9XA 5BUZA 3A28A 4B5LA 1E7WA 3CWQA 1QHXA 1XF1A 3RVKA 3SBEA 3K0FB 4QM6A 3H4VA 2Q28A 1KORA 3FYSA 2JJYA 1QV7A 5I7UA 3EC7A 4INJA 2E2WA 3I2HA 4G4JA 3WWZA 4DM3A 4P4NA 2F3QA 2FPSA 2PMBA 3LTNC 2MYNA 2DSNA 3R6LA 3VC2A 1ZW6A 1QP8A 2F2TA 2FX3A 5ECGC 1JAIA 1EUDB 3KUKA 4XFJA 3A2KA 4RHUA 4DV5B 4U9UA 5EHNA 2C5EA 4X24A 2EC5A 1FTNA 1O95A 5BOSB 2A0WA 4F11A 1CS0A 3QXSA 4UM5A 2FSSA 1T8UA 3MTJA 1Z5UA 2Q6VA 3GG2A 4B09A 2SNIE 5HDQA 1XF9A 3GLGB 3DCNA 1YNOA 3G2IA 4D45A 4WA7A 3REGA 2O50A 1LBSA 4IDEA 4YDHB 2PQ0A 5DHQA 5TNXA 3JQEA 4JJ4A 2H2HA 4LXYA 2OV3A 2R97A 1QGDA 5DTQA 3SMVA 1D1QA 1JKJA 1R2QA 4M9QA 2R8ZA 2VWGA 3H0KA 3KEGA 4IG9A 4MNTA 721PA 1COZA 3MINA 4LF9B 1WHSA 1RJGA 4L73A 5EJ4A 5DHTA 4N9WA 1OXTA 5AI5A 2JGDB 3ZCTA 3N7AA 1ILEA 4EG8A 1KDRA 1WBDA 4J0KA 3KQHA 4JJFA 1T4MA 1YVPA 2V6IA 2OC9A 2XECA 3CYFA 2JGEA 4RCYA 4ZAZA 1W2HA 5BWNA 1UAGA 5KS2A 5M2QA 1PNOA 2JZCA 2JW5A 4H1HA 4V0KA 2B83A 2NP6A 1XMXA 4TYWA 3OA2A 2XT6A 3ORHA 4LHZA 2AN5A 2K5UA 4CKXA 1MW8X 2YBDA 4PG5A 5K4HA 3V3TA 4ZQGA 1S3SA 1A72A 2FPPB 1JJVA 3CUSA 5JU6A 1SMKA 4WIAA 3UB3A 5FDFA 4WA8A 4ZMSA 3ZQKA 4YECA 2GGSA 1GV1A 4CDNA 1BA2A 1BS9A 2NZ8A 4DMKA 3N70A 3M9XA 2DJIA 5AT1A 1YDHA 2ECFA 1E7RA 1VL6A 2VDLB 3FAZA 5LR6A 4KQFA 2ZXFA 1KYWA 1JIVA 1X1RA 2VNHA 3KKNA 1NRIA 5H16A 4ISBA 2PA3A 3IDSA 3UJ8A 4O4IA 4JP8A 3GDGA 3PQ5A 1XZCA 4MYUA 1VZ2A 2ZR9A 1LPNA 2QTVB 3ITKA 3NIGB 3OZEA 3LKZA 4HQ6A 3W79A 3AVUA 3BRWA 4CM9D 1EVJA 1XQVA 1ZCZA 1L3IA 2VSOA 2J6HA 4JKIA 1T2VA 4V1CI 2COKA 1JNXX 2ZS9A 4L0QA 3QKRA 2ZYSA 3TOZA 2EZUA 2OWEA 4N5LA 1RHRA 2QJTA 4C0AC 4EJSA 1Y37A 3LP5A 1W36B 5F64A 4WASA 4NJOA 5IJ9A 2ZWAA 5JMOA 3MCVA 1IPHA 2JLCA 3KZKA 4YPVA 2JAWA 1CXZA 2FUCA 4LI0A 1KEWA 1REQB 3S8YA 2QENA 2NPOA 4C0WA 3I45A 1U31A 2N0SA 3OY7A 4D57A 4OX9Y 1SVKA 1XKLA 5ALIA 2C0QA 1NXTA 5GOZA 3VYRB 4HB0A 1HNNA 5IJWA 4JHXA 1FE8A 1KAMA 2ZAGA 4O33A 5EJ2A 1RXVA 3ORQA 1ZCJA 3MS7A 1N2JA 4R9NA 3A4IA 4YP7A 1M7BA 3JSXA 5K6TA 3B6IA 3CTMA 5BSGA 5DNDA 4BVHA 1R5JA 1QP0A 3GT0A 5JI2E 3BEDA 3JVIA 1QWOA 4C7JA 1ZONA 3AHEA 3V00A 3ER9A 2FDCA 3IEUA 5EJGA 5JZSA 2P1DA 3SPXA 3ANXA 3TCNA 4C07A 3BB4A 3LDHA 3WQQA 2R66A 3FNFA 2CUKA 2P9GA 3KTAA 3O82A 2J7PA 5JIBA 5HYVA 3PCXA 4WL0A 4QICA 4C4RA 3GBSA 1Z5VA 1JPJA 2WA2A 2A5YB 2PXAA 2ZUUA 3JRWA 2QYOA 1U7PA 2AOXA 3E8SA 3FTQA 3CE6A 3PFGA 1S9DA 1I2AA 4N49A 3WMRA 4EX7A 1JE1A 2RBKA 1IM5A 2G5GX 1C4XA 2VUSA 2IZ7A 3GPCA 4XIYA 5DNUA 3FOWA 4IRUB 1U3CA 1LRKA 1NOKA 5A71A 2G4LA 4YIKA 3SYRA 2X7JA 4F2HA 1H4SA 3LIIA 4BYMA 3ETGA 1TMYA 2Q8PA 3N5KA 2CJWB 2V5UA 1CNEA 3M5PA 3ZNNA 4KXNA 3ZYZA 4L50A 2EFJA 5J9FA 3LXMA 5B64A 4WNYA 1YA8A 3LGXA 4YAOA 3CC8A 5C3MA 1E3IA 3N0XA 1D4FA 5KWVA 2UYQA 3JQ7A 1GARA 4ISCA 4N8EA 1WXEA 2AYZA 2DBQA 3QP9A 3RIXA 2XTMA 5I51A 5TQ2B 4AROA 1WMAA 3NTOA 2I6XA 4HEA6 2PKRA 9LDTA 7YASA 4KG7A 1M2EA 2JCVA 4G0NA 1K6JA 1KJ8A 4Z2YA 2NPFA 3AHHA 3TH5A 1VBMA 1XGKA 4WEQA 2GTHA 2ATIA 3HKDA 4WADA 3ZZTA 1ULAA 2Q5CA 4R2JA 2CJYA 3BWEA 5AKGA 3RAGA 2GPAA 2VXYA 4FZRA 3VPFA 3X44A 2DSTA 1RJEA 2FUNB 1SXPA 1J1ZA 1LI4A 4GIBA 2BGLA 4CIDA 3QSGA 3K70C 3R74A 5DYYA 5HA5A 4JT8A 2IYPA 1UQUA 4NH4A 1HXHA 4DCJA 4XCQA 1J39A 1SHKA 3STUA 3WL4A 5DGXA 1EFRA 5IRCD 2BH9A 4IIDA 2P9TA 1CUIA 2W6OA 4KV9A 4NZYA 3TZQA 2VK8A 2EV9A 5CNMA 4JEMA 1XXHA 4NJEB 1TIPA 1L8AA 3AUAA 5CIQA 4URZR 1GAEO 2AZTA 3JRNA 1M5UA 1T8PA 4CL0A 3P94A 2O3SA 1D2CA 1T2EA 4Q34A 5LOVF 4MUHA 5FR2A 3TCKA 4FB5A 3TKAA 2ZJ8A 5U4XA 5BR7A 5K8UA 2OT3B 2FFQA 5KYNA 1XEWY 3K9CA 4LE2A 3L0IB 4ZOQI 2CSUA 2JI7A 2RI1A 3GVCA 1EUCA 5DGTA 3PQ2A 3FHJA 3FZEA 3GCGA 5BSWA 4FCWA 3BZUA 3Q1LA 1VE6A 4DR7B 1GOTA 1FP2A 2ANBA 3R3WA 4MW7A 5DTJA 5AVOA 2HBZA 3GR6A 3I1FA 2OQRA 1R9JA 2GYWA 4KE6A 3T7AA 4B85A 4TRMA 4R01A 3DE1X 1RLOA 4R8VA 5TDHA 3UMYA 1E2GA 4QLBA 5CDHA 2CV2A 2YRFA 3BE5A 4MW4A 1VPVA 4KP7A 2NNLD 1E6KA 2EZ9A 2EIXA 3QRWA 3VKFA 1YU6A 1MAVA 4IYJA 1ZS9A 2XV1A 4MUGA 3C48A 1U0JA 1OBOA 2HCBA 2Y1GA 3HYLA 4J07A 1YZ3A 4KGVA 4EB0A 4ZK2A 1FJXA 1WW3A 1ZK3A 1V48A 2HPAA 2IY7A 4I66A 3BF8A 4EG0A 2B9EA 3L40A 4K28A 4AY5A 4RKWA 3W6UA 1VFNA 1FFGA 4KLRA 7AT1A 4LOAA 1ZD5A 3NORA 1BNCA 3G9UA 4FZ5A 4H0NA 1J8YF 5I8PA 4Z4GA 1WQ4A 2NZ2A 3EQ8A 4HUJA 3SICE 1RP7A 4UZSA 3NHBA 1H5QA 2BP7A 3HJGA 4LPKA 1FTWA 2Q5IA 2W6MA 4FTWA 3WLHA 2C3OA 3RRYA 1K6MA 4DXAA 2QOEA 3A9WA 1Z18A 2GN2A 1XN4A 4FNOA 5BNIA 4L3OA 1Q7EA 2IZZA 4LJAA 4RD1A 5IF9A 4NDZA 2VJYA 2ZM6B 2QNBA 2A0KA 3QQPA 4AN1A 2JS7A 5KTTA 1UDBA 4ZU1X 1LF5A 1F8UA 2YNMD 4FXOA 1VHDA 2X2OA 1E7SA 3RRXA 4W5NA 1L8XA 4JLKA 3E2MA 3RS9A 1DBRA 4NP6A 2V98A 3V2HA 4L9AA 1G4AE 1IH8A 3GDOA 3N8HA 4JLVA 4B3DA 4L8WB 3DDCA 2X6RA 4QJ4A 4B8ZA 2C61A 5HOEA 1GTJ1 1IUOA 3QVLA 2XE4A 2VA8A 4HTFB 2XZPA 3Q3EA 4F46A 4OI0A 2E4XA 2H2GA 3KYDA 2P62A 3B13B 3OE4A 1V1MA 2DGDA 5DSZA 5T8KC 3RARA 3D7MA 1M10A 3ZD6A 4ZOBA 5KYUB 3WDSA 2X8BA 1NBWB 2TSYB 3CH4B 1JX6A 3GAAA 3HMKA 5E2BA 4ZI2A 2PCJA 1UJBA 2XTZA 2R751 3EH2A 2QX4A 1IZ9A 3V7WA 1KC3A 2JFBA 1G5QA 2ROQA 5CVCA 2ZYGA 3Q3HA 1JMYA 4QXAA 4P93A 4ZD6A 1U1DA 3URMA 1EXDA 2IOHA 3S8MA 1S9HA 1SZJG 3N39C 2QT1A 1DX9A 1X7XB 3WAJA 2ID7A 4X45A 5LQUA 5AVXA 3ADBA 1BS2A 2HL6A 3L6CA 3LQFA 1UPUA 4D25A 5LQRA 1GGVA 1PS0A 5FI0B 3OIWA 3GB9A 1FP4B 3IOEA 2I54A 4IIBA 2VI5A 2XGOA 2YWGA 2ZJ2A 1WXQA 3IHLA 3KTAB 4G1CA 5EMJA 5KAPA 3JD0A 1JB9A 4FMPA 3T15A 3EX7C 1Q12A 3TBHA 4AJ9A 2NU6A 2PUWA 2VTKA 1N0IA 1Z29A 2R2GA 1QWSA 2VDKB 3LTEA 5E4TA 3ETLA 1EG2A 1UC4B 2Z9DA 3UB2A 3ZVNA 4JQOA 1PZHA 2J5XA 4MRVA 4WFIA 4CG3A 3DOJA 3HHEA 5KDDA 1BXRA 1XA3A 2JLSA 5C81A 3DC7A 1RQNA 2W6ID 3FYDA 1XO1A 2R1VB 2VOJA 4PX9A 5DF1A 1ZYUA 4S24A 4Y1FA 1ZN2A 4PO1A 1Y6QA 2YV1A 1NZJA 3E8MA 3LBFA 2BGUA 1TLLA 2EWWA 3L7OA 3VKVA 1XD2A 4WKBA 5IT0A 1YZHA 2D1SA 2B3TA 2I2WA 2WYVA 3CRRA 3IUEA 3KB1A 3D6JA 4EL0A 5JRDS 4QXRA 1U0BB 4P4SA 2RI6A 4E03A 5KX5F 1SBYA 2RHBA 1QH1A 4FQ7A 4Y9RA 5EVCA 4A03A 4LYGA 2J3KA 4LOJA 5LQAA 2QW1A 2AHOA 3NOVA 3EMDA 2PUFA 4HVCA 1K8RA 3L18A 5C5DA 5JC1A 2FPKA 2HV9A 3A1SA 4Y2XA 3KQLA 4HWOA 1AKTA 1FC0A 2DTDA 3IC5A 1NMYA 3C3PA 3HABA 1G9TA 1SKYE 4AFNA 3HKBB 3LUAA 3AJ9A 1TPYA 4ASUA 2H1VA 3H2ZA 4TVSA 1M2OA 3NDJA 4ZVRA 4IWYA 3GBVA 3M83A 1EDEA 1AIPA 1E32A 1RKBA 3QFCA 1U1CA 5B1IA 5I45A 3WKBA 2VP0A 4TT8A 3AVVA 1LX7A 3O2NA 1DPFA 5CJJA 3SP1A 1GUDA 4G2NA 5C4MA 5CFOA 3VH3A 1PFKA 5JVDB 1SB8A 1SBNE 1U3WA 1G9SA 3P52A 3G6KA 5DV9A 3U5ZB 1P6XA 4HNGA 3A9VA 4MWCA 4ZQCB 1NTRA 3FPLA 3GLFA 2IXTA 4ZHSA 4NONA 2ESRA 1OX4B 1EUYA 4IHJF 3GZTB 4KVZA 1Q7GA 2NLOA 2ODEA 2XUHA 3QBEA 4YQYA 4X64B 5LP6A 4ZYVA 1JIXA 3MS4A 4NG4A 1Q95A 5A3RA 1VOTA 3EA5A 2PZ8A 2DM6A 1XYVA 1GD1O 4ZFNA 1TJNA 3H5LA 3F97A 4HDRA 4WOPA 5K8LA 4ARZA 4MPDA 4KR0A 2VDWB 2Q3MA 5KVCA 1JQKA 1XAIA 4IDCA 4LXTA 3ZIAD 3O83A 5E2IA 1JI3A 3T61A 4AC9A 1ZSYA 4YAIA 3OG9A 3C97A 2HIAA 3VI3B 3VZSA 1KFKB 3L7AA 1ACLA 2CHFA 2ZIFA 4H7PA 5AW7A 1YQGA 2ZYHA 2AKAB 2BFEB 3NATA 4HTFA 2WWFA 3M5CA 2AEJA 2GXQA 3OSZA 4WRRA 3TJMA 1T0HB 4EARA 4TQAA 3P2EA 2G77B 3H1PA 3I9LA 4HYEA 4N6NA 5JFTA 1ECPA 4YP9A 3K70B 2HD4A 5GIOE 4BP3A 5LFAA 3ZN2A 3MUFA 2AG1A 2AV6A 4C0QC 3BTVA 2V7BA 2FPIB 4FCVA 2PLWA 4XQCA 4BNTA 1JJAA 3HVJA 4ZOLA 1JA9A 3NHFA 4TRJA 4PSUA 4XGKA 5DHPA 1T1JA 1X13A 4H6WA 3IVRA 2Q4BA 4UBMA 3E84A 5C3UA 2GZ1A 4DCMA 5ARBA 3CPSA 4W8HA 4CMIA 3N86A 3V2IA 4MYSA 1AHIA 3FRIA 3L8FA 3KUCA 5AYVA 2YFQA 3VOTA 3KVRA 4Z51A 5C35A 5FPKA 2Z4RA 5LPNA 1M2NA 2UZ0A 3HWWA 2X41A 1KY5A 2I91A 1P75A 3EBPA 2ZRLA 5A6VA 1Z88A 1IZ0A 3IKLA 1FNDA 2IWRA 4BEJA 3N3AC 2WJWA 5GIPE 3M6WA 1EWTA 1GU0A 2HMUA 3KUXA 1ZKDA 4LVOA 3DTTA 5HGJA 5ERYA 4P86A 4YN3A 4AJ4A 4O5AA 4M1QA 3CH5A 2Z2YA 2XEDA 5FPQA 2H2IA 3HZRA 1GQFA 1K68A 4XYBA 1WF3A 5DCLA 5JCPA 3ZE1B 3HJFA 3GP5A 1GKYA 1XTZA 2QD5A 3ONEA 3AEYA 4UBOA 4I8DA 4BO4A 5L3QA 4HPXB 2AGVA 1VG0B 2X8LA 1F8FA 3A9SA 3B6JA 2REBA 3OD5A 4HWRA 3ZWDA 5JSUA 2O8DA 2WUVA 2WUWE 3QX7A 4FD2A 5DCWA 1TK9A 4JR1A 5BUQA 3F5FA 1E9EA 2YQZA 4PG7A 1IBSA 2KBEA 3L0SA 3FPAA 3PGKA 3ROTA 2JA1A 3TPCA 1B0AA 4K9DA 3SQNA 4U9HS 3AY7A 3C74A 2VWPA 3FLMA 2I4RA 4ZO7A 2YXPX 4N48A 4CMKA 4P3PA 4QEKA 1AKEA 3UY4A 3DLBA 5JJIA 4ZCMA 4C04A 2CEKA 2Z43A 2YJNA 1JTVA 1K6IA 4UUAA 4HK4A 1I5OA 1NP7A 5U9CA 4JBNA 4RIHA 5EWLB 3LP8A 3FUCA 4NFHA 3WIEA 4I1PA 3BILA 2Y6UA 4TUYB 3G68A 1JQAA 5HGXA 3G8AA 3A3NA 3AIMA 1X7ZA 4REOA 5DI9A 3HG7A 2FKNA 3K0EA 3O8DA 3BGOS 3ZNPA 3N0TA 4ARBA 4C4XA 2VYVD 1J9GA 1FSGA 1FUKA 2HQOA 4OQMA 3SC2A 2VCYA 5KYVA 4WCFA 4P36A 1AQYA 1ODTC 1HV8A 1SCAA 4Q0MA 1EB9A 4D1YA 2JKZA 4K03A 4WXEA 3W7AA 2ID4A 2WWRA 2Y66A 3N9IA 2HSDA 2G76A 1Y5RA 3I2IA 4BE9A 4KXMA 4QARA 3ZY4A 4C9BA 2WFLB 1XQ9A 5G02A 3IKMB 1M3SA 2FHPA 3VBEA 3I2YX 1XLTC 3F8SA 3M9WA 4I5GA 1EVLA 2AFVA 2ZSJA 4YJHB 3WV5A 3FUUA 4DSTA 2FFAA 1ZINA 1R0RE 3B1XA 1ARZA 5EZ6B 5IBCA 4V0OA 4GVXA 3ZDFA 4NBLA 1KI1A 1IOVA 4UU0A 4YROA 1RNLA 1GPJA 1CY2A 3E82A 4H3VA 1BEZA 4DZRA 1EUCB 4MYHA 4HDRB 1KYZA 3D0RA 1YDFA 3ZDRA 3HJNA 4LXQA 1VL2A 4G8DA 1F9EA 3D8NA 3ZXIA 4WN9A 1MF7A 3LQQA 1DFHA 4FN4A 2VT2A 3AIIA 3EGIA 4CM8A 2VSFA 4IHKA 2PKQO 2QPOA 3BSWA 3IUQA 3MT7A 4J90A 4Q82A 1NF8A 2AC7A 1OBHA 2R8XA 3SYLA 4HLDA 5AFSA 4LRYA 1LJUA 4YR9A 5IN5A 1QB7A 1V5IA 4UVIA 4J8PA 1P1FA 3TZ6A 3HH8A 1C1HA 1PGJA 1LSUA 1NY5A 2J87A 2NU8A 1CWUA 4ND8A 5JAHA 3BJEA 3VOAA 4MQUA 4ZO6A 4BJ1A 1JH9A 2IS4A 2TMYA 4BYGA 2FZLA 4JV5B 3EXEB 1IIBA 1Z15A 3RSSA 3I61A 3RTBA 4NAVA 3WBJA 1WZCA 5EIBD 5KQPA 3CX6A 1BMTA 2HA5A 5K3CA 2XD9A 4BIIA 4FI3F 2ECKA 3R3JA 3KETA 1NQ5A 1WM1A 4GOJA 4JT9A 5CM8B 4E5SA 3IR7A 4HBZA 5C0OE 3KQOA 4I6GA 1FS6A 3JX9A 4Q1FA 3KZCA 3PIRA 3SLRA 2JJ2D 3GH1A 4QUBA 2QGFA 1NMSA 3KBOA 4R2HA 5CA0B 3TQQA 1ZGGA 5CJPA 3TSCA 2QX9A 2OBFA 4TLEA 4PE5B 3BCSA 6REQA 2Q1XA 1JEEA 1SIBE 3IMFA 2VAPA 1KEZA 4ZCRA 3HY4A 2WJGA 1N8KA 4WW0A 1GCUA 2VH1A 1QHNA 3PXCX 3QVUA 2DCUA 1XXLA 4RJLA 2D1RA 1O4WA 4EYEA 3F9CA 3M8KA 4N6OA 4NAHA 4P4GA 5ALQA 3NHAA 2H0QA 5A2GA 5SYAA 1SPXA 1A88A 2CNWA 2PANA 4DZZA 1QTNA 3LKVA 3I3SR 2J3DA 1E59A 2VP6A 5ITZB 3R5KA 2VPPA 5KNDH 2Y1FA 2GF0A 1L4GA 2ZVJA 1GPUA 3OBIA 5LOVB 1LGYA 1AKYA 1E3WB 1Z37A 3AI7A 2YN2A 4BNXA 1HZJA 1VE7A 2WFAA 2EJWA 3DCJA 1RVV1 2I4NA 3P4YA 4LNAA 4MCJA 3T0FA 4EKGA 4ZZIA 1Y6FA 4WGGA 1KSGA 2FHSA 1FFCA 1RJDA 3SKXA 2TRSB 1EFAA 1GITA 2H11A 1UMBB 3BH6A 4AJNA 1OH6A 5TQ2A 1ISRA 1Q19A 3R7DA 4NJEA 1QO0A 1I6LA 2A35A 4H4DA 3T3IA 4CFSA 5A5GA 3KEQA 5JXJA 3U19A 1FTGA 2CLDX 1L4LA 2X0IA 2J3QA 3DZ2B 5CPFA 4DDVA 5AHXA 4LY0A 3PNSA 3OIUA 1IZYA 4EFDA 4Z49A 4NI5A 2RCNA 2VSYA 3L8HA 4NBVA 4DV2B 1X7ZB 4D3YA 3O38A 3KUDA 3EZFA 1GP2A 4RJ2A 8GPBA 1E0AA 4FYWA 2WTEA 1IY8A 2XIQA 1UAYA 3ND6A 4OD0A 4YDSA 2QW8A 3TE6A 3GDWA 4XUGB 2DU8A 1FRVA 1K6XA 2J7KA 1FDTA 3S0JA 1EPUA 1J20A 1WS6A 4B9AA 6Q21A 5FLKA 3WSVA 2YIMA 1I0ZA 3NH9A 4JH0A 3N05A 3FCEA 1S2DA 1U2QA 1XMSA 1PK7A 4II3A 3RVMA 1T43A 4KV7A 5IG2A 4YO7A 2ENWA 4AYTA 3IBYA 2PMDA 2GPTA 2Z1DA 1VSTA 3TAXA 1QIKA 4GI5A 4LW8A 1GKKA 4Q9NA 3VZQA 3G23A 1NNEA 3TI9A 1F12A 5IKPA 5I8ZA 3U62A 3AM5A 4G4SP 1CQZA 1UADA 4A2CA 3C16C 2G72A 1ORIA 4BP8A 2OMEA 2YMMA 3UWDA 1R9MA 2H2FA 4LTNA 2OCDA 4QO8A 1IHDA 3HJCA 4NK4A 4AO7A 5EGSA 1LBIA 4QGAA 4E22A 3RUHA 5GWXA 2IQ5A 2VQEB 4OBEA 4WK2B 1QU3A 4AZ0A 2ASVA 3ET4A 5CT5A 2HMYB 4QRDA 1JKJB 3PTLA 4MV1A 2WJPA 2QXYA 1BQ4A 3GGCA 3F98A 2ZS8A 1YR9A 2A9KA 4YJ2F 2H16A 3HKCA 3P9RA 4LMRA 4LISA 4WBSA 5KI6A 1YBMA 1E2DA 1KTVA 1X87A 1ZW1A 2NSHA 1TK3A 5G3YA 1AJEA 2D0PB 2ZLBA 5B7GA 4D9EA 3UWKA 3AIOA 3ENZA 3ZJTA 4I8IA 3AO0B 4OFXA 1LY1A 2IK8A 5ES4B 1DJQA 2Q4OA 2V9ZA 2CDRA 1U5BA 3EYAA 4HS9A 4YUYA 3THSA 4ZVTA 3H2JA 3QYAA 3LPNA 2ZTVA 1U7ZA 5NLLA 5HIKA 3Q8MA 2ALJA 2BPOA 2WPDA 1ISFA 1U4SA 3B12A 1F1BA 4WI1A 4TSRA 5K3BA 3KKMA 2W6NA 1RYFA 2ZDQA 3J81A 3Q11A 1E5TA 1QZUA 3HUDA 5ILOA 1REQA 4KQCA 1QHSA 3CR3C 3V42A 5KVQA 1L5HB 1M8JA 3Q7SA 3DGEC 1XEWX 2CC2A 3MM4A 5E3JA 4L8VA 2G1AA 4A2WA 4IVNA 4QDTA 1L4HA 4TMZA 5B5SA 1FFEA 4MB6A 5I7HA 5ENDA 2QWXA 2V6GA 4JBIA 4DYDA 3OIVA 2GEBA 4BMSA 3C7AA 4XD7A 1DEXA 3HACA 4GYJA 2QG4A 4P54A 1AQNA 1UWVA 2E1PA 4F4IA 5B2ZA 4BEWA 1LSJA 3OJWA 2FU5C 4JYBA 2ZAOA 4B3RB 4UTVA 1XTKA 1C7QA 2J59A 1YB2A 4R41A 1JG6A 4PZEA 2GEFA 1RVDA 2FEAA 5JRZA 1W35A 4AS2A 2Z0MA 4H1TA 4F4CA 3LFUA 2ECPA 5LQKA 3BIJA 3SXPA 1M74A 4HWTA 5EAIA 2GNAA 1XLUA 2FN7A 1WDKA 2PJUA 3U4MA 3O47A 3GNTA 2H0RA 3WQBA 2YIVX 2C5AA 2WYUA 4GLOA 4OQYA 1RQGA 1FBTA 1UBLS 4IXMA 3RUDA 4WXRA 5AJTA 4CDMA 1XP8A 2KB0A 3E48A 4GQIA 3DXYA 3K6SB 1EQAA 1MO2A 4RD2A 1L7DA 1N0HA 3G5LA 2CJWA 2UUOA 1CQIA 3Q9SA 3T9CA 3ZOZA 4OHYA 2RAVA 3AXTA 3VHLB 1IVSA 3IGFA 2X8JA 3LY7A 2HJSA 1PT6A 3AUJB 3ETNA 5DLYA 4CNBA 5HF8A 3L8YA 1L7BA 5DXAA 3PE3A 4EVSA 3TV1A 2J0VA 4F9GA 2QXTA 4F71A 1GUBA 3DZJA 4NYMR 3JQ7B 2R00A 3U3OA 4D82A 2R1TA 2VDVE 1XTSA 1RZUA 5IK2D 2DB3A 2RGEA 3M33A 3EPHA 3SIXA 4O8ZA 1ZVKA 2O1SA 3NC0C 3P7MA 1QYVA 3AR3A 4R7TA 1NURA 3NHKA 3GOHA 2HA3A 3IAM1 4UEWA 1C3OB 1P61B 4IW3B 1K75A 4LY9A 1KO7A 4LQDA 4N0QA 4KWTA 2X2FA 2IF2A 2NADA 3TD2A 1F2UB 1DRUA 4PS0A 1SVUA 3QPBA 5BSMA 3VM6A 3E27A 2XVXA 2H5JA 2IXGA 4K9KA 1MZVA 3UJ9A 5BSHA 1XDZA 4MV6A 4EATA 2O8DB 1NSFA 4KAXA 4C0SA 3ZDAA 3IEIA 3UHAA 1TA0A 4H7KA 2YV5A 4DLPA 2HNAA 4ZGBA 4AULA 3V1TC 1E2PA 2HWXA 2M6SA 3QGMA 4UHEA 2HJWA 3S55A 1OLSA 2QGNA 2WSYB 5T3YA 3TD6A 2P65A 2X1LA 3OZUA 5HTOA 4CE6A 1GNPA 4Y2YA 1WMEA 6ABPA 1NVXQ 4MQLA 2XRZA 3UANA 1DL5A 2LIPA 3UV7A 2IOFK 3KLNA 4MDYA 1KP3A 3IXQA 2FX2A 2RAPA 4OJQA 1T35A 3F2IA 3ZK8A 2D2VA 1XC7A 4PYQA 1GTSA 1M67A 3A6EA 1R0SA 3U16A 5B36A 1I1HA 1PFYA 4FSDA 3U81A 1CW2B 2HDOA 4HNAA 1PLJA 3DS8A 1ZJZA 5G4KB 4BDTA 2LP4Y 4P31A 3AERB 3K9HA 1UEXC 4B31A 1J06A 2D2FA 1X7YB 1FLNA 4OAQA 4YBRA 2PMKA 4TN5A 3I92A 5EHZA 4P32A 5AKEA 3OE1A 2R79A 1C1DB 1N6OA 2WYIA 2PEZA 1KNXA 3C1OA 3QUTA 4HEHA 3OC6A 2NZXA 4Y6SA 2DPMA 2QNIA 1ECFA 3CSDA 4CLOA 3BRQA 3E9CA 4YRBA 3ACDA 4KKVA 1BDHA 4YUZA 5F3WB 2PX2A 2YFHA 5AK5A 3CRVA 4QODA 4O1MA 2DQSA 4FDUA 2WWTA 5JQGF 4HRXA 2EWMA 2F4NA 5DM60 5FFFA 2R8EA 1O2DA 1U0GA 3ADOA 3PDIA 3K53A 4GPBA 4OGLA 2FK7A 2ZJZA 1Z35A 3UATA 4Z3OA 2FV8A 2DKNA 1NQTA 2PZGA 5JYAA 1YIDA 4GLLA 4JB2A 4ZKDA 3IBTA 4UUOA 1N7HA 1KJYA 5DYNA 3UICA 3PV0A 2V55B 3WTBA 3N75A 1SXJC 4C0HA 3KQNA 4BB9A 4Y7DA 2FEXA 1E1RD 4J0EA 2JGLA 5CW1A 4GNKA 1LNQA 1DO2A 2D0OB 2H52A 1DTSA 4O4IB 1RRMA 3LA6A 1YR8A 2HQ1A 2QT0A 5EJ5A 1H0HA 2PUCA 3H65A 4YLGA 4W6QA 5TMPA 3I4CA 1S96A 4MO9A 2ASEA 5HCNA 1BWPA 3F5MA 2BM9A 4KGXA 4ZJPA 4XGNA 2OENG 4A16A 1DPGA 1FUIA 4L76A 5DLDA 1XVAA 4PSKA 1Z2AA 1H1LB 2PBRA 1Q2XA 1GQQA 1TUIA 2WU1A 4ZANA 3TDKA 3WWEA 4A8JB 4F3CA 1YMUA 4MICA 1A77A 1GCOA 3CLSD 1RXUA 1B8UA 3UIEA 4FXPA 4RM2A 4B34A 1DIRA 3BWVA 3CXRA 1N7JA 4ARSA 4A6DA 3U9SA 4RLHA 3SF8A 1GR1A 2G07A 4KODA 4KZKA 2FPIA 3KDPA 3TMYA 4L4UA 1E2NA 4AD8A 1T5SA 2R86A 4BE7B 1XP5A 4P38A 1DQPA 3NKLA 4HYTA 4MX8A 3WRXC 1U9IC 3DKPA 5CGQB 3EISA 3O93A 4UVDA 1PR0A 3QY9A 2FPUA 3NB0A 1FFDA 1UEIA 2ZRCA 1OLOA 2E87A 3LM8A 4BX0A 1ZPDA 4DQLA 1R0XA 3F1KA 1JEOA 4JELA 3R8XA 2JIMA 2NVOA 1F4PA 1UBCA 1NUTA 2LR0A 1MEJA 3FWNA 1C0EA 2PVCA 3FUTA 5T4EA 3VV2A