2I3GA

Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with nadp+.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
347
structure length
347
Chain Sequence
VANATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHPHLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAVWERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAVTVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFTPVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAHIAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of N-acetyl-gamma-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP(+).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords N-acetyl-gamma-glutamyl-phosphate reductase
total genus 116
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2006-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2i3gA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i3gA01
4FS3A 2YV1A 1S7CA 1A4UA 1DHRA 2V6FA 1UUFA 3G79A 3S2FA 2Q50A 3LDHA 1RM0A 3PIDA 4JROA 4DXHA 1MFPA 1PS0A 5JBIA 3NDIA 3V2UA 4BGVA 2CFCA 4D7AA 5TJ9A 1ZFNA 1VL6A 2IRWA 2NNLD 5F5LA 1R4NB 3RQSA 4DWVA 2QHXA 3BA1A 5K6AA 4R5MA 3LK7A 4IJUA 5G0VA 4D46A 2WD8A 4CM7A 1ZXBA 4YT5A 2A35A 3ZWOA 1ZJZA 2ZQZA 3STHA 4EYEA 3CIFA 1E3EA 3FHLA 3GT0A 2I3AA 1N2SA 4PG5A 5I7SA 4U8GA 2OORA 2DFDA 2NQTA 3ZCXA 4K6CA 2G5CA 2NU9A 1SAYA 1X0XA 2WE8A 4CMHA 3SLGA 3D64A 1JAXA 3VZRA 1T1RA 1BTOA 2CDAA 4PLPA 4Y9DA 1W6UA 2SCUA 3OIFA 5ER9A 2RHCA 4CM6A 2BFOA 3WBFA 4CQLB 5CDGA 4FFOA 1I2BA 4E4YA 4R3NA 2WM3A 4ALKA 4XYGA 4B3IA 1HYHA 2CD9A 3IJRA 2UVDA 3AY3A 3E9NA 5JE8A 4LN1A 4DLLA 4GH5A 1JW9B 4J4TA 4MVJD 1XELA 2AG8A 1PS9A 1DO8A 1F17A 3AU9A 3QIVA 3WDSA 5JNLA 5TX7A 4QQRA 1HDZA 4PLWA 4IDCA 2ZYAA 4FOOA 4YJHA 1F14A 4I5FA 4MINA 2GCGA 3W8FA 1DLIA 4BNKA 2YJZA 2XXJA 3WIEA 4BO9A 5CP8A 3D4NA 4DPLA 2HSDA 1WDLA 1GFSA 1W0CA 5TJHA 1UAYA 2C0CA 2PKQP 2QRKA 3KSDO 4B4WA 2PKRA 1HE2A 4I5GA 4TRNA 3PHIA 3GZNB 4AJ4A 4L0QA 3WG9A 3LSYA 5ADHA 3PLRA 3M1LA 4FBGA 1KS9A 4GL4A 5TT0A 4CV3A 3JQFA 1Y5MA 2JKVA 3SJ7A 2HK9A 4P4GA 2FRDA 2OXIA 1B8PA 1B14A 1IE3A 4RPKA 1KETA 3OIDA 1EFLA 2PGDA 4TZTA 3JCZA 2VZ8A 5HA5A 4PCVA 3TFQA 3MEQA 1LBEA 5I7FA 3OHSX 4L4SA 1VJTA 2GN4A 2W98A 3RC9A 3L6DA 3KZVA 4FD3A 4J2HA 5HBRA 1GEGA 4IGFA 5KCZA 4J0FA 1XG5A 4Q3EA 4XD2A 4B79A 3GVXA 4AJOA 2WYVA 1GYRA 4UUMA 4FPXA 3WYBA 3WB9A 3Q0EA 2P9EA 4JJFA 1I32A 3ZV4A 5KWEA 3SC6A 1I8TA 1RWBA 3NGXA 4CLRA 2Y1DA 1H6AA 4LMRA 4BGEA 3MJEA 2HMUA 1KBZA 4YT4A 4XGNA 1FK8A 4E33A 3H5RA 3KYCA 1H6CA 3WGQA 1A71A 3ORFA 2XF8A 4PN3A 2LDXA 3LZ6A 4GX0A 4L4RA 5C3MA 2DTXA 1M67A 1Q1NA 1U1IA 2AXQA 4UAGA 5KJCA 4Z0TA 1EE9A 5BNFA 4DRYA 4ZN6A 1XR3A 3ZDFA 3FNHA 4LRSB 1M6WA 3QVOA 2DUUA 1PQUA 1Z74A 2D4AA 3KEQA 1Y8RA 1J4AA 2YDYA 4RF3A 4W9NA 1EUDA 3VDQA 3HG7A 3AUTA 4NBWA 2IXBA 1GQQA 5T57A 4W7IA 4WLNA 3B1KA 2P9GA 3ZI0A 3I9LA 2WD7B 5COQA 2BF7A 2HQ1A 1O89A 1X0VA 5BT9A 4Y8VA 2QYSA 3G1TA 2VUTA 3ROMA 3NTOA 2WJPA 3BXXA 1ONOA 1UZNA 1GZ3A 2NVBA 5GZ3A 3DOJA 3M2TA 4KDEA 3BZUA 2H6EA 2O2SA 1OZAA 1WZIA 4W4TA 5F5NA 4YPOA 5CDTA 3WGGA 5EL0A 2B69A 1LEHA 1CWUA 1WNTA 4I9HA 1PTJA 2EXXA 4HADA 4BL5A 4XYMA 2VZ9A 5JO0A 4RPJA 1ZVMA 2BD0A 1E3WB 1GZ4A 3ZHBA 2DPHA 4UVHA 3EHEA 3OECA 3I52A 2I5PO 3TJRA 1BHSA 4R54A 1PR3A 4IGEA 1LSOA 5ILOA 3PQFA 5HRUA 4XR9A 1CJCA 2D1YA 2WE7A 2H63A 1P1HA 2NVWA 4NG5A 3TOZA 3QWIA 6ADHA 2DM6A 3MJCA 3MJVA 1YL5A 4XR4A 4ND4A 1NVMB 3PLNA 4NNJA 3U49A 4BOYA 3Q9NA 4W99A 3ZWWA 3UCEA 4CMIA 3H9GA 4ND2A 3QWAA 3U62A 4CMIB 1MP0A 3Q11A 4FFPA 1M75A 1R16A 5ITWA 1K5HA 4L9RA 2WYUA 2VYVD 3U9LA 2FZWA 3UCFA 3WGOA 3C24A 4AG3A 4D0RA 2BELA 1H2HA 1KYQA 2QW8A 3CH6A 4GSLA 3PDJA 4WASA 1B8VA 3ZH2A 1HDYA 3QWBA 2X6TA 5CFZA 3KBOA 3ZWAA 3O8QB 4OH1A 3RJ9A 1LLCA 4K28A 4MKZA 3UH1A 1ISMA 4CMAA 5A5FA 3IS3A 3H5NA 3ZNPA 1QYDA 3JQGA 3KXDA 4J49A 3V2GA 1AHIA 3V1YA 2VRCD 3FWNA 3O38A 1UJMA 1E6WA 2NM0A 3GDFA 2CNBA 3KLPX 3LU1A 3GVHA 3PZRA 1SC6A 4YB8A 1E0DA 4BO5A 1R12A 5JY6A 4NFHA 3WMXA 2VNAA 4N54A 3RFTA 1EUZA 5JSFA 4MJLA 1GZ6A 1WDKA 3JV7A 3GZNA 4BNMA 4AL4A 3RJ5A 1YH3A 1SZJG 5T73A 1XA0A 4D43A 1EQUA 3ZW9A 4ALNA 3ULKA 3DBLB 3U4HA 2Q4BA 1GU7A 4GWGA 1HLDA 3RUDA 3BTVA 4ILKA 4Q3DA 2Y99A 2VT2A 3LT1A 2GYYA 1Q0LA 5IDYA 1HSZA 1NVGA 2HMTA 1HSOA 3BMCA 4BQPA 5IFLA 5L51A 4E5PA 5L7TA 3WJAA 1BGVA 3JQEA 4XIJA 4H7PA 1NQTA 3PJEA 4M89A 2VN8A 4NBVA 4CM3A 1YQXA 2WTBA 3BHIA 3AI2A 4PRKA 4IDBA 2X1HA 1H5QA 3ZWNA 2WEKA 1ISJA 2OL4A 2HMSA 3VTZA 3GHYA 4J1NA 1FMCA 3H65A 1ISHA 1K0UA 1XU9A 1WW8A 4ZQBA 1MFZA 1KIFA 2R2GA 3WX0A 5CDSA 4WLOA 1X13A 2J3JA 2Q1UA 3IAHA 4CUJA 2VHZA 3QVSA 1OAAA 2QZ9A 4XX0A 1T2CA 1U28A 2JAPA 4R1NA 2ZIZA 2C5AA 1UXHA 2OUIA 1JA9A 3EY4A 5HS4A 3INTA 5DBIA 4K6FA 4OKNA 1ZK4A 1HDOA 3IUSA 4DIOA 3BTUA 4XB2A 3SBOA 4CLEA 1PJBA 3D5QA 3F1LA 5AXCA 3DHEA 2RHRA 3KM0A 4GSKA 4I9UA 4KDFA 5DOVA 4U0JA 1UZLA 4J1QA 2JAHA 3RU9A 3QP9A 3ZZNA 1BVUA 1NWHA 5EESA 4YJHB 4A2CA 4R41A 3F47A 3RUEA 5I9NA 3AI3A 3DZFA 1E7WA 4OXYA 1P1KA 3NDJA 4OGWA 3WLEA 3FNEA 3G17A 4BUCA 2J5RA 2NSDA 3MOIA 4OMUA 4D42A 2HK8A 1KY4A 5FF9A 2FPPA 2FSSA 2H1SA 5EN4A 5BSFA 2VUUA 3I9JA 1Q2XA 1NVTA 2Y66A 4PG8A 3ABIA 1E7YA 1JAYA 5F21A 1T4DA 2UUOA 2Q1WA 2C20A 2HU2A 4GGPA 5KKAA 3RIHA 4CL8A 3VC7A 1F8FA 3VH3A 4XCVA 3WFJA 1SPXA 4AJNA 3RVDA 1IOLA 2P5UA 3WNQA 5G4KA 3QHAA 4R51A 4FCCA 2ZQYA 6LDHA 3T4EA 5EINA 3C7CB 3AOGA 3U3XA 4CQMB 3DZGA 1C0PA 3VH4A 1O5IA 1E1MA 2FR0A 1YL7A 2GERA 3ADOA 1B3BA 4LVUA 3EDMA 3AUSA 4JJIA 4L4XA 1ISGA 1XKQA 2NACA 2O3TA 4ZQHA 1XCBA 3WWZA 3U4DA 4EGFA 4QSMA 1MB4A 4DQVA 4HFNA 3GQVA 4DPKA 4UEJA 3TWOA 3QVTA 3RC1A 1QXSA 2EG9A 4J6FA 4WLVA 2OGUA 4CLRB 4MIOA 3HDYA 1UXIA 4Z9FA 1WXDA 5B4VA 3QA9A 4W6ZA 5TGDA 3D0OA 1Z73A 3UHAA 2NLOA 1DRWA 1BMDA 1ENYA 3GMSA 1UDCA 2JFFA 4MDHA 3W1VA 2O7SA 1V3UA 3I23A 1ORRA 2PLAA 3JTMA 2BFMA 4NK4A 3N58A 2Y1FA 2AE1A 5AOVA 4Y67A 3B1JA 2DKNA 1PL6A 1ZSYA 4D0SA 4G2NA 3NJ4A 1T1SA 1CF2O 4E13A 4NMHA 4CM9A 4PLHA 3VPXA 3S55A 4KUHA 4MIYA 1IY8A 2I66A 3S1LA 4CMJA 2HRZA 3D3EA 3ZV6A 4CPDA 4LCJA 2Z5LA 5JO9A 4KWHA 4B3HA 1EUCA 2XPCA 4MVJE 3ADPA 4OHUA 4ZHSA 4RV9A 2UV8A 3ETGA 4LISA 3RBZA 4BNGA 1GL3A 2C54A 4JX8A 4YRAA 1F12A 3L6EA 3N74A 2PFGA 3FTPA 3GNSA 2OHXA 4IS3A 2VYVA 2EKPA 5JCJD 2BGLA 5B4UA 1YXMA 4ZICA 4YR9A 5MDHA 5K0ZA 4JNKA 2I6TA 4Z9XA 3ZV3A 5DP1A 4IJWA 2YHUA 3B6ZA 1PJLA 1KC1A 3IUPA 2IZ0A 4NFSA 1E5LA 2CDBA 3OEWA 3ENNA 2DBQA 2DBRA 2ZYGA 3GRKA 2R00C 3BTSA 1W8DA 5EJ2A 1MGOA 1U3VA 2NQ8A 1BWSA 1U2DA 3H3FA 3A1NA 4FR5A 4ND5A 4S1VA 3NUGA 2GN9A 3ZHYA 1GQ2A 3HWRA 1NAHA 3EK2A 3O26A 1GTMA 3PVZA 2W2LA 3JYOA 3LVFO 3V5NA 5GZ6A 1TT7A 5C7LO 4BQRA 3PQDA 4MO2A 1LRLA 5EPOA 1H0KA 5FI3A 1I3LA 3ZGYA 1R0LA 3NT5A 3JD4A 3C1TA 1X15A 3GK3A 3PZBA 4A03A 1U2GA 2HLPA 2GLXA 3H2SA 3ZWYA 2W8ZA 1NM5A 3GFGA 5IF3A 4J1TA 3C1AA 1PSDA 2PD4A 3QV1A 5CDYA 4BNVA 1X14A 4YAKA 3WTBA 3GVCA 1GD1O 4BNWA 3I6IA 3L9WA 8ADHA 3E5RA 1RM5A 1QLHA 4DC1A 5CPBA 1HE3A 2CZCA 1U7TA 1BW9B 1GPJA 4R1TA 2CY0A 4XQEA 4YYZA 1U5CA 1LQTA 2P91A 1C0KA 3DR3A 1UXJA 3E5MA 3OBBA 1QR6A 1WPQA 4IBOA 2GR9A 5JMPA 1ZEMA 5AXBA 4S3MA 4YAIA 3PJFA 1F06A 1PX0A 3KOUA 3ETEA 1HZZA 2BI8A 4O0LA 4NZ9A 5THQA 2HRBA 3IMFA 3GRPA 2Z1NA 3AJRA 1NTOA 2YHIB 4I1IA 4CLHA 1LQUA 4Y6PA 1WDMA 1GUYA 3TF5A 1HYGA 1KEPA 4FW8A 5KJ6A 1EDOA 1LSJA 4ONEA 1DJQA 4I08A 4CR6A 4J7XA 2PA3A 1J5PA 5LCXA 4B4VA 1E3SA 3JQ6A 4IIVA 1H6DA 5A02A 4BIIA 3WQQA 3GUCA 3ZWMA 1BXGB 3WXBA 4HY3A 3MZ0A 4XWYA 1I2CA 3V2HA 2IODA 5A3VA 1PGQA 4CQMD 3VZPA 4NHEA 2HKIA 3VKUA 1V3VA 1SMKA 3DAPA 4WECA 3WICA 3TFOA 2NTVA 3I4FA 5LC1A 1FJHA 4IM7A 2D8AA 5JY1A 1DIAA 5G2OA 1R4NA 4B8ZA 3RBVA 2ZKLA 1ISFA 1DXYA 1JQBA 5CG1A 1P77A 1TEHA 3H9JA 1U7HA 4TVBA 1ZMOA 2JD0A 2QZZA 4J2OA 5JS6A 3ENKA 4B4OA 1M6HA 5BNIA 4UREA 3F5QA 3FBTA 2P5YA 4IDFA 1DC5A 3M6IA 2FZEA 1NPTO 4I5DA 4JP2A 4N5MA 2Q22A 1LRJA 4U0KA 3K6JA 1C1DA 2D2IA 2IXAA 4JK3A 4G5HA 1DFHA 4IZIA 3K8ZA 5BSEA 3JYNA 3W4IA 3X2EA 2VUSA 4YQZA 4U7WA 1JVSA 4ZVVA 4UVEA 1XEAA 4OQYA 3LQFA 1T2AA 1PZFA 4OOFA 5B4TA 3JD0A 4ZJUA 3TSCA 3KYDA 5JDIC 2D5CA 4LVCA 1PJ3A 1A27A 5JYFA 1LLDA 3JQ9C 4AJKA 1WWKA 1AE1A 4TSKA 4YAEA 4GLLA 4DBVO 3I9KA 1X7HA 4IJKA 4DTIA 3T7CA 5TF4A 4HP8A 3WQRA 3O4RA 4M55A 5DT9A 1WZEA 1PGOA 2AEFA 4AJPA 4MIEA 1F8GA 3DXFA 3VPHA 4XJTA 3MWEB 2VWPA 4RORA 4CQMA 4NH4A 1Z45A 2BMAA 1QKIA 3DBHA 4OO3A 2G1UA 2X4GA 3QY9A 1J49A 1Y81A 5HM8A 2C82A 1V9LA 1HE4A 4R5HA 4LMPA 4YT2A 2DAPA 1P3DA 1DLJA 3BHMA 5B37A 1XU7A 2CVZA 4RZIA 4RDHA 5U1PA 1XWFA 1YS4A 1Q0QA 5CPFA 1G6KA 2BGKA 1CQIA 3RAJA 2GZ3A 2JFHA 1NHWA 4RPGA 5IDXA 3AM3A 3ZU3A 4TQGA 3ZU2A 5IDWA 1PZHA 1YGYA 1ADCA 1JKJA 3KO8A 1YRLA 5TC4A 1GAEO 3JQDA 2DU8A 1DHTA 3BAZA 2TMDA 2PWZA 3GVPA 4P22A 4WNCA 4LW8A 3ZNQA 3EC7A 1BG6A 3TRIA 2NADA 2J3IA 5IN5A 3VAZA 1SEPA 1ADFA 1Y8QB 1I36A 3FPLA 3IDSA 3WWYA 1PZGA 3OH8A 3TZCA 1T2EA 4CUZA 1GUFA 3ASUA 5A05A 3JQAA 4A26A 4A27A 3GAZA 1SOWA 2BLLA 1L7DA 4BMNA 5L7YA 1UXGA 3K9QO 4OSOA 5ENDA 2NTJA 3KV3O 3NAQA 3H5AA 1XDWA 1H93A 3C7AA 4EDFA 4HXYA 1XGKA 1MA0A 4J91A 2VHVA 1K6IA 2AQKA 2O3JA 5JAZA 2DBZA 2YQ4A 3IQDB 5U4QA 2PR2A 3WJ7A 5K9ZA 3IL2A 3MOGA 3JYLA 4U6QA 3DAFA 4PRLA 4Y98A 4E5KA 4JLWA 3HN7A 1R6DA 2G0TA 3SEFA 1H9AA 4DBZA 2D0IA 3I83A 3WFIA 3NDRA 2W2LD 2Y1CA 3F3SA 4TRMA 3ONDA 2ZTMA 3DOCA 2X7HA 2V6GA 1X1TA 2PGJA 4C4OA 4PG6A 2VTEA 3GVIA 4CM4A 3AY6A 3RUIA 3RU7A 4Q39A 2QRLA 2OBNA 3DFZA 2O50A 2FR1A 3HUDA 4DA9A 1LNQA 3JQAD 3PK0A 1LRKA 2NU6A 1LLUA 1P1RA 3BHJA 3I3OA 1KC3A 3LLVA 1I33A 4GLOA 4TROA 5DCWA 3TZHA 5BQFA 3AFMA 5T64A 2C5EA 3VPSA 3EVTA 4OXKA 2AE2A 5H81A 4CV1A 2PKQO 3INGA 4UUNA 2Q2VA 3E6AA 1JU9A 1VKOA 1QV6A 2BH9A 3VH1A 2IYPA 3JQAB 5ES3A 1HXHA 1E1NA 1NR1A 2VRBA 1HDGO 1VC2A 4BV9A 5L7WA 3DZJA 5CG2A 1JTVA 2EGGA 4D44A 4CMKA 3DZHA 2DVMA 4AJ2A 3M2PA 1QYVA 3DTYA 4BB6A 4O5OA 4CM9D 3DOOA 1ENOA 3ZNOA 4DC0A 3WYEA 3IKVA 4IMPA 2FY8A 1UDBA 3AOEC 2WMDA 5IZCA 2WDZA 5G0SA 5A06A 3HSKA 4NBTA 4BO7A 3BMNB 2JD2A 1KVQA 4AICA 1Y8QA 4L75A 4BNIA 5ICMA 3PHGA 1XIVA 4IQ0A 1DAOA 4XA8A 3C1OA 4MVJP 1AUPA 2H5LA 4XYEA 2Z1MA 2ZTLA 2NU8A 1YKFA 1A7KA 4RO0A 4DIBA 1B8UA 1I0ZA 4PLFA 4E5NA 4OIMA 1R66A 4M86A 1I3MA 4IMRA 2I76A 4DREA 3SVTA 2ZB4A 4RCVA 1ZEJA 2VQ3A 3HNPA 4ID9A 1FXSA 1MV8A 1ONNA 4FFMA 1Z7BA 3FPCA 2C7GA 2E6UX 1QSGA 1N9GB 3TL2A 4EJ6A 2ZCUA 4LSMA 1CEQA 1E1KA 3H2ZA 3PDUA 1ADGA 1E5QA 4PGFA 1Z82A 4RVHA 1ZUD1 4E12A 4WCFA 1YL6A 4PG7A 4DLBA 1IHYA 4RGBA 1EVYA 3UVEA 3W6UA 1TVEA 2P9CA 1A9YA 4II2A 3HB4X 4FQ8A 4RLSA 3GG2A 1PJTA 5TS3A 3WLFA 3DMTA 1EFKA 3WMWA 2UUPA 1E92A 1W73A 3PFWO 4F45A 4N5NA 4NDNE 3RASA 2EKLA 1O94A 2Y0CA 2C2XA 3SLKA 3H4VA 4MVJH 4W7HA 2IZZA 1U8FO 3GAFA 1HTBA 2J3HA 1WLYA 3A9WA 1U5AA 1T2DA 3RUHA 1N5DA 2GO1A 1XQ1A 2YYYA 2DT5A 2EW8A 2YW9A 5EMHA 4W9NC 3Q3CA 1PIWA 3JD1A 4YTEA 1GADO 3T4XA 2Y1GA 4JP3A 2A9FA 4DYVA 3H9QA 3OSUA 3JQCA 4MVJF 5JW6A 4TKMA 4BO1A 4RVGA 1OC4A 1R15A 1V35A 1DAPA 3GGPA 3UICA 4E3ZA 5M6DA 4FFLA 4HWKA 4KQWA 3WYCA 4E31A 5HWSA 1DFGA 2G76A 4YAGA 4I8XA 3ZU4A 3LF1A 3OP4A 4KMSA 1QYWA 3QQPA 5L45A 1DC6A 1NHGA 3F9IA 5GMOA 1LI4A 3A06A 4RLHA 3W8DA 1NBOA 3PHJA 5IJZA 2HCTA 4QFDA 2GZ1A 3KYCB 1NXQA 3PQEA 2H9IA 1DRUA 2X0JA 3TZ6A 3I6QA 3GUYA 4O59O 4XYBA 4R9SA 4QFCA 3SJUA 4BMSA 1B0AA 3EGOA 3MCVA 4HFRA 2CF5A 3AY7A 4BGIA 4WUVA 3TPCA 1RM3A 3FR7A 1DEHA 2HJRA 2WYWA 3KYBA 3WQSB 5I7EA 4Q3BA 5G0WA 1C14A 3NT4A 3FCOA 4ZRNA 5C7IO 2JCXA 3NKLA 5G4KB 1GDHA 1CDOA 4BNFA 3VOSA 4J90A 4CM4B 4Q3NA 1L7EA 2WD7A 1O0SA 1PZEA 2FSVA 3VPFA 2JCYA 3KRTA 3L9XA 1OC2A 1JKFA 5JYDA 1IL0A 1C1XA 1LDNA 2AG5A 2VYND 2GASA 5L53A 1UXKA 1ADBA 2RCYA 3MTGA 4ALMA 4AJJA 5ICSA 5A04A 3QWHA 3E8XA 3DONA 3U4IA 1X1EA 3JQFC 3NGLA 4L74A 3F4BA 1UP6A 3CZMA 2PH3A 4B3JA 2J6IA 4WNIA 9LDTA 3GNTA 4QTZA 4YJFB 3MJTA 3U4CA 5JLAA 5KNLA 1Z75A 4IPTA 2BI7A 3QW2A 2RH8A 2ZATA 4FB5A 3DZBA 4JBHA 3OA2A 1WAMA 4JXKA 4NU6A 1K6XA 3GFBA 4PLZA 5DBFA 4EZBA 5IG2A 4R68A 5DBGA 4CM1A 4BNTA 1C1DB 2DTDA 5KIAA 5IN4A 1AXEA 1NQOA 4D45A 3O9ZA 3P2YA 3RC2A 3SX2A 1V8BA 1HE5A 3EZYA 4BS9A 1P0FA 3R3SA 3BIOA 2BFPA 3K96A 3JQBC 2CVQA 4BO0A 5TLSA 1GV1A 2VCYA 1DC3A 2VHXA 1EK6A 1KEWA 1RYEA 5KJEA 2Q1TA 4MVJA 3UW3A 4WOKA 1ISIA 1OMOA 3JD3A 4DGSA 4XJSA 1OFGA 1EQ2A 1RYDA 1EDZA 4PLCA 4IJVA 1VJ0A 1NPYA 3R0IA 3WS7A 4BVAA 4DYDA 4E2ZA 3GN2A 5F1KA 4GPD1 4GKBA 4KP7A 4M54A 3D3WA 4QEDA 1R0SA 3L4BA 1UDAA 2FPGA 4RVDA 3NTQA 2RH4A 5C7OO 4MKRA 4MP3A 3F6YA 3LLSA 2CF6A 3WSWA 4GMFA 1YB1A 1K6JA 4OQZA 1HZJA 3DDNA 1UZMA 1O8CA 5U9CA 3ANMA 1XYGA 1ZSNA 1ARZA 1ZNQO 3H3JA 2DUWA 1HKUA 4ZA2A 3OJLA 4PFJA 1N7GA 5JMWA 1CRWG 1BSVA 2JHGA 4IS2A 2J3KA 5KTKA 3QLJA 1I10A 3K31A 1N8KA 3FNGA 3HHPA 5FWNA 5L4SA 3CE6A 2RBEA 4HNGA 5ILGA 1OBFO 3UAGA 2VOEA 3VPGA 3L6OO 4GX5A 4IDGA 3WSVA 2PD3A 3RUAA 4AJEA 3ZV5A 1LTHR 1F0YA 4UVDA 2D59A 3HDQA 3DBLA 2D3TA 4U6SA 3EVNA 1LDMA 1HRDA 1VM6A 2X58A 4FGWA 4BKRA 1CIVA 2DTEA 4RF2A 1H6BA 1PU2A 3KSZO 1IHXA 3LT4A 3Q9UA 2FP4A 1P0CA 4PIVA 5JDCA 3JQ7B 2HO5A 2AMFA 4TMFA 4QECA 1NAIA 1PL7A 5TNXA 1CYDA 3M1AA 3NX4A 3DL2A 1RM4A 1BW9A 3L07A 5L4LA 4WE3A 4CV0A 1B3RA 4NR0A 4E6PA 3OQ1A 3V1UA 1ZZEA 3A4VA 3RKRA 1GUZA 1QORA 4BNYA 2V6BA 5IZ4A 2O23A 1ONPA 2PNFA 4RF4A 3FSRA 2O48X 1ID1A 3GEGA 4P4LA 4Z3DA 1P74A 3FI9A 3UFXA 1ZK2A 4CV2A 2YFHA 1IPFA 5EERA 1UAGA 3GGOA 1ZO8A 2PY6A 5BNTA 2FN7A 3PTZA 2DC1A 5FEUA 4J1SA 2O3SA 2DPGA 2C29D 2I67A 4J0EA 4WEQA 4EUHA 1KVSA 1DDOA 3WIDA 1WMBA 2FPIA 5EQDA 4ZD6A 1DC4A 4A0SA 2GNAA 3QVXA 3D4PA 1PS8A 3JQ8B 1GV0A 4DQUA 2Q3EA 1Y9AA 3BYZA 1JLLA 1P9LA 1DFIA 2Y0EA 2AEJA 1YB5A 1Y9EA 4LGVA 4HBGA 4TVOA 3VDRA 1M76A 2PV7A 4GVLA 2CUKA 1DPGA 3I1JA 3K2BA 2V6MA 4WCFB 3UF0A 4BNJA 1E7QA 4IXWA 2B0JA 1B7GO 3PHHA 2XXBA 3E1KA 3MJ4A 2WSBA 2AEMA 3COSA 3I9OA 2GSDA 5B1YA 1VL8A 3PI7A 2QG4A 1Y1PA 9LDBA 1O9BA 4FFRA 2C59A 4KZPA 3PXXA 4A7PA 1UP7A 4JIGA 3ZW8A 4BNUA 3DO5A 4YJFA 2OP0A 4KUGA 4KQXA 3DB2A 4N7RA 2Y0DA 3PGXA 4XDZA 4Z3KA 4PZCA 4R1SA 5A9RA 3FF4A 4ALIA 4NK5A 4E21A 1LX6A 3CUKA 1D7OA 2IEBA 3DMTC 2I99A 2NU7A 1FDSA 5KVQA 1IULA 3UXYA 1O95A 2OP1A 2Q2QA 2YQ5A 4BO2A 4AJHA 2EF1A 2O4CA 4HFJA 2RAFA 4ZGWA 1FDWA 1SBYA 4FN4A 3HE3A 4AJIA 3OJFA 2AQ8A 3AOEA 5IZCC 2EIHA 5DDIP 5KVVA 1DRVA 2JL1A 3LC1O 4P4NA 3GA0A 3FBGA 4I9NA 1KVRA 3DAGA 3H9EO 3W4JA 2B5WA 4IIUA 3GF4A 2DLDA 1YJ8A 1JDJA 4AVYA 3S2GA 4DVJA 1DB3A 3ZWPA 3JYQA 4HX5A 2VRCA 3JD2A 1GCOA 1C1XB 1U3TA 2ZJ0A 1YVEI 1KVUA 4R01A 4FJ2A 1HDXA 4BNLA 4A5OA 3HZZA 3ITDA 3PJGA 3PGJA 1XHLA 4UUPA 1C0IA 2J8ZA 1IZ9A 1GEEA 7MDHA 5ITVA 2P2SA 5AQ1A 1ENZA 2B4QA 2CSUA 3X2FA 4PLTA 1NNUA 4J7CA 3UCXA 2PH5A 4JBIA 1A9ZA 3AUAA 4LK3A 1X7DA 2V65A 4OAQA 3B20A 3V1TC 2ZCVA 2VHYA 3QE3A 3RKUA 1I24A 2O2YA 5AVOA 2IE0A 2JHFA 4C7KA 4CM5A 3CINA 2EJVA 1TB4A 4Y6SA 1VSVA 5JDCC 1XQ6A 5AXAA 1IYZA 3K73O 1EVIA 3ICPA 1U3WA 4RVSA 4Z0PA 5ER6A 5KJ1A 1B2LA 4PLVA 2I9PA 5C5IA 1HF3A 2IEDA 3AUUA 3CTMA 2X0IA 3G0OA 1Y7TA 1QP8A 5G4LA 1P45A 2X9GA 5A4DA 3DHNA 1N7HA 5JCXA 2X5KO 2TMGA 5HTOA 1Q7CA 4ZQEA 1QG6A 1BVRA 4IDDA 5COAA 2GF2A 4YBZA 3RBXA 1T24A 4CMCA 1CETA 1IB6A 1PWXA 1G1AA 3KSUA 2EP7A 2Q2WA 2O7QA 3E48A 3EYWA 3H8VA 1HWYA 1EK5A 4J9UE 4EW6A 4EUEA 2X9VA 1PEDA 4WLUA 4QXMA 2NTNA 1MUUA 4QX6A 3OETA 4L73A 1G0NA 4XQCA 1S6YA 2Y1EA 4BNHA 1CERA 5KVSA 5IAAA 3FNFA 2NVUB 2PZKA 3B70A 1NFFA 4FC7A 1D1SA 2I3GA 3F4LA 5G0UA 3KYDB 4K9DA 1MC4A 3L77A 4NI5A 2O4UX 5CEFA 1Z6ZA 1BDMA 1E7SA 2QQ5A 4XEHA 3ZWBA 4IINA 1Y8RB 3PIIA 1VL0A 4R1UA 4DL9A 3EAGA 3HDJA 1W4ZA 1QRRA 3OJOA 4RVFA 2X0RA 2FMUA 2EKQA 3E03A 3E82A 3AW9A 3FD8A 1H94A 3R3JA 4LSWA 3ANNA 3NV9A 4GWKA 1Y6JA 4M1QA 2JCVA 1IPEA 1MXHA 4NJOA 5I8ZA 4B4UA 4Z9YA 1YQDA 2X5OA 5JAIA 3FTNA 4X54A 2OZPA 3K5PA 3WR5A 4Y6RA 2HDHA 2ZK7A 2ZJ1A 4IZHA 1D3AA 4URFA 7ADHA 4YACA 1ZCJA 5JAMA 1DSSG 5A9SB 1N9GA 2POQX 3VVCA 4MPDA 3ST7A 5KJFA 3IP3A 1DJNA 4XB1A 2Q1SA 2ZB3A 3LC2O 3FR8A 5COBA 2Q99A 4P8RA 5A9TA 1E3WA 4J4HA 3VH2A 1PL8A 4F6LA 1HYEA 3ICCA 1N1EA 2NV6A 3VZSA 1T26A 1TT5A 3ITKA 2IDZA 1RKXA 3KTDA 1NFQA 1YDWA 4UVGA 4IUYA 4WK6A 1TA4A 2Y1OA 1RJWA 5DCYA 4NPCA 1AXGA 1I30A 3ASVA 3GEMA 3UUWA 3OICA 4RJTA 1YBVA 2OBYA 3PJDA 5TT1A 4PZEA 4O6VA 1KOLA 3VVBA 5IXSA 1MG5A 4O63O 3BMNA 2QRJA 3SXPA 1IZ0A 4CMGA 4R3WA 1LDGA 1X7GA 3OM9A 5K6AC 4N5LA 5JCJA 4MP8A 3JSAA 3KUXA 3PP8A 2EV9A 1AHHA 4CR8A 2Y68A 5I9MA 4OKIA 1D4FA 3T7EA 2I65A 3TQHA 4BKUA 4EEXA 2AW5A 2HJSA 4H15A 1LC3A 5I8WA 4D41A 1E3IA 3TZKA 1N1GA 3ZNNA 4EBFA 1NYTA 2P68A 4JBGA 1QV7A 2GUGA 4PLYA 3P19A 3F5SA 3G49A 3E18A 3W6ZA 4F6CA 2P4HX 3ZU5A 3NYWA 3U09A 1V6AA 4WEOA 2B4RO 1U4OA 1SO8A 2NUAA 2PZLA 2E49A 3FRJA 2CVOA 2F1KA 4XGIA 4MVJG 5DP2A 3WNVA 1R37A 4E5MA 4WGGA 1DIHA 4R69A 4R9RA 4ALJA 2JFGA 3WOHA 4BKPA 1P1FA 5DF1A 4WJZA 2ZB7A 3TNLA 3ZHXA 2YZ7A 4J9VA 4NFYA 2ZTVA 1E7RA 4Z6KA 3D1LA 3RI3A 3KEOA 3L4BC 2YV2A 4XYLA 4O1MA 2EGHA 4B7XA 1Q7GA 2Y05A 3GMDA 1KVTA 4P38A 2A4KA 4KUEA 2OOSA 3OQ6A 3RSHA 1UH5A 5TRTA 5KVCA 1FF9A 1V0JA 1LU9A 4JJGA 3R1IA 1LSSA 3K2EA 2PZMA 4CLDA 2DBVO 1EE2A 4E2YA 1C0LA 2QYTA 5I7VA 4FDAA 2NWQA 5BSHA 4ZQFA 2BKAA 4C7JA 2W90A 4KTTE 3CXRA 4Q9NA 1BXGA 3I5MA 4EEZA 4IQ8A 1P31A 1PJQA 1LDEA 2VWQA 4JQCA 4XGKA 3BMCB 3I9NA 3DBHB 1E3LA 4YT8A 3DFUA 4ND1A 4E5YA 4BB5A 4F3YA 5A03A 4YEDA 1ZW1A 1K89A 1LC0A 2GRAA 4NIMA 4YJDA 4CLXA 3P2OA 1E77A 4XQGA 4PZDA 5JAQA 3WBBA 3AM5A 4XIYA 5L3ZA 3V8BA 3ETDA 4EJ0A 2VOJA 3WGTA 2A94A 2B83A 3FN4A 1O6ZA 5GY7A 3CMCO 2FOIA 1PJ2A 3GR6A 3PHLA 4YJGA 2XOXA 4HV4A 2GDZA 2V7PA 2BGMA 4D3FA 4CUKA 3PYLA 1BXZA 1LXCA 3S8MA 3I9MA 1QLJA 4FGSA 1LSUA 2NVUA 3C85A 1LDBA 3AFNA 5A1TA 3ZWCA 4TRRA 3GOHA 1P44A 2YY7A 3RROA 1TLTA 4CJXA 1PJ4A 4CMEA 1MG0A 1TI7A 3G1UA 1NQAO 4L8VA 4JN6B 5AYVA 1SEVA 4KOAA 2IZ1A 3PPIA 2C7VA 5FFFA 3B1FA 1B16A 4GMGA 1YE3A 4FSHA 3W8EA 3CMMA 1PGJA 4RPHA 2JJYA 1SNYA 1PGPA 4XRRA 4HFMA 3GPDG 4OOEA 4XDYA 2Q49A 3GN1A 2VZ0A 1KY5A 1OI7A 4PG4A 1U8XX 3TDKA 5CHEA 1QYCA 1KEVA 3F46A 4ITUA 3HADA 1DOHA 1ZSVA 3VHRA 3DZKA 1LJ8A 1HT0A 2D5AA 3WGHA 3WGZA 5H83A 3AU8A 1U9JA 5CEJA 3DWFA 3O8QA 4BKOA 3K30A 1P1IA 4YDRA 5EQFA 1MX3A 4XKJA 4BGUA 1U4SA 3GHHA 4AJ1A 3Q2KA 3A14A 3CSDA 3DZIA 3QVWA 1KERA 4ESOA 2OMEA 1E6EA 3BMQB 1QMGA 4AJLA 2R6JA 2UYYA 5IDQA 2OFPA 2X23A 1HDCA 5DOZA 1GPDG 3U0BA 4CLOB 4CM8B 4XRGA 5A5EA 1HL3A 4YJGB 2YV3A 2ET6A 4GKVA 3TN7A 1P1JA 3AK4A 4L76A 1EBUA 1EZ4A 4YVFA 4BNXA 1ZJYA 3OFSA 1E6UA 4NBRA 1ZK1A 3ANLA 4DMMA 4GAEA 3DEYX 2C2YA 3QWFA 1XLTA 3DTTA 5JYEA 2B4TO 3LYLA 3KB6A 5G0TA 3HQ4O 1J6UA 3BTOA 3DHYA 1E1LA 1EVJA 2X5JO 4QUKA 4CL3A 1BRMA 3LF2A 2XAAA 1HETA 1VKNA 2P4QA 3WTCA 1WVGA 8LDHA 3GH3A 4NQZA 3IIEA 3GNQA 5L95A 4ZU3A 1FDUA 4QT0A 3OQBA 3ROPA 4R16A 4CMEC 3ROQA 1MC5A 1YO6A 3LT0A 3JQ9A 2G17A 1YJQA 1BDBA 1NP3A 4NU5A 5T8KC 2E37A 3PYXA 4PVCA 1Q0HA 1NQ5A 1JN0A 3AI1A 3CZRA 4YAJA 4GQAA 4QO7A 4U5QA 4XQ9A 1PQPA 1SCUA 1U3UA 4WLFA 4WPGA 2YFQA 4FIZA 5F1PA 1ZBQA 3ZWXA 2PD6A 2EW2A 4INAA 1EMDA 5DULA 1EEHA 1PR9A 3OJEA 1B15A 1I5RA 1IUKA 1JWBB 3BMQA 3TZQA 1DBVO 1PJSA 4RL6A 4J7UA 1UR5A 1XSEA 3INRA 4IXTA 4YQYA 2PTGA 4MP6A 4NJMA 1OOEA 3DMYA 1N92A 2PGLA 4CQLA 3NEPX 3TOXA 4W82A 2UDPA 3S2IA 2O3UA 4YA6A 4XZ3A 3IKTA 1PQWA 2E82A 2J5KA 2AHRA 1V3TA 1VSUA 3CPSA 1T2FA 4DLAA 4UEKA 1VLLA 1YOVA 3ON5A 2Y93A 2VWGA 3KVOA 3HN2A 5CEEA 1YOVB 3ZWVA 1YDEA 4H3VA 1LUAA 2AQIA 4BO4A 4DIFA 3GEDA 5TQVA 1YB4A 5L40A 3FWZA 5TSDA 3WGYA 1NFRA 4I5EA 2EP5A 1TT5B 1L1FA 5DN9A 5T67A 2E4AA 2ZTUA 3W4KA 1YWGO 1WP4A 4MKXA 2YUTA 4GX1A 2LDBA 4FFNA 4IQGA 1YONA 1YBAA 4H16A 3DBRB 3F1KA 4BNNA 4HKTA 4JGBA 3RCBA 4J43A 1PWZA 2W4QA 3S2EA 5I9LA 3H7AA 5MGBA 4YXFA 4G65A 3IP1A 3EUWA 1VPDA 3ROKA 4NBUA 1FDTA 2DQ4A 4B7CA 1P33A 1K3TA 1Q7BA 5A3JA 1E7MA 2HUNA 3Q6IA 5GZ1A 2VYNA 4ZQGA 4TWRA 1GQYA 2VTDA 3PYMA 1MXFA 1GYQA 2A92A 4RF5A 4M87A 2ILTA 4D3DA 4IY1A 3QSGA 3EZLA 3VTFA 4WCFC 1NWCA 1ML3A 2OO5A 2Q46A 2X22A 1ENPA 1FDVA 1VJ1A 4OJNA 5EIOA 3GC6A 4Z0HO 5IXYA 3JYPA 2FWMX 1A7AA 2GN8A 4DQXA 3N7UA 5F3RA 1ZXLA 1D1TA 4BKQA 3GDOA 3VKVA 3GGGA 4E0BA 4GGOA 3DBVO 1Y5RA 1ZK0A 4FC6A 3OJ0A 1EVZA 4KTVE 2WWRA 3RUFA 5LDGA 1AN9A 5DZSA 1H2BA 4R4JA 1VE9A 2VNSA 4EITA 3ONEA 3P7MA 4PLGA 3E9MA 3KHUA 3IJPA 3L4SO 3D7LA 2X0NA 1A5ZA 4TRJA 4II3A 4CR7A 1PJCA 3PWZA 5TIIA 3RC7A 1K2WA 2HK7A 4YRDA 1J0XO 1BXKA 2B36A 3GPIA 4CM8A 4UVIA 5JYAA 3HDHA 4RQTA 5ENVA 3P5SA 1GYPA 1KEUA 1ULSA 4ZRMA 1JWAB 5AXDA 1GY8A 4GX2A 4YWJA 3TL3A 2CDCA 2FHSA 1HEUA 5JFOA 4RPLA 3GLQA 3LT2A 3HB5X 1R4MB 1ZKMA 3C7DB 4WOJA 1R4MA 3H6KA 2HMVA 5CAEA 1R0KA 4OYRA 2QX7A 2O3QA 3OEYA 2AA3A 3BMOB 1UP4A 5DNAA 4IDEA 2GZ2A 1I2ZA 2VHWA 5JPIA 4A10A 1DIGA 2B35A 3H9UA 2EWMA 2X9NA 3E9QA 4BO3A 2PZJA 4AFNA 1T25A 4J4BA 4GI2A 4OL9A 2VWHA 4BHTA 3LC7O 1I01A 1NASA 4J16A 3PWKA 2J5QA 2IYOA 4HNHA 3CKYA 3KLMX 2EHDA 3O03A 4GBJA 1GR0A 3MWDB 4Q3CA 4LRTB 4YCAA 4MOWA 3I4CA 4GVXA 3RUCA 2Q45A 3C8MA 4BO8A 1RPNA 3JQ8A 3C3XA 3GZ4A 3RFVA 1YQGA 4N18A 4B8WA 3JQBA 1LA2A 3NRCA 4FJ1A 1NX6A 4DMLA 4UEOA 2Y67A 2ZB8A 4BO6A 5L9AA 2BFAA 5JC1A 4YRBA 1ZK3A 3NT2A 3ONFA 3RD5A 1I3KA 3D3WB 1DIRA 1Z7EA 4JCOA 4OXNA 4WCDA 1LLQA 4BV8A 3PWSA 1NPDA 3MJSA 1LDYA 1ZH8A 4FJ0A 4QO8A 1JVBA 3DC2A 4WLEA 5FI5A 1G0OA 3G3EA 4KWIA 4ND3A 5DCUA 5CDUA 1VRWA 2QIOA 1YBMA 2W2KA 4TZKA 1JKIA 4E30A 4MVJM 5BR7A 4UULA 2GGSA 4HUJA 1ULUA 3GG9A 2EJWA 4EJMA 1QYXA 2RIRA 5T8KA 4A73A 3KETA 3IOYA 4BNZA 1MLDA 3OIGA 3QJ5A 5HS6A 2YHIA 4D79A 3K92A 1I3NA 4B7UA 1DIBA 3SC4A 3PEFA 4ROSA 3UKOA 4CMBA 1WMAA 2CMDA 1NR7A 2GD1O 2B5VA 2YDXA 3GY0A 1HDRA 4NJMB 2AQHA 3WGIA 4ALLA 4CLOA 3AM4A 1SOVA 5JXWA 4TKLA 1A4IA 5JDIA 2R00A 5J9GA 1T4BA 3L0DA 2GPTA 4K26A 4Q3AA 3CEAA 3HJAA 3DBRA 4M8SA 3DQPA 1H9BA 4DPMA 2E48A 2G82A 2B37A 2GN6A 3EMKA 2O3RA 3HFGA 3BMOA 5C37A 1C3VA 2HMWA 2ZYDA 3HFSA 3JQ7A 2BHLA 3OMLA 2UAGA 4PVDA 1SB9A 2C07A 1E3JA 2JD1A 1PGNA 4D3SA 4RVUA 3NTRA 1M66A 4RDIA 5JC8A 3R6DA 2BRUA 1SB8A 3NJ8A 3UN1A 5F1OA 5LDHA 4IDAA 4CODB 5KOIA 1B26A 4J3FA 4K1LA 3QRWA 1M2WA 1AGNA 5H82A 3D4OA 3RWBA 1ZIDA 4G81A 5KKCA 3UOGA 4DUPA 2Q4EA 2W2KB 5THKA 5J23A 3PRJA 1ZMTA 2X86A 4WKGA 3Q1LA 4E2XA 2EERA 2EEZA 3JQGB 3MTJA 3IC5A 1D8AA 2FR8A 3Q2IA 2VT3A 3AWDA 5T5QA 3RFXA 3U5TA 4EI2A 5T6BA 4OM8A 2F00A 5B12A 4RZHA 4UUOA 4M49A 3D5TA 4OSPA 2PK3A 1EBFA 5BSGA 4EUFA 2DFVA 4MVJI 4FOSA 3UGKA 1HLPA 2X8LA 2Z95A 1CQJA 5L4NA 4F46A 3ZHZA 4BMVA 4E2WA 4LCEA 3OA0A 3ZN2A 2HAEA 3VZQA 3PFFA 5FYDA 3OF2A 1TXGA 1A72A 5A9SA 3GDGA 4E32A 3EW7A 1GCUA 1VI2A 4RQUA 3A28A
chains in the Genus database with same CATH superfamily
1XTKA 1HE8B 1A4UA 2V6FA 3N8HA 4M1EA 4TYNA 2WAAA 4WXRA 4L50A 4JROA 1I6KA 2QLLA 2EZ9A 4FGJA 4ZCQA 4GXTA 1C9JA 4JB2A 4WH0A 3P2JA 4LEIA 2O2EA 1MW9X 4MQLA 3EXHB 1DJMA 3FBWA 4D7AA 5TJ9A 2XB2A 4EYQA 2IRWA 1XNRB 1ZD3A 1W2GA 2AW3A 3VZCA 5MHTA 4HGNA 4BP3A 4N3AA 1KYXA 2YZ2A 2AUMA 5F5LA 3RQSA 2ATEA 3WOVA 2GVNA 5IS2A 4ERXA 5UKDA 1VGVA 5IYZF 2P9YA 4CQNA 2H1LA 1GZ5A 5DMXA 2WMYA 2ES4A 3TXYA 3UW1A 4CM7A 5AUPB 5BXYA 1PT9A 3K6SB 1YJXA 3QIAA 3S2YA 1MOQA 1GUAA 1ZJZA 1Q0PA 3HUUA 5LBUA 4PC6A 3C3WA 3AG6A 2CL0X 3RF6A 2BEJA 3LOPA 3M81A 5EUCA 1N2SA 3SHWA 4R0MA 3RSGA 2NQTA 1EVLA 4L28A 5KSOA 3PNYA 3F7OA 2H07A 2G5CA 4K6CA 5D51S 5B1IA 1ZVQA 2PKWA 1SAYA 5FYQA 1FQJA 221PA 2WE8A 4BFVA 5EIEA 2CJYA 2FSIA 4Y1RA 3SIWA 1YR6A 4PY2A 3D64A 4H3HB 1XCMA 1XZCA 4PCLA 4L7VA 4DLWA 4HNUA 3DVLA 5CH5A 2HM7A 3F6EX 1Z5NA 5CBPA 3CE9A 1QCCA 1W6UA 1KPIA 2V74B 2YWFA 3WMGA 4UDYX 3BGWA 3GARA 4Q82A 4RTOA 3CX4A 4ZT4A 2FA9A 4L51A 2BP7B 3G2JA 4RK7A 2XT0A 1DAFA 4CQLB 2WTAA 1NBIA 1I2BA 4IFEA 1DJPA 4M21A 4R3NA 2WM3A 4ALKA 5CDGA 4B3IA 1UBNA 2MJLA 3LFHA 1R8YA 2FW0A 1OJLA 1ZRMA 2ACVA 4J07A 1CUAA 2R1VB 1AGRA 5JE8A 3HWWA 1X87A 2AMYA 4RGQA 1AURA 1XELA 2JI4A 5KB3A 2Q7XA 4ANFA 5ARBA 5HQ3A 2PJRA 1FX1A 2RHOA 1DO8A 3LHSA 3LBYA 4LSZA 3T7EA 5KNCH 3AU9A 3ZOZA 2GFIA 4UMEA 5LYYA 3WDSA 5HQ3B 4YY3B 2ZG6A 5ED4A 4J03A 2AN4A 1PR0A 2XYGA 3REQA 4FGKA 1GUBA 1JJBA 4MJXA 1ATZA 1Y7HA 4MINA 1L5MA 2R4UA 3WLAA 4BNKA 2OLJA 3ZIDA 3WIEA 1F2TB 3PV0A 3QVKA 3P9YA 1WDLA 1GFSA 3N6RA 4EG6A 1S2MA 1DEAA 3ANYB 5E2IA 2C0CA 2PKQP 4NEGA 3WMFA 3EXIA 1TQDA 4YONB 4EA7A 3PJRA 3KSDO 3KYJB 4KGVA 4OYLA 1HE2A 1Z5ZA 4TRNA 3W2FA 4B71A 4ZYXA 4RK1A 4AJ4A 1E5DA 2C3OA 2IKSA 4CT0A 2Q3LA 2Q2OA 5DYWA 4HZGA 4FBGA 4KQ1A 2HLDA 4QYMA 4DAOA 4KE7A 3JQFA 3E0XA 1OGJA 5ITZA 2Z6VA 3W9BA 2NU7B 1Z12A 2W2OA 1MIHA 2OQRA 3NNDA 2HK9A 2HWUA 4P4GA 3W7AA 4CCAA 1B8PA 1QH9A 1B14A 2PGDA 4DS3A 4TZTA 1G5HA 1TDJA 1OD6A 2VZ8A 2OQVA 3WGKA 3A11A 1UOQA 4K3VA 4GZLA 5DK4A 2A58A 3OHSX 2E4WA 1DQPA 4D9EA 2X4LA 2QT0A 3ZZMA 3DGFC 4Y2SA 4J2HA 3RC9A 3H99A 3KZVA 4LWPA 4YCMA 1PDOA 1QVVA 4L5CA 2XBMA 2RHWA 3CRRA 4OEHA 1UWLA 1XD2B 1YI1A 3P94A 2CCGA 3VYTB 4LJ9A 3K4HA 1Q50A 2ZYIA 3GVXA 2OG1A 2JFUA 3I3SR 1GYRA 4P81A 3WYBA 1OLUA 2P9EA 3Q0EA 3TFWA 1I32A 5KWEA 1XA3A 2Y1DA 1NMQA 1WQ3A 2LKCA 4PAWA 1JIXA 2HMUA 1S7GA 4AO6A 4LJKA 3RE1A 2DZDA 3KYCA 2P6PA 4EKYA 1A71A 2QTLA 1RHRA 3R5XA 3IQGX 2XF8A 2LDXA 1OXSC 4GX0A 4L8LA 3R77A 1AV6A 3VU1A 1U1IA 3RS0A 2AXQA 1JJFA 3B3GA 5JATA 1KZGB 1AZTA 1MV5A 4EO4A 1SQ6A 1XR3A 3U9SA 3NZEA 4WCVA 4DKJA 2QEQA 4GT1A 4JT8A 4D6XA 2YWGA 3EZ2A 5E4YA 5TGTA 1PQUA 1CJBA 2HCJB 5IW8A 5HCIA 4II7A 2VUIB 5H9VA 2P3OA 1WD7A 1GNTA 2YDYA 3VDQA 3P8ZA 1TU3A 3HG7A 2DETA 5T57A 1GQQA 3L02A 1QFSA 4W7IA 2IH5A 2P9GA 3GRYA 3M6MD 3Q3HA 3EGDA 4P7KA 2BTQB 5ICFA 4ZWNA 1VLHA 2WD7B 3DKPA 3I28A 3AV3A 1G8KA 5TVGA 2HQ1A 4DJ5X 2BCGY 4C0SA 1HNXB 3G1TA 1HYBA 1E9FA 2Q5OA 2VUTA 3NTOA 3GAAA 2WJPA 5EZSA 4DWWA 4F2HA 2A88A 3OP1A 2YVAA 1NXVA 4PQRA 4DIMA 2GFHA 5LL6P 4R98A 4WY8A 4C6SA 3DOJA 3M2TA 3TI7A 3N2NA 3HCPA 4DR3B 3L5KA 3UAYA 1R6XA 2HJGA 2HPVA 4PBSA 5K3CA 2NZWA 2EXXA 2QTNA 2IU4A 5IJXA 1R88A 1PRYA 4JIMA 3F73A 2PKYX 5I5GA 1E4EB 3HCDA 4EZEA 2CXSA 3OX1A 1E3WB 4BFTA 1XQ9A 4DCOA 1W5SA 2VF2A 4GVPA 5HDBB 2TSYB 2OBMA 2VBIA 4AMGA 3QKRA 5JZOA 3LHFA 1CUBA 3TIIA 1Y9DA 1YUNA 2QL7A 5CM8B 3RYIB 3ELDA 2I5PO 2IPMA 3V1KA 1BHSA 4M99A 1LSOA 1ST2A 3MCUA 3NDPA 4RV4A 4B32A 1P60A 2XCUA 1EWKA 4P4TA 5A4IS 5HJ5A 4PC1A 3CPHA 2F8LA 2NVWA 1PV4A 4CF3A 2QAJA 1U6IA 4B1FA 4C03A 1UBSB 4BOYA 1IZ7A 4W99A 3WAKA 5FWXA 5ALDA 3EJWA 2EJTA 1GJRA 1HGXA 5DBOA 4ND2A 4RJLA 4WFIA 4EJSC 1PR2A 1P2GA 4EEKA 5FBQB 1QBKC 3PQ6A 1SOMA 3H0KA 1SCQA 1SVKA 4ARIA 1KOFA 4WXHA 1M75A 1T36B 1C9DB 5ITWA 1DT3A 1K5HA 1UFQA 3I5XA 4CEIB 1MTZA 1QF6A 4ZO6A 4L9RA 1DV2A 2WYUA 1S2GA 3LQRA 4M1TA 2SCUB 1AA9A 4L5BA 4MPPA 5A5GA 3HRIA 1N4DA 1YZLA 2JFXA 1AG9A 4OXQA 1M7GA 1AY0A 1MAHA 4XCXA 3P0IA 2DQSA 3PQ5A 2H5IA 3UCFA 1TTQB 3TTWA 3WGOA 1BCRB 5KVAA 4QM7A 2QV7A 3T52A 4D0RA 2BELA 1FBTA 1UT5A 4YMHA 2XUZA 4ZVPA 4DDKA 4DCPA 1KMCA 2CLHB 3PDJA 3V3TA 1YZKA 3MJHA 3VHLB 2Q27A 1FYFA 5HE8A 2UUCB 3KBOA 4O4LF 1LPOA 4OH1A 3ZWAA 4W5QA 3ONVA 5G53C 1JLSA 3GAMA 4QNNA 1ETHA 2IGTA 4LZOA 3IS3A 5CIQA 5A5FA 2OMKA 2X3FA 3M89A 4KQHA 4DB4A 3JQGA 3KXDA 2ZBQA 1DPFA 3HKCA 5AVTA 2PX0A 2XVYA 4JJ7A 4L2IA 3FZQA 5D84A 2XMZA 2C9ZA 3GDFA 4W7SA 1CUHA 1G20B 1KQPA 1ZMBA 1R12A 2JJ8A 5JY6A 3PVCA 4NFHA 3UJAA 4B2YA 2VNAA 3AF6A 1KHTA 4N54A 3LXRA 4FSXA 4G56A 1AMNA 3J81A 4MJLA 2B34A 5DIZA 1N3BA 2BW0A 3P9SA 1CB0A 3GZNA 3DAHA 2PIAA 1U9ZA 1NJ5A 3EEIA 3KJQA 3W7BA 4YMTA 3RJ5A 1YH3A 4RU1A 4EYGA 3D4LA 2J3QA 3ZXYA 4DR6B 1SK9A 1EQUA 4TSFA 4ALNA 5DYTA 1BOOA 1GO2A 1GSOA 4GWGA 3LUKA 4HYQA 1VECA 2YVUA 2YXEA 3CX8A 5DO9A 3ILYA 5HGJA 4DG5A 3DDCA 2FPXA 1E2FA 1HSOA 1JBEA 2R8BA 5EPEA 3MMXA 5L51A 4E5PA 3RR2A 2C95A 3WJAA 3G8AA 4XIJA 4B3FX 3L01A 4H7PA 7AT1A 3BICA 2PO7A 1IN1A 3ISTA 3TMAA 3ZJTA 1WTCA 1VDZA 2GHTA 3VGPA 4PRKA 4YUYA 2B6HA 4YO7A 1P5FA 4IDBA 1UZAA 5CBPB 2VKQA 1FXWA 2ABWA 1EHCA 1R10A 3IPCA 3SSMA 1DEOA 4O8JA 4HF7A 2Z0MA 4G4IA 4PX5A 5B3JC 3ZWNA 4ECEA 2WEKA 1UINA 2NO9A 3FPBA 4DLRA 3KDPA 5CGQB 3GHYA 1V9SA 4J1NA 4LG1A 5AW6A 4TM7A 3S8EA 1ISHA 1BMFA 2OCIA 3T35A 2XTAA 4QPJC 4UHJA 2VZEA 3AF2A 3HV0A 1GHTA 4MWGA 5AW3A 2HZ7A 3DLTA 3WX0A 4CIWA 5J40A 3BDIA 1DIOB 2P1ZA 4MV7A 4NECA 1EXWA 2PX3A 2Q1UA 4UC0A 4Y0AA 1OAAA 2Y3IA 4BX8A 1XF9A 1OREA 1VJ5A 3GCGA 1BDHA 3EUEA 3W3AH 2C5AA 5B58T 2AVNA 3D3QA 1OX4A 3IILA 4W8GA 4XASA 3R9KA 3S40A 5HZGA 1NT4A 3CN9A 1XMJA 3TQCA 4X24A 1W8IA 4TMKA 1IXKA 1WNFA 2Q8PA 1KMNA 2ZUFA 1LQ2A 2QTMA 3TSWA 4K6FA 4JLAA 4HEA1 1F3LA 1HDOA 3MGGA 3BRWD 1MDFA 3I37X 4PAMA 5AVXA 2OB2A 1KK0A 1L7AA 3K09C 1B74A 4LC9A 1U2SA 1YJBA 1JENB 2RHRA 3FPAA 4GSKA 1IG0A 1MJHA 5JRJA 4BBAA 5K0CA 1BX3A 1V7ZA 5C1DA 1TD1A 1JHZA 1AUXA 5HFNA 2BGIA 2NVOA 3NASA 1IQUA 3N8IA 2UYHA 3DUFA 3ZCUA 1NWHA 2V7BA 4J0DA 5K3EA 1W4BA 3F47A 4BVFA 2F43B 3T06B 1VHQA 3FKSA 5JSUA 1FXUA 1RACA 1VE6A 2H4FA 3DSRA 4OGWA 4PBTA 5K4HA 3FNEA 5LP6B 2NSDA 2QTZA 1U8YA 3G0GA 3OT1A 5C5EA 1KYTA 1ZUNA 2H1SA 4I9GA 1QP7A 1MA3A 2H16A 4OB7A 2IYRA 1W2WB 3I9JA 3GWGA 1CNMA 4REQA 4IKOA 5AM2A 2Q1WA 2C20A 3JVDA 4IVNA 3WMRA 4C01A 1UMBB 1RBYA 3WDKA 4U39A 2VJDA 3PG5A 3UMFA 1TTHA 1V4VA 3P2IA 3WFJA 1SPXA 4DV5B 1YDFA 3WNQA 4HBZA 4I50B 1YRQA 3IVRA 5JVDA 1U7UA 4GD3Q 4E6EA 3CFYA 2H2IA 3PRKE 1NJ6A 4C4XA 3ZUPA 1HK7A 2G40A 3TI9A 1JMVA 3PNQA 1YTLA 3IBYA 1C0PA 3KQTA 3BGDA 2H48A 3FYDA 1YL7A 3MBIA 1B3BA 1L4YA 3HGQA 3PEVA 4UBMA 3Q98A 4JJIA 5FRDA 3OHPA 4CW7A 3IAXA 1ISGA 3HXOA 1XCBA 1GA4A 1W96A 4GMDA 4KXVA 4EW1A 1ZXXA 4QSMA 5FL3A 2TRSB 5JIBA 4DQVA 1A8HA 1ZICA 2GF9A 2OVBA 4PNPA 3TWOA 1NVKA 1H2FA 1KJZA 1NVXQ 1E4EA 1MABB 3QVTA 1T4MA 3L0PA 5KNCA 4QVIA 1M2OB 2JVIA 1QXSA 1JU4A 2EG9A 3KKQA 4WLVA 3A8TA 1AUOA 2JGIA 3HDYA 1RMQA 4U2KA 4AZ0A 1UQRA 5KYUA 1T9ZA 1IRXA 5CNMA 2A3NA 2DUNA 3QA9A 4HL6A 4RVNA 4W6ZA 2O1SA 4WNYA 3SQOA 5TGDA 5J1SB 1PNRA 2KS6A 3T9BA 1FVHA 4UAUA 1BMDA 1T4CA 5KX5B 4R3UC 1Z8HA 2NSLA 1TVCA 2X2PA 3L6UA 3LX5A 4IJQA 4JI4B 3HPQA 3JTMA 3ABRB 2I6SA 3T5BA 5CA0F 5KMGA 3N58A 1W36C 2XKJE 2Y1FA 3FMVA 3WYFA 1F60A 2NXEA 3D31A 3B1JA 2GNPA 2DKNA 1BCSB 3IUNA 4RNDB 3TB6A 3W5JA 4N7MA 3M5CA 1I0IA 4G2NA 1YB7A 4E13A 4NMHA 3IEXA 4ER7A 1EUDB 3VPXA 3S70A 4UBOA 4CMJA 3OOWA 3PDHA 4OJYA 1IU9A 4IJ5A 2HRZA 4AMUA 1SUPA 4CPDA 2CDNA 2HEGA 4KR3A 1M33A 1QIEA 4KWHA 3A1DA 1OFIA 3AFOA 1T3HA 4TWBA 4WACA 5JO9A 1RLJA 2UV8A 5JS2A 3KHKA 4E5VA 1E1YA 2AX4A 2YBEA 5I47A 1W49A 4KLNA 4C0AC 1F4PA 3A4MA 3QTTA 4OAOA 3FCAA 3NIBA 4YRAA 1RXWA 3TVDA 1XX6A 4MV6A 2XMPA 1FRFS 1R74A 1X8LA 2EKPA 3KQOA 3AINA 4P0QB 4DIKA 2B8JA 3M0EA 2HFJA 1YXMA 5B4UA 4YR9A 5MDHA 1I9GA 4XWWA 3CW8X 4YGYA 3ZV3A 5IRCD 5C4GB 1RVDA 2C42A 1VSBA 5EZ5A 5TVKA 2Q5JA 2VJYA 3WLKX 3B6ZA 3HDGA 1PJLA 4QARA 3IUPA 5F78A 2IZ0A 3EBLA 3ZHCA 5LQCA 3SWWA 3ENNA 1Y6QA 3H83A 5KQSA 2AMVA 2DBRA 2Q1XA 3P71T 4WXMA 1W8DA 2ZUCA 1MGOA 2NQ8A 3CRVA 1ETUA 1U2DA 1Z37A 1WMFA 3TNFA 3OJXA 4FR5A 4O1HA 5DHQA 1ANKA 1QLWA 4ZU1X 1Z8DA 3PNMA 4S1VA 4CYMA 5TMPA 1IM8A 1JFFB 2GN9A 3ZHYA 1P3Y1 4OLJA 1XB2A 3BJEA 3GJZA 5HHTA 4MV4A 2GS9A 3OKFA 2C4HA 1JHYA 1RWMA 1NW7A 1GTMA 1D1PA 2V3CC 4N3CA 2AWOA 3GMTA 1CBUA 1UWKA 5CCBA 4BQRA 5C7LO 1W44A 5SZHB 3UWMA 2AFIB 1LRLA 4J6EA 2ZZNA 2J32A 4ARZA 5EG5A 2G28A 2QE6A 4QJ5A 4MKIA 4PO1A 5CCEA 4MS3A 4BLVA 3WAJA 5BSTA 2WSYB 3VYSB 4A03A 1P5JA 1QHXA 2IEAA 4N7BA 3B6EA 3NBMA 3ZU6A 3CNHA 1Y63A 1E9AA 3GFGA 5IF3A 2WVJA 1YULA 4J1TA 3MLBA 2XX3A 5IAJA 1O9HA 4Q0MA 4OBXA 3DCIA 3ONNA 4MW4A 1IVNA 5HUHA 2EBFX 5CDFE 1PWYE 2J07A 3E15A 3OTWA 1M83A 3QBDA 3IUQA 4BNWA 2XVAA 2NV2B 8OHMA 8ADHA 1QLHA 1RM5A 1Y4UA 2FSGA 2Y2VA 2MT9A 3FDZB 4OFWA 3AVPA 1T5DX 3GRVA 3VR0A 5AJTA 2GD2A 3DR3A 3WZLA 1NRWA 3RDPA 1G21B 5ADUS 3GJTA 3FUXA 2NUPA 4KR2A 1VB3A 1AU9A 3I9FA 5CM9C 1RABA 5MN6A 3H9CA 4U7DA 2D0OB 4WN9B 1QG2A 1WPQA 3WK9A 2WA1A 2CHFA 3D1JA 3LUBA 3MTIA 5AXBA 3Q15C 5FEMA 1GKUB 3TVYA 3LYUA 1E18A 2W71A 1EUQA 5THQA 4O0LA 1U0RA 2HK6A 1TQ8A 3C3BA 3IMFA 3NQ41 2IV3A 1OLSA 1NTOA 2JI8A 4I1IA 4FDUA 1ZL2A 1A96A 3BB4A 2AG1A 1G5IA 1RW4A 1SRQA 3H5IA 1UKYA 1X9GA 1GUYA 1VYHA 2OZLB 3TZLA 5LWQA 1AMOA 3E3MA 1IVYA 3QE9Y 3V9AA 1FCJA 1OU4A 2OZLA 3DE7X 2ST1A 3CJRA 3IPXA 1EHIA 4CKEB 1YQWA 5JMTA 1J5PA 3QMWA 1OWMA 3N87A 3WDLA 1AV7A 1H6DA 2PBRA 1A8QA 3HXTA 3U1BA 4CTJA 4K8OA 3HU2A 1YFZA 1OF1A 5IT4A 3CS3A 3RSOA 3GUCA 3MCWA 2PGNA 5ARCA 4HY3A 3MZ0A 2IU0A 4DXAA 4GDMA 1PGQA 3O2JA 5CJPA 5JSKA 1V39A 1YA4A 3NPMA 3PBKA 4D4LA 1Q6ZA 3T54A 2Q0XA 2OHJA 3SC3A 3T1HB 3SMQA 2NTVA 4L07A 2XXAA 4JB3A 3FYSA 3SE0A 3CIOA 4EKDA 1R4NA 1JHOA 4B8ZA 3RBVA 2F9MA 2ZKLA 4CN9A 1OFHA 1V5IA 2GCIA 1ISFA 1DXYA 1KGSA 3H11B 3SYTA 4URWR 1P77A 1C9EA 1TEHA 4MMYB 3D7NA 5EWJB 1ZVJA 2FX3A 3H1FA 3UFBA 4DLNA 1Z83A 5FP0A 1IVSA 5EZ6B 1AGYA 4PIMA 4B4OA 2IGBA 2Y8EA 1M6HA 3LBFA 4UREA 2IS1A 3F5QA 3FLMA 3PC3A 1H2WA 4CTNA 3M6IA 2C7PA 2UZ3A 2GJSA 1FYDA 1LRJA 4LOAA 4N49A 3K6JA 4MWOA 1Y37A 2D2IA 4JK3A 4G5HA 1E9CA 1JZTA 1DFHA 1JQ5A 4PZYA 2NGRA 2X8JB 3FYUB 3ZBQA 3K8ZA 3ZK7A 4JP8A 3W4IA 4F3TA 1XFDA 2FX2A 4PTYA 3QF7A 1PZMA 5CFLA 3G02A 4YQZA 4FUQA 1S96A 3OF3A 4UVEA 4HB2A 4HN4B 5H3HA 4TTQA 4TWAA 5B4TA 1L5GB 4JL5A 2P1RA 3JD0A 4ZJUA 1IXRC 3L0IB 4GP7A 4LVCA 4YCBA 1LLDA 5JYFA 4MWSA 3UAVA 1CF4A 1NDQA 5CU7A 3PS9A 3WHPA 4I1PA 3ILVA 1OWNA 4YAEA 4NZNA 3I9KA 3NRJA 3T7CA 2IHUA 2XGJA 1XZGA 4C1NA 2I8LA 3ISVA 3QOWA 3DOEA 4Y7CA 3PGKA 4X97A 5DT9A 1WZEA 3AC0A 3FH0A 2AR9A 3ZX5A 3N8GA 4AJPA 5CLJA 4YCJA 5DHSA 3DPUA 3PNKA 2PJZA 4RKEA 2E1RA 1MR3F 3A6FA 3GPCA 3MWEB 4QPNA 2VWPA 4RORA 3VM6A 3W78A 2V0GA 2ZS8A 1A5SB 1U2DC 1CNEA 3A2NA 1QKIA 3ETJA 3DBHA 4HDNA 4XPZA 4YDSA 5EE3A 5FHQA 5TPWB 4MARA 4MGKR 4YCSA 1QQBA 1J49A 1Y81A 4GU5A 4I4CA 2C82A 3HU1A 3OPQA 4FMPA 4JODA 2W43A 4X3OA 4DRXB 4R5HA 4QDZA 5EJAA 1K2VN 4PAGA 5K3DA 3ETNA 3O9MA 3C74A 4QU5A 2OVFA 5U1PA 1SBCA 4QG3A 1XWFA 1JRLA 3R8XA 2XMRA 4ZZ2A 4C7VA 5IUKC 1AKRA 2GZ3A 2JFHA 3V4PB 2ZFUA 1W9HA 3CH5A 3ESXA 1TZMA 3HEBA 3ZU3A 1YASA 3PWTA 1HZZC 3TLMA 3V4VB 1UT6A 2HXYA 3EB9A 4DSAA 5IDWA 4HN9A 3HJFA 2VAVA 2G5TA 1P61B 1SIBE 2E85A 1YRLA 2VP2A 3EHDA 3KO8A 5TC4A 3U3RA 5B64A 2DU8A 1DHTA 1DRJA 1ZD9A 3AL2A 2ZRLA 2P3LA 2PWZA 1EZ1A 3CRW1 4WNCA 3GVPA 3JU3A 4EB6A 4QYSA 1MQSA 1E1RA 3INNA 1UK8A 2GWRA 2J3IA 2H3HA 5KNDA 1SEPA 3DE4X 5JZVA 2QQ0A 3IDSA 2EF0A 1PZGA 3U4AA 2PUTA 1UOPA 2GEDA 1USUA 2XUIA 3COWA 4RK4A 3WKAA 1Y9JA 4YECA 2V54A 1VFPA 3W8RA 4OHOA 4BDSA 5IVIA 5L7YA 4JXZA 1G3IA 3UJ7A 2DUMA 1U0OC 3SBXA 3W5IA 1JDZA 1Z9BA 1OYYA 4YP6A 2H5EA 3C7AA 3OCZA 4V0RA 1XGKA 1JVNA 3OQHA 1PVVA 2VHVA 3BK2A 1ZNWA 3O4FA 4K40A 5CT4A 2AQKA 5JAZA 5U4QA 1Q11A 2PWYA 3MOGA 1DCKA 3BG5A 3DAFA 4PRLA 5LA6B 4K6HA 2IVZA 3BVPA 3IT3A 4MA0A 1A9OA 1WTAA 1VG0B 2OY0A 2ZJZA 3N2GB 2ZJFA 3O4GA 2ZVDA 4GQBA 4Q4AB 5GJVC 3UJ8A 2CKDA 3JZDA 2G80A 3NDRA 2W2LD 4LJYA 3N2GA 2VZLA 5IK2A 2WPDD 3F3SA 4FWTA 3DCYA 1OASA 1IQPA 3PFIA 3QXSA 1O87A 1YVDA 1ZU5A 2GK7A 4TLCA 1X1TA 1V1MA 4GKAA 5HXAA 2QOEA 4EHJA 1QH8A 2W11A 4KBYA 1FFXA 1NVFA 4TXNA 3R9XB 3AY6A 3PUIA 2A0FA 3A4LA 3I53A 3R9XA 3K1TA 2ZUTA 1KY2A 2O50A 2FR1A 4L6CA 3HUDA 3NWBA 4ZVTA 1LNQA 1O2DA 3PK0A 3BHJA 2NU6A 1P1RA 4K2AA 1L5FA 3K9GA 3SQDA 4DSUA 1TUIA 1JLLB 4GLOA 5KTPA 1POWA 3WP0A 4TS9A 5LYJB 2JKZA 3IVGA 4P7JA 5D3QA 3EPKA 1GP2A 3WNDA 2CE2X 2DGDA 1YIDA 1QHGA 4MVWA 1SM4A 1VJRA 2JIDA 3LW8A 3RVNA 3DF9A 1AKEA 1HRKA 5CT8A 5B57C 1L4BA 2FB9A 3B5JA 4MYSA 4ZTBA 2V5UA 3K3PA 1DKUA 1NW8A 1V1JA 3B2EA 2H9YA 3ENVA 5DW0A 4ZDJA 1MHTA 3A6DA 4NMXB 4NYJR 4NQRA 2V96A 2VRBA 1I7LA 3EXHA 4JP1A 3RG2A 5CG2A 1E5XA 1IBCA 3K0EA 3JAKB 1TJNA 1YZTA 1GGFA 2WT9A 2R8PA 2D1RA 2CHVA 2QD4A 4O5OA 3A9TA 4Z54A 1ND5A 1R6VA 5ALPA 4E4TA 5FNVB 4DC0A 3WYEA 4UARA 5EMMA 1GGMA 3HXLA 4DY4A 1ZOSA 5G0SA 5A06A 4JGIA 4NBTA 5JD5A 1JMYA 2ZWAA 1PKEA 2QXTA 4M1OA 1E8DA 4UBLA 3TRDA 1R50A 4L75A 4BNIA 5I6DA 3WC4A 5ICMA 3E4DA 1ZLYA 4U2GA 2IY9A 3PHGA 3GZJA 3D8BA 5IC6A 1QPZA 5LU9A 3TJZA 4AF8A 3HYNA 4RQBA 1YB2A 4OI2A 3TD6A 1E2IA 1KQOA 5F9MA 2HSWA 3VU8A 4BFSA 2PNJA 1WUJS 3HB7A 4ZT2A 2YN0A 1B8UA 4PLFA 4E08A 1M2KA 2AK2A 3IGFA 3VO1A 4OIMA 1KI3A 1ZD8A 3AETA 1FNBA 4N03A 3HTXA 1R00A 2A9PA 3ELBA 3ZI4A 1VCIA 4CKCA 3TLXA 2VQ3A 1S8FA 4WKNA 3X1YA 4WK2B 4ID9A 4QDJA 2ZYUX 1AK1A 3NOQA 1G1MA 5DGXA 3A3NA 3HUEA 3N2YA 3FPCA 1FA9A 2NX2A 1W59A 2B4YA 2C7GA 2QSUA 4R7TA 4UMVA 4C89A 4LYHA 1N9GB 1YSCA 4OHYA 1PE0A 1CZRA 1SVNA 1IOWA 2VXBA 1NVVR 3H16A 1TEZA 3H2ZA 4PNEA 3PDUA 3C6MA 3T7KA 4E12A 1C8KA 1NBME 3MCAA 4QUAA 3HO8A 2DERA 2XNDD 1YRHA 4P5DA 2CE7A 2I78A 4JELA 2ZYTX 3UVEA 3W6UA 3WRXC 1TVEA 3TCXB 3IAEA 5ALTA 4MUIA 4NPHA 1D6NA 1D03A 3VO2A 2Q9CA 1TRKA 1KARA 3PIRA 4C76A 5EXTA 3ZQUA 1ADJA 3FMIA 3C5VA 1EFKA 1TM7E 4BECA 1FFBA 3WMWA 3HJBA 1BX1A 1E92A 5ERYA 4F45A 4CTMA 4PZLA 1KEEA 4NDNE 1KXZA 3RASA 5L6LB 2QRMA 1Z2CA 4A8JC 4K0RA 3KVVA 1YBHA 4U9IS 3IMKA 3ID6C 3G9QA 1RWVA 4MVJH 2XHEA 4XJVA 4DM7A 1JZSA 3D3NA 2JARA 3GAFA 1UOEA 1WLYA 1XAIA 2DPMA 3KQQA 3KZ1E 4RENA 3EBOA 3RUHA 2FUEA 2GO1A 1XQ1A 2YW9A 4HPJB 2DJIA 2H1RA 3Q3CA 3VI4B 1LTQA 5FUQA 1QF9A 2XDQB 3P0FA 5EGNA 2OYRA 4JP3A 2JRCA 5CLLA 2A9FA 3WADA 4D74A 4AYTA 1MIOB 3H4MA 4ZEOA 2Y4OA 3RYHA 1FP4B 2AWNA 2AXPA 2G5PA 1V35A 4E3ZA 2CLCX 3VTKA 3CF0A 1LPPA 4R1PA 5M6DA 5HWSA 1CJUC 4HWKA 4KQWA 3OCVA 1ZLXA 2B8TA 5KQRA 1BXRA 3BWVA 2Y1LA 3F49S 4A16A 3K9HA 4Q7MB 3TM5A 1EDDA 3A3KA 2JGDA 1F51E 3ZDZB 3I2HA 2O2DA 3T3MB 3WXMA 4ARAA 3E7WA 1NHGA 3F9IA 1CQPA 1X19A 4LYYA 4WOBA 3PXEA 3S2SA 1PUIA 1JEYA 4LWZA 4MDEA 4ZAWA 3PHJA 3ZJYA 3GJXC 2CNWD 3EUAA 4LFBB 4U7GA 4QFDA 4TV8B 4TMXA 4PNZA 5A2GA 2GZ1A 3KYCB 1NXQA 4DA4A 5CVVA 1DRUA 4F9TA 1NUPA 1Q3TA 3I6QA 3SU8A 4P31A 1UPAA 1EK2A 4FYWA 1QHEA 3PDWA 5AT1A 3SJUA 4QFCA 3V4OA 3BN3A 1B0AA 2GM5A 2WAOA 4LOJA 3DAYA 2R6DA 3EGOA 4LS3A 1KAMA 4LXUA 3NVKI 2RJOA 3MCVA 5DLEA 4BGIA 1W75A 3DZDA 1TU4A 1QIIA 1UJBA 2C96A 2PXCA 2FDXA 2PSEA 2HC9A 4YR7A 5ESRA 3NHWA 4MI3A 4ME6A 2FVXA 2WY2D 2XADA 4Q3BA 5AW2A 2YOFA 5DTJA 1P2BA 4RVOA 4BNFA 1M1XB 2GWHA 4J90A 1TPYA 2JAQA 4Q3NA 2RI1A 4CM4B 4NEQA 1OXBB 2WD7A 3LXMA 1O0SA 1VJDA 2G4LA 3LVRE 2ZOSA 1BFUA 1ZESA 3TUIC 3VPFA 4REOA 2CV0A 1QE0A 2CLFB 3N0WA 1IL0A 3PF8A 1C1XA 3BWBA 4F2PA 1Y80A 1KR5A 1UXKA 3QUBA 4ALMA 4AJJA 1Y9ZA 4ZI7A 3QBTA 5A04A 5E7IA 1NUAA 3E8XA 5IBPA 5G41A 2MINA 3LDUA 4X6LA 3JQFC 3NB0A 1AUVA 2A59A 5K3FB 1UP6A 1ZWKA 1G9XA 2AX3A 2FMKA 4C4TA 4MRMA 3QKUA 3WRYC 4B3JA 3LG2A 4Y6OA 2CL7X 4WNIA 4ZVOA 2BCEA 4QTZA 2PPVA 2D7CA 4F2DA 3PXDA 4K6KA 1Z75A 4GI7A 3SD7A 4JBHA 3ECCA 4FB5A 1U90A 3QPCA 2DKOA 4AMYA 1JR3D 1VL2A 1WAMA 1U28C 3K20A 3IQFA 1MAVA 1BQEA 1BWQA 3D7RA 1XKLA 2QTWB 5CT5A 5B1DA 1EHYA 4RIIA 4X62B 2PKCA 4HRAA 1UAAA 3A4IA 4JI8B 4CEHA 3IKMB 1P0FA 3T9FA 3R3SA 2A67A 4QAJA 4ED9A 1UM9A 3K96A 3DZCA 3JQBC 2CVQA 4BO0A 1USIA 2BRUC 3LAWA 1HEIA 1YT5A 3IIIA 3Q3EA 3RSSA 5KJEA 2JAWA 3UA4A 4WOKA 3AR9A 1H2EA 2FWNA 3K8OE 3T3HA 1GRVA 4F6RA 1U8EA 4DGSA 1TEVA 4XJSA 3TGWA 3MXOA 1EQ2A 3A1CA 3PITA 4WXEA 1J8QA 2VF5X 4PLCA 16PKA 1TECE 5LYJF 1EGMB 4AY6A 2F8TA 1CEEA 2ID8A 5JBQA 1YAHA 4DYDA 2ZRFA 3DHWC 1I7NA 4GKBA 3HB9A 4QYIA 4Q7LA 1FPQA 2H2DA 2Y6UA 3QV2A 1BE6A 2GN0A 1V4BA 1K7SN 3U4GA 2JW5A 4LZWA 3O4JA 3JVEA 3LBAA 3B53X 2DFLA 1PF7E 3AHHA 4MP3A 4X95A 3F6YA 4P9NA 4R1LA 2CF6A 4GMFA 1B23P 5JRDS 2C5BA 4OQZA 4PYRA 3RAPR 3I01M 3LL4A 2QMEA 1UZMA 5KQMA 2BUAA 3N2KB 4L7QA 3UB2A 1XYGA 1PVDA 1ZSNA 3CG4A 2UXBB 1VKZA 1CXZA 3FUWA 2WLTA 3OJLA 1JLHA 2PSSA 2ZROA 1BEEA 3ORHA 1DQSA 2VNHA 2I2FA 2VXCA 4PE5B 3CC8A 3FF1A 5JMWA 2JHGA 4G1EB 4IS2A 1UK6A 3SMVA 5E4JA 5CH8A 3X3HA 1NOKA 2X3YA 3HHPA 3ZTWA 3DC7A 2CMHA 3CE6A 3SHQA 4EJSA 3ZE1B 5BPFA 3ZD8A 3QEAZ 4BMXA 1RPTA 4JBLA 4KN5A 1KEKA 4YH1A 1RAHA 4MUYA 1OXKB 4OBWA 1VPWA 4O2AF 1F2UA 1N1MA 2J5XA 3E7PA 2BYTA 2GLUA 1AOXA 3ESBA 2QTRA 3JZMA 4Q21A 1FUEA 4BZQA 4C7MA 1QU3A 3ZV5A 2JLCA 4JJEA 1C7EA 4X44A 1E6KA 5CA1A 2FK8A 3HKEB 5DX0A 2D3TA 2JFPA 1VM6A 4FGWA 2D5IA 1XDGA 4MGIR 1I9CA 1NZDA 2C8KA 3AG5A 3GLRA 1C7JA 3NC1C 3C3PA 3TYXA 3GUZA 4FSDA 3E35A 4PIVA 3ICQB 2HRCA 2AMFA 4TMFA 2B7CA 1PL7A 4QTXA 5TNXA 4UMDA 1LK7A 3BKWA 1RJDA 2QB5A 2EAUA 5KTYA 2C9YA 2XODA 3DL2A 1CPYA 4A6DA 4EX7A 3L07A 1C4OA 5L4LA 3IIKA 1AO0A 1RWQA 5TVOB 1SBNE 1VLQA 2XE6A 3QKTA 3PTLA 1UEXC 4NR0A 5KYXA 1E1CB 2ZZKA 4JU8A 4RGYA 4NABA 5JS8A 2B92A 3A31A 3IRUA 5D01A 4OY3A 1J7JA 2OA0A 3ZGLA 3MUOA 4YRRA 5CB0A 5IZ4A 4NXMB 4F3RA 2O48X 1RC0A 3GEGA 2HJHA 3NC4A 4P4LA 1P74A 1QC5B 2JCSA 4US0R 4Z3DA 2ONZA 4OHCA 5G1OA 2NIPA 1YQ9A 4DABA 3LOQA 1ZO8A 1XCPA 2HHLA 3KZMA 2NW6A 3T7RA 3TOCA 1FP2A 3KSMA 4LKOA 2JA2A 1N36B 3N0VA 2HB6A 3K7EA 4MWDA 1GG2A 3X0DA 4KGZA 4EB3A 2EKDA 2P77A 4HDSA 2J0VA 4LNUB 4RFVA 3MWJA 1WY5A 2RG7A 2EDAA 2QBYB 5C5DA 3WIDA 4HDSB 2FPIA 1Q21A 2BJWA 3QVXA 3IT2A 3D4PA 4O8ZA 1ESMA 5A1JA 5C8DA 3A6EA 5C1PA 1E5TA 2YXPX 4HMOA 1YNOA 3G2KA 1Y9AA 2PV0A 2WIDA 4KRGA 1Z0JA 1QGOA 1PK8A 1W0JD 3QLVA 4ZI5A 3HYTA 3KZCA 1U7DA 4A4DA 4WY5A 1EE1A 4KFSA 3I1JA 4OG2A 3PKZA 4FYPA 4AF6A 1Q16A 1YACA 4WCFB 3UF0A 2BFFB 3THRA 5ELXA 5LZ5A 3MRVA 4IXWA 4MTLA 5DNUA 4GPTA 2JIMA 3RAEC 3H1AA 1JQDA 2XXBA 3GP8A 3AXTA 2Q6KA 3MJ4A 2OV1A 2WSBA 3OOYA 3KJGA 1ZP6A 2DECA 1CEXA 3I9OA 4OATA 3S68A 1VL8A 3C6QA 1X8JA 4UCFA 1O9BA 2BTEA 2PLRA 2VDUE 3EBPA 1NF9A 1JDNA 2C59A 1XL1A 1QPGA 3PXXA 4KZPA 3ZW8A 1PN3A 1MOZA 4JIGA 1Q2UA 1HORA 1E3DA 3KL2A 5A7FA 2X5NA 3TH5A 4OFBA 1GKKA 2YMQA 3HWX1 3TNJA 3DB2A 1YU9A 1L7RA 2Y0DA 4XDZA 4NONA 1YC5A 2Q3BA 5A5VA 2IKQA 3QA3E 4MUHA 1V8DA 2C8LA 1K88A 4E21A 3GMIA 3OZAA 2O0HA 4JD5A 4WI1A 4AMVA 4DE5A 1JT2A 2PANA 4Q7QA 1ZN7A 4OHPA 5IHXA 1TAUA 1NOIA 1FDSA 3AEXA 4RSGA 3FMGA 4Q12A 3PTAA 1O95A 4BO2A 2Q2QA 5BRAA 3BD7A 3FAZA 2EF1A 2DUJA 3IPRA 2RAFA 1FDWA 1QBGA 3D54D 3O1IC 2V8OA 1TQ6A 1PHPA 1XLVA 1YR2A 3QMVA 4FN4A 1XMPA 4H6XA 4UEWA 3RT7A 3P2MA 3VHXB 5DDIP 1ZCZA 5KVVA 1L3BA 3JWGA 2YFYA 3LYAA 1DRVA 4X63A 3AI7A 4AJIA 4H4EA 3NW9A 2PHZA 3C70A 3FBGA 3OUZA 2IP4A 5AVWA 1EPUA 2BEVA 1ZBDA 2HLDD 5FBHA 3W4JA 4IIUA 3GF4A 3UK2A 3VR2A 4KE9A 4DDHA 1OT5A 3OE5A 4NLLA 1YJ8A 1R8XA 3W6NA 2WB2A 4AVYA 2ZKIA 3COJA 3FGZA 1YZ3A 2DFTA 4MUBA 4ZREA 1ODJA 5AKZA 3I9V6 2CEAA 5KX5A 1GKLA 1W5AA 1U3TA 2JGLA 4M8IA 1VP3A 1YVEI 4ND8B 3D6HA 3CVUA 1JE1A 3U31A 4TKVB 1NV9A 2RGCA 1XBTA 2A8YA 3SAJA 2P9QA 3HZZA 4Q16A 4A5OA 3PGJA 4X1YA 4F1WA 3CYFA 4EG0A 2AOTB 4DR5B 1QZZA 4RS3A 2J8ZA 4WZAB 4E15A 2X76A 2JVKA 1IZ9A 1Y5IA 1K1EA 2AOTA 3QHQA 4FONA 3T61A 1UOOA 5ITVA 1OVMA 2B4QA 1XL0A 3X2FA 3RV4A 2AR0A 2W9XA