2I3GA

Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with nadp+.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
347
structure length
347
Chain Sequence
b'VANATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHPHLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAVWERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAVTVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFTPVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAHIAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetyl-gamma-glutamyl-phosphate reductase
molecule tags Oxidoreductase
source organism Mycobacterium tuberculosis
publication title Crystal Structure of N-acetyl-gamma-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP(+).
pubmed doi rcsb
total genus 116
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2006-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2i3gA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i3gA01
3KSZO 3LLSA 4AJJA 1FDWA 3LU1A 1NPYA 3GT0A 4HV4A 2D1YA 1T25A 4B7CA 3IL2A 4WNIA 4HBGA 4E31A 1GEEA 3ZV5A 3DBLB 3H9JA 3VKUA 3SXPA 1YGYA 7MDHA 1EE2A 5G4KA 3L4SO 5JC8A 1E1LA 4R9RA 3OJOA 3LZ6A 2LDBA 3DZGA 1NAHA 3GGOA 1JA9A 2BI8A 3OFSA 1KVSA 1HDOA 1P74A 2R2GA 2P9EA 3C1OA 1EBUA 1EEHA 5HWSA 1P44A 3D1LA 4BQPA 4H7PA 3H65A 2I9PA 2GZ3A 1ADCA 3HDHA 2Q46A 4WE3A 1DC6A 2HKIA 3HSKA 3FD8A 1AGNA 4YT4A 1NWHA 2ZJ1A 4XWYA 4CLRB 2I5PO 1WZIA 3FNHA 4DC0A 3AU8A 4FW8A 3Q0EA 3ZHYA 3BHMA 1ZEJA 4BMVA 3D3EA 1NR7A 2BI7A 2QHXA 3GNSA 1DIHA 3F4LA 1E3EA 1GCOA 2X9VA 2HK8A 3K92A 4XIYA 3GVIA 2WMDA 1X14A 3AOGA 3GR6A 3GEDA 1T1SA 1PR9A 2DFDA 1GPDG 4J1QA 4D41A 2AXQA 4CLRA 1MFPA 2X0IA 4ALJA 5JW6A 4EDFA 3AK4A 3KYDA 1DLIA 3BA1A 5G0WA 3ZGYA 4DVJA 2OL4A 3LT4A 2C29D 4I9HA 4PZCA 4Y67A 4CR7A 1V8BA 1CQJA 4FB5A 1HDYA 2CVQA 4ALLA 4YWJA 5FYDA 4EBFA 4FJ0A 2I67A 2WTBA 2AQHA 1H6CA 1MG0A 4GWGA 1U8XX 3T4XA 3WGTA 1P3DA 4GX1A 5A9SB 5TQVA 3NEPX 3AI1A 3W1VA 3RUDA 4E0BA 4R5MA 3AFMA 3F5SA 4QTZA 2CDCA 3PQDA 1LSSA 3M2TA 1Y8QB 2R6JA 1GYRA 1Q0QA 3KXDA 1GU7A 4E5MA 3E82A 4AJLA 3TZHA 2IZ1A 3ZWYA 1HKUA 5I7SA 5TX7A 5A3VA 2W90A 4MVJD 4FFPA 4PG8A 3C85A 3RKRA 1GV1A 4BGEA 4AJHA 4FGSA 3HDQA 1T1RA 1YDWA 1X15A 2W2LA 1H5QA 3IC5A 1PL8A 1PJSA 4WJZA 3WGQA 4BIIA 1E6EA 3CUKA 2VRCA 3I3OA 1QP8A 2OZPA 1HLPA 2JFGA 3BMOA 1V6AA 1DB3A 1PTJA 4BO6A 3GDOA 3NT4A 3O4RA 2O7SA 2P9GA 4Y98A 3NX4A 5KJFA 1J0XO 2VYVA 4K6CA 1FXSA 3VC7A 1KVTA 4KDFA 2PGJA 4A0SA 3WFIA 3ZWVA 1EK5A 3JD3A 4KWIA 4YJFA 3C1AA 3WX0A 1YONA 4XA8A 4E30A 4D0SA 1GZ3A 1ZK1A 5G0VA 1QKIA 1ENOA 2O2YA 1XDWA 3FR7A 3OBBA 1EVYA 4JJFA 1E6UA 4RGBA 2IODA 4E2WA 2FZWA 4FJ1A 1YQGA 1U8FO 1C1XA 3ZNOA 3ZWBA 3ABIA 5A03A 1MFZA 3NDIA 3EZYA 4N54A 1B8PA 3CIFA 3GH3A 2I99A 4JBHA 4Z0TA 1A7KA 1K6IA 2Y66A 1C0IA 2VUUA 3EAGA 4E13A 3ICCA 4XCVA 2X22A 4RVDA 1JLLA 1LNQA 3Q2KA 4IGFA 4NQZA 2C2YA 2EERA 1GYPA 5THKA 1H2HA 4GL4A 4CQLA 3VPXA 4E2ZA 1XR3A 1ZBQA 2AQKA 5JLAA 3D5QA 3KUXA 2PD6A 3LSYA 3D5TA 5KCZA 3OQ6A 4FIZA 3NT2A 1UR5A 1F8FA 4U0KA 1JAXA 4IZHA 1EDOA 1Y6JA 3R3SA 3D0OA 1N1EA 3EVTA 2UUOA 4XQ9A 1T26A 2GGSA 1VKNA 2PH3A 3DC2A 1C0PA 3FBTA 4MINA 4PN3A 1HWYA 4UVHA 3UGKA 3FNFA 3MOIA 2AEMA 3GHHA 5JSFA 4H3VA 1GQYA 1BRMA 1YJ8A 5IDYA 4DQXA 3KOUA 4D7AA 4XYMA 2FZEA 4NU5A 2E82A 2AG8A 1KVQA 3WGGA 2Q45A 4DXHA 3PJEA 4YQYA 4H16A 2FHSA 5JMPA 4DPKA 2P91A 3G1TA 5DZSA 3ZWOA 5DP1A 3RASA 3L0DA 4UREA 5A9RA 4Y6RA 1LLUA 2GLXA 2ZYGA 5DBFA 1H6BA 2HUNA 2HMVA 1N1GA 1B3BA 2RBEA 1SZJG 4U8GA 4U7WA 5M6DA 4E33A 1K3TA 1Z6ZA 5MDHA 2AW5A 5HM8A 2OOSA 1YBVA 2DU8A 1NTOA 4LVCA 1PJCA 3JCZA 5EINA 4C7KA 3F4BA 1H6AA 3DDNA 2E49A 1EVIA 1ENYA 5EMHA 1EQUA 3N74A 3ADPA 2WYUA 4RDIA 4ZRMA 2DT5A 5T57A 4OQYA 4B4UA 2C2XA 1L7EA 3C24A 4DREA 4C7JA 1PR3A 1NVGA 3D4PA 3PRJA 4TVBA 4F46A 4P4LA 4ZQGA 3KM0A 4DMMA 4N5MA 3WDSA 1EZ4A 3L77A 4BVAA 1IOLA 5CDTA 1NFRA 3IQDB 1P1KA 2JL1A 1O95A 3GZ4A 4B3JA 1I36A 2DTEA 1YJQA 3DTTA 4L4XA 1YB5A 2Y99A 3I9LA 3L07A 3L9WA 3VPHA 2Z95A 1RM0A 2EWMA 2J3HA 4IJWA 1MLDA 3F1KA 1MV8A 4RPJA 1UAYA 2HJRA 1XGKA 3HDJA 4PZDA 4URFA 1QXSA 4JIGA 3WXBA 2DBQA 1ONPA 3UF0A 1QLJA 2QRJA 1ZW1A 5A9SA 3EC7A 4ILKA 1PU2A 3BHIA 5JAZA 2I3AA 5K6AC 3R6DA 2XXBA 5JDCC 1R4MB 2ZATA 1I0ZA 4ZHSA 1WP4A 3NYWA 4IS2A 3DBRB 2B4TO 1RWBA 3C7AA 3QWAA 4XYEA 3RUHA 4Z0HO 3QVTA 5AXBA 4WECA 1NPTO 2VYNA 1I5RA 4YAKA 1GYQA 1FK8A 1RJWA 5C5IA 2EHDA 2YHIB 3W4KA 3VDQA 1YOVB 5JS6A 1ML3A 1DC5A 4B8WA 1LTHR 1TB4A 4IDBA 1ADFA 1R37A 1YDEA 1T2EA 3IDSA 3OF2A 3JQDA 5FI5A 3ROKA 4BO5A 4BNWA 3BIOA 1PJTA 1WDLA 2Q2QA 3CZRA 1YQXA 3EHEA 4IPTA 3DO5A 1PJ2A 4UVIA 3Q9NA 1C0KA 1PJQA 4NBWA 2G82A 4LRSB 4X54A 2RAFA 3I9JA 2EF1A 3STHA 4ZN6A 4ZICA 1JN0A 3I6QA 1KEVA 1PS0A 4ND3A 1Z45A 5JMWA 4WUVA 3A1NA 3WGIA 1ZZEA 1NVTA 5CAEA 1DPGA 5L45A 3HG7A 5IZCC 3IJPA 1LDMA 1ZXLA 2IRWA 1Y7TA 4PG5A 2X9NA 1E1KA 3RAJA 3VPGA 2D2IA 4KWHA 5A04A 3KYBA 3VH2A 1B15A 4B7UA 2ZTUA 3PWZA 1QV6A 1KEWA 1T24A 1CETA 4JP3A 1Q7CA 2NV6A 1YL5A 4P38A 4JBGA 2JCVA 1D1TA 1LI4A 2IDZA 2HRZA 1DRVA 1VPDA 4D3DA 5FFFA 2YY7A 1PZEA 3GVCA 1S7CA 3HB5X 4E5KA 2PKQO 2IE0A 2C20A 2FWMX 4QT0A 3WOHA 4ND1A 4BNMA 3G49A 4PVCA 1TA4A 5H83A 1L1FA 2HK9A 3ETDA 1X1TA 3SX2A 3WGHA 1B26A 3AU9A 4FOOA 1ISGA 1QRRA 2Y05A 3PZBA 4WASA 3VZPA 3R0IA 3IIEA 4FSHA 2C07A 3QWFA 3ZNNA 3AI2A 4TROA 1F8GA 1Q2XA 2RIRA 5L7YA 5JAIA 1DXYA 3NTQA 1LQTA 3F9IA 3JQCA 2R00C 4CLXA 3ZV4A 1WNTA 3IP1A 5T67A 4ALNA 3HHPA 3WGZA 2XXJA 3MOGA 4MJLA 3FNGA 4U0JA 4D79A 1YOVA 4HX5A 4CJXA 2H6EA 1RM5A 3GK3A 5I7EA 1QV7A 3AUSA 4EJMA 1QG6A 3TWOA 1M75A 2ZCUA 5G4KB 3VVBA 1E5QA 1TT7A 1Y8RA 4NG5A 4YR9A 2CDAA 3CPSA 1IE3A 1HDGO 1FDSA 2UV8A 4CMIA 4TRNA 4H15A 3ZU3A 1MX3A 4WLEA 4KUGA 3DBVO 5L7WA 3GEGA 3C1TA 5T64A 4IJVA 2PFGA 5KTKA 1LDEA 1D1SA 3I9NA 3MCVA 1VE9A 3BMCB 1X7GA 4UVEA 3PVZA 2OUIA 3PFWO 3ROMA 2G5CA 4CQMB 1U2DA 4IINA 4RDHA 3KBOA 1T2CA 2ZYDA 2VUSA 1U3TA 3FWNA 3OSUA 1C14A 4JJGA 3K9QO 4OJNA 3VTZA 4BMSA 1E3LA 4FR5A 3ZHXA 3F47A 4I08A 4R1NA 1NFQA 2UYYA 3RFTA 3ZDFA 2EP7A 3CEAA 1F0YA 4U6SA 4EI2A 4NFSA 1T4BA 3GRPA 1JVSA 4L9RA 1K89A 4XJTA 3ZHBA 1I3NA 1UDBA 3ONEA 4J4TA 5JCJA 4FGWA 2POQX 2PH5A 4PLHA 4RPHA 3OHSX 1XSEA 2VRBA 2VN8A 4ZVVA 5ENDA 4TWRA 3VPSA 1LLCA 2X5JO 1O9BA 3C8MA 1N9GA 3LDHA 3JYNA 5DCUA 4NBRA 3K30A 1RM4A 3M2PA 1DIAA 2ZKLA 4BKUA 2A9FA 4CR6A 2LDXA 2ZTMA 3ENKA 3JQBC 4IDFA 4OM8A 4QFDA 5KIAA 2NVBA 4Z3DA 4JN6B 4Q3EA 2BFPA 4MVJH 4DLBA 5BSEA 3GEMA 3QQPA 3JYLA 1E1NA 5GMOA 1U7HA 4OKIA 2D8AA 2GN6A 2YV1A 4NR0A 4R51A 4B79A 3D3WB 4OIMA 4YJGA 3RIHA 1JAYA 4AJNA 1PS8A 3PZRA 3IMFA 5JXWA 3WGYA 2H1SA 2PKRA 3E5MA 2ZB3A 3I9MA 3KZVA 3M1AA 3LF2A 5BR7A 3B1JA 1P31A 5I7FA 4GAEA 4XX0A 2B83A 1AN9A 2HMWA 1SEPA 2PZMA 5EL0A 4J0EA 3QRWA 4RLSA 5JBIA 1OAAA 3E1KA 3NJ4A 3INTA 4IJUA 5J9GA 5I9MA 1OOEA 1NWCA 2WJPA 4CR8A 1LUAA 3ICPA 4YJHB 2JHFA 2AE1A 3PHIA 4RVSA 4QO8A 3ROQA 1DFIA 5KJ6A 4ZRNA 1A9ZA 4RVHA 5ER9A 5JC1A 5I8ZA 1DIBA 2D0IA 2JD1A 1PGPA 3VPFA 1F12A 1V0JA 3NTOA 2V6FA 2P2SA 1WWKA 1L7DA 3IJRA 5CDGA 4O0LA 1BGVA 1YL7A 1U5CA 2YDXA 3RUCA 2Y1OA 4J9VA 1WMAA 1TEHA 1GAEO 3RC2A 1VL6A 4LSMA 2NLOA 4MKZA 1U4SA 4PIVA 1IUKA 2JJYA 3GGPA 1ISIA 3AOEC 2RH8A 3RD5A 4O5OA 5CDSA 1Y8QA 4UEOA 2YQ4A 2BGKA 4HKTA 2EW8A 2PK3A 3OQ1A 1LEHA 4J7UA 3W6UA 5A4DA 2GD1O 1HL3A 3KETA 3A14A 5HBRA 2X0RA 2BLLA 3ON5A 4CMBA 2EGGA 2FY8A 5BT9A 1HEUA 1DLJA 4CM4B 2Q2WA 3TZCA 1MG5A 2J3JA 4Y6SA 2V7PA 1NQOA 4KDEA 4LGVA 4TRMA 1K6JA 1O94A 4M86A 3T4EA 1I10A 2D3TA 1VI2A 3TDKA 3U49A 3DMTC 2V6GA 1VC2A 2E37A 3N58A 2CF6A 1M6HA 5TGDA 1GL3A 3DZKA 2VNAA 1SO8A 2G76A 3GQVA 1E3SA 1OI7A 3WNQA 1DFHA 5A3JA 4LVUA 1YH3A 2VHZA 1UXGA 3PP8A 5I9LA 1PL7A 2VT3A 3TL2A 3IKTA 5A02A 3Q11A 3V1YA 2Y0DA 1DRUA 4P4NA 1Z82A 5KJEA 3GFGA 1J4AA 1ID1A 1GEGA 2DPGA 2CFCA 3RVDA 3DWFA 4RO0A 2JFHA 2WEKA 4CMEC 2IXBA 4E2XA 5G2OA 4PVDA 4GX5A 1B0AA 2IYPA 1V35A 4FBGA 4EUEA 1SBYA 3DEYX 4RV9A 4CQMA 1IPEA 3GMSA 1P0CA 2Q1TA 4NFYA 1C1DB 3WYEA 3QSGA 1MUUA 4J7CA 5B4TA 3HN7A 3WG9A 5DNAA 4WGGA 2FMUA 2QRLA 2X6TA 3UW3A 4WEQA 4YBZA 1ZK4A 1VSVA 3D4OA 4BKOA 1NYTA 4J0FA 3S8MA 3H5AA 5IDXA 2BFAA 3QA9A 4FD3A 1DSSG 5ILGA 1E0DA 4YJDA 1OMOA 2VZ9A 4NJOA 1ZSVA 2B36A 3MJTA 4W9NC 1W73A 2ZTVA 4FPXA 3JQEA 4AJPA 4S1VA 1YE3A 4RQTA 5IFLA 1R0SA 2B0JA 1W4ZA 4N18A 3RJ5A 1MGOA 4PLPA 5HTOA 1ZIDA 2RHCA 1YB4A 3UCXA 3V8BA 1HT0A 2CUKA 1JWAB 3K2BA 1CQIA 2W2KB 3WTBA 4LMRA 4WCDA 3DB2A 4QECA 1AHHA 3PLRA 3UCEA 2VOJA 4AG3A 4DBZA 1R6DA 2VUTA 4UUNA 2J6IA 3GDGA 3TZ6A 1E7YA 4CLOB 2EKQA 4BO1A 4PFJA 2VZ8A 4A27A 4CODB 1KY4A 1VL8A 5CDYA 5U9CA 1A9YA 3AM4A 4UEJA 4O6VA 3KHUA 3HFGA 1I32A 2P5YA 1P9LA 3DOJA 1JW9B 1NHGA 4B4VA 5L7TA 2BGLA 3OIGA 2ZK7A 3PJGA 3MJCA 4DLLA 2D5CA 4WLNA 4PLVA 4CV1A 4I8XA 4IDDA 5ITWA 4CLEA 1JTVA 4QO7A 5JFOA 3GN2A 3BMNB 5GZ6A 2DBRA 4Q3DA 3GF4A 4PLFA 3P7MA 2ZCVA 4E5YA 3H2SA 3JQAD 2XF8A 1HYHA 3D64A 4YXFA 4GPD1 4JQCA 4R1UA 3IS3A 4PLWA 3RROA 2DFVA 3Q1LA 2NUAA 2YUTA 1PZHA 3WR5A 1IYZA 1A7AA 1HZZA 4BQRA 5JO9A 1XQ6A 5T73A 1UAGA 2IZZA 4IS3A 2EW2A 3ZZNA 1O5IA 3HADA 2WE7A 4EEZA 3DBLA 1EBFA 4YAIA 2FOIA 3JYOA 5KJ1A 1GQQA 5CDUA 2NU9A 2P9CA 4DIBA 1QLHA 1EVJA 1GZ4A 2WD8A 3WIEA 1WDMA 1PWXA 1ORRA 4JXKA 1Z7EA 2PNFA 2B5VA 4IXTA 3ASUA 2X86A 4ALIA 5ITVA 4DGSA 3HE3A 3FCOA 1FMCA 2GDZA 2ZB4A 5L95A 3LK7A 4K28A 1PIWA 4LMPA 1O89A 4CLHA 4JP2A 1ADBA 1KETA 1R12A 4M8SA 5F5NA 3DZBA 2C5AA 1SEVA 4XDYA 5JNLA 1QMGA 3KYCB 3V5NA 1M67A 3GFBA 3GVHA 4HXYA 1BXGB 2W8ZA 2Q2VA 2C7GA 3NGXA 4XB2A 4BNKA 3WIDA 5T8KC 5JDIA 2SCUA 3EMKA 1P1JA 4MP6A 1CJCA 2P4HX 4WCFC 3WWYA 4CMGA 2YW9A 2GRAA 2VQ3A 4PG4A 3I6IA 1ISFA 3RUAA 3FNEA 2WSBA 3LC1O 3RUFA 1P1IA 1BG6A 2ZTLA 4MIYA 3WWZA 1XU9A 1ZMOA 3Q6IA 4FCCA 4R9SA 3ZCXA 1R4NA 1HXHA 2O3UA 4YAJA 3FR8A 1RYEA 4ND2A 3NUGA 1VRWA 4P22A 2Z5LA 3VVCA 2H5LA 5KVCA 2Q1SA 5ADHA 3EW7A 1M2WA 5KNLA 3TOXA 4I5FA 1BSVA 1E7QA 2R00A 3WQSB 5TS3A 4EW6A 5U4QA 4FS3A 4D43A 4BNIA 3AM3A 4BNLA 1YQDA 4EUFA 1UDAA 2DPHA 2OBNA 3G1UA 3T7EA 4AVYA 3G3EA 5DULA 3CH6A 1ENPA 3V1UA 4RPLA 4XGNA 1TT5A 3OJLA 2CSUA 3OQBA 3FPLA 5L4NA 3JQGB 4WK6A 3WSVA 4ONEA 1ZJZA 3ZV3A 5F1KA 4BNVA 1I33A 4WLUA 2OHXA 3INGA 3I4CA 2UUPA 2RHRA 4R1SA 1VKOA 3FWZA 4UAGA 2YYYA 3S1LA 3UN1A 4CM6A 2D59A 5K9ZA 2DAPA 2YJZA 4RF4A 5KVVA 3JQAB 4BV9A 2IEBA 4NBVA 1I8TA 2B37A 3MZ0A 3BTOA 5G0SA 2HDHA 4RZHA 3OM9A 4PZEA 5COQA 4BO9A 4DPMA 4PCVA 1D8AA 2C7VA 1LDBA 1FF9A 3P5SA 4IUYA 1I2CA 4HNHA 5I7VA 3MTJA 4BL5A 5FI3A 3UXYA 4YJFB 4LN1A 4OXYA 2WDZA 1WZEA 2J8ZA 4XZ3A 1IY8A 5B1YA 2NQ8A 5DCWA 3OMLA 4OMUA 3WSWA 3CKYA 3JQ9A 1LSUA 1XG5A 2G1UA 2B69A 2VWPA 4OAQA 3I4FA 4M89A 1SAYA 2I65A 2AHRA 4QQRA 2PKQP 3RC9A 5I8WA 5IXYA 2NNLD 4KUEA 3U09A 5IG2A 3D4NA 2Y1EA 3I9KA 1VJ0A 2F00A 1XYGA 5B12A 1X1EA 3H9UA 2Q1WA 1LDGA 4ZA2A 1DC4A 5EERA 1DJNA 4HNGA 1A4UA 3ZNPA 4YT8A 1S6YA 4FQ8A 3DBRA 1IHXA 3WGOA 2F1KA 4CV2A 4CMKA 5FWNA 3B1FA 2UAGA 1XIVA 1GCUA 4NHEA 3JQBA 2NVUB 4CM8B 1PWZA 4F6CA 1OBFO 3MTGA 1E3WA 4BKPA 1DO8A 4O1MA 5HS4A 1BXKA 2O3QA 2AMFA 4HFMA 2YV2A 3N7UA 5CG2A 2B35A 4A10A 1FDVA 1HE2A 4IIVA 1UUFA 3UFXA 5LDGA 3UVEA 2EKPA 2VHVA 4W6ZA 4WKGA 4QXMA 3WFJA 5FEUA 1HDXA 3CZMA 3LYLA 2GZ1A 3WB9A 1BXZA 4CLDA 2RCYA 1I30A 2XPCA 5DCYA 3EDMA 8LDHA 4KQWA 1TLTA 4J2OA 4KZPA 5HA5A 4L73A 3GVPA 2BD0A 4YYZA 1B2LA 5HRUA 4CM4A 3EGOA 4JROA 1NXQA 1KYQA 1E7MA 2W4QA 3SJ7A 1BHSA 5FF9A 4CM1A 5CEJA 1WVGA 3OJ0A 3V2GA 3OA2A 3ZH2A 3S2FA 3FSRA 5AXAA 4D46A 3GG9A 4PGFA 4CM7A 1ZXBA 4RJTA 3JD2A 1PZGA 5KKAA 3CMMA 2WM3A 1YBAA 1PEDA 2B4QA 3DOOA 3ANLA 1ONNA 1RKXA 3NV9A 2DTXA 5JAQA 5C37A 1PX0A 1ZUD1 1A71A 2WE8A 4XQGA 1KC3A 4AJIA 4ALKA 5BQFA 4ZQBA 4RVFA 1X7DA 2IEDA 1LLQA 1YRLA 4R3WA 1I24A 2HO5A 2VYND 9LDTA 4I5GA 1O6ZA 1WXDA 5COBA 2VYVD 1E7SA 4ALMA 1ZCJA 3NAQA 4D44A 1B8UA 2VOEA 2BGMA 3ZWXA 4XGIA 1LRJA 3AFNA 2NTVA 1I3KA 4BNXA 1SMKA 3RBZA 3TNLA 2HMSA 3RUEA 1LXCA 4Z9YA 4MKRA 4C4OA 3PQEA 3PWKA 1KEPA 4B7XA 5IDWA 2I6TA 3QIVA 4HADA 4CL3A 3VZRA 4RL6A 3R1IA 1ZSNA 1GY8A 1MP0A 4XJSA 5T5QA 4KTTE 3W8FA 1T2AA 4BNGA 2DLDA 2VCYA 4RF2A 1LSOA 3RSHA 4YDRA 4CMAA 4A03A 4RPKA 5KVSA 4TKMA 2CF5A 2JFFA 4W7HA 1HDRA 3UUWA 1BW9A 3SEFA 1YS4A 2OFPA 4NIMA 1XU7A 2FPIA 2OMEA 4D0RA 1E5LA 3AY7A 5CPFA 1R4MA 5CG1A 4MIEA 5JCXA 4LISA 5TF4A 3GDFA 1HRDA 3PDJA 1B14A 2JKVA 3JQ8B 5EN4A 3VZQA 5JY6A 4BHTA 3AOEA 1DBVO 2FN7A 5G0TA 1CF2O 3EY4A 2HJSA 3UAGA 3B70A 2AG5A 3GNQA 3BXXA 4IDGA 4OXNA 4A2CA 4UULA 5ICMA 1UP7A 5BSHA 1CERA 3JYPA 4FC7A 5EPOA 3K96A 1LC3A 3NDJA 3HN2A 3BMQB 3TQHA 3NGLA 3DR3A 2Y1GA 3H5RA 2PTGA 1IL0A 1SNYA 2O50A 3WMWA 2Q1UA 2QW8A 5DF1A 1LC0A 2QZZA 1U28A 2BKAA 3K6JA 1PJ3A 2AQIA 3BYZA 5L40A 1I3MA 2WD7B 1SPXA 3DZIA 4R01A 3GOHA 3EUWA 2HSDA 3A28A 4AJ2A 3IUSA 3JQ7A 5B4VA 1E6WA 1PGQA 2BRUA 1UH5A 5KOIA 3E9QA 4IDAA 1U1IA 4FOSA 3PEFA 5G4LA 3RI3A 2GO1A 2GASA 4NK5A 2VZ0A 4OKNA 3QVWA 1ARZA 1GZ6A 2OP1A 3OA0A 1IULA 3K2EA 3ZW9A 4Q3CA 2C0CA 2GN8A 4I5EA 3S2EA 4MDHA 3KEQA 1P1FA 5TLSA 2DBVO 3L6OO 4DTIA 4CLOA 3JD1A 1U2GA 4Y6PA 4XD2A 3NT5A 3KV3O 3RU9A 4J4BA 1MC4A 1PQUA 1PJBA 4E6PA 3QP9A 3RBXA 3AUTA 4XRRA 3U5TA 5JPIA 1HZJA 5C7IO 3ZWNA 3UHAA 4BGUA 1K0UA 5KJCA 2J5RA 4QX6A 4PRKA 2IXAA 1U5AA 1Q0HA 4BNHA 1UZMA 1DFGA 1AHIA 4W9NA 1DAPA 3BTUA 5DT9A 5TJ9A 5C7OO 4E5NA 4YTEA 1N5DA 1U9JA 1VLLA 2NSDA 3F3SA 4EUHA 3I83A 3WJAA 4WNCA 4XQEA 1ULSA 3GZNA 3ZWCA 4I5DA 3RUIA 4DBVO 4R68A 3U0BA 3O8QA 3BMNA 2XAAA 2GF2A 3KYDB 3QJ5A 3VAZA 3AW9A 5B37A 1OC2A 3O03A 4XR9A 2VTEA 3ITKA 3F1LA 3P19A 4IDCA 4MVJE 5LC1A 3EVNA 1FDTA 4IJKA 5JAMA 3F5QA 4BO8A 1Z74A 2BF7A 1KBZA 5IZ4A 3TF5A 2NADA 3NTRA 1DIGA 1LRLA 4TKLA 4ZQEA 1YXMA 3FHLA 1P1RA 4BNYA 3PIIA 4J49A 2Y93A 1YL6A 4KP7A 1DOHA 1WDKA 3DL2A 1SC6A 2YQ5A 3IAHA 4BNNA 1CIVA 3I1JA 4RVGA 1QORA 4BNUA 1AE1A 2GSDA 2JD2A 3O26A 3CINA 3X2EA 6ADHA 1FJHA 5L53A 4BB5A 5LCXA 4WLOA 3BTVA 4CQMD 4CMJA 3PHGA 2Z1MA 4A73A 2FSVA 1VJ1A 3QV1A 4MIOA 3JTMA 4Q9NA 3BMQA 4EJ6A 4OH1A 4WCFA 3ADOA 4EITA 3T7CA 4JBIA 3L6DA 2OO5A 5H82A 4IQ0A 3L6EA 4DLAA 1J5PA 3DFUA 4J91A 4DIFA 1EFKA 3HWRA 3RWBA 1GPJA 2YFHA 4FFMA 3ZNQA 1CDOA 4HUJA 3EYWA 1HSOA 1B8VA 4KMSA 1ZNQO 2P68A 2PLAA 5MGBA 4D3FA 1DEHA 3V1TC 1Q7BA 4W82A 4DIOA 1N8KA 5A5EA 2A94A 4OL9A 5L9AA 1ZK2A 1EE9A 2A92A 4N5NA 2FR1A 1JKFA 4GVLA 3FTNA 3KTDA 1MXFA 3GA0A 5TT1A 3ROPA 5CHEA 4P4GA 3CXRA 3LF1A 3OH8A 2GERA 3OETA 4DA9A 3E03A 1F06A 2DTDA 2QRKA 3AM5A 4CMIB 1E77A 4XIJA 2Q4BA 1NQ5A 1BWSA 2IYOA 3I5MA 2O3RA 3H8VA 4E4YA 4XYGA 1XEAA 4EEXA 1DJQA 3QWBA 3ZN2A 4NMHA 3QHAA 1GUZA 1H6DA 1MC5A 4IM7A 4R4JA 1V3VA 1X0VA 4CUZA 2J5KA 2HU2A 4Q3BA 3PDUA 1W6UA 4GKBA 3RCBA 3M6IA 5DBIA 4WLVA 3ZV6A 5ILOA 1JDJA 1ZJYA 1M6WA 1LX6A 4EYEA 1NNUA 4TQGA 4WPGA 3ETEA 4BO2A 1YVEI 5F3RA 5AYVA 2NWQA 3LT1A 3MEQA 3WLEA 4ITUA 4BO4A 3VHRA 4A7PA 4CUKA 4NH4A 1ENZA 4XYLA 4GSLA 4DC1A 3MJVA 1I01A 4PLCA 3DHNA 2IZ0A 1J49A 1ISHA 2G17A 3AJRA 4AJEA 4CM9A 1W8DA 4D45A 1E92A 1LLDA 1UXKA 1HYGA 3S2IA 5A5FA 5CEFA 5TIIA 2BMAA 3LQFA 4HFNA 1ISMA 3DZFA 5AXCA 4DYVA 1PGNA 4J2HA 5CFZA 2NM0A 3WS7A 1NQAO 5JYFA 2ZYAA 1YWGO 2ET6A 1V3UA 5B4UA 1H93A 3S55A 3WYCA 4PG7A 2CVOA 2X4GA 3DZHA 4DQUA 4ROSA 4DMLA 4DWVA 2NU8A 2X0JA 4NK4A 1H94A 2Z1NA 2CVZA 4MP3A 5JYEA 1E3IA 3ZU2A 4AICA 1P45A 3PQFA 4FJ2A 5K0ZA 2EG9A 1X7HA 2FP4A 1EDZA 2JD0A 4JK3A 3WQRA 3GHYA 2J3IA 4G2NA 3L9XA 5U1PA 3SC4A 2Y68A 2GN4A 1U3VA 3OEWA 4OHUA 4RLHA 2I76A 5EQFA 2OP0A 1ZFNA 3JQ9C 4XDZA 4YAGA 1SB8A 4NZ9A 1R16A 3QLJA 1KOLA 3U9LA 3DZJA 4U5QA 3G79A 3PGXA 1ZVMA 1PSDA 1KS9A 3MWDB 1ZK0A 1LDYA 2DC1A 1P77A 4D3SA 1H2BA 1M76A 3DXFA 1XLTA 2EJVA 2GZ2A 1Z73A 3E5RA 2PD3A 2VHYA 3U4IA 1AXGA 3LT2A 1R15A 3KRTA 1SB9A 1H9AA 1JWBB 1Y9EA 1WLYA 3JQ7B 4DL9A 4EGFA 1Q0LA 3KYCA 4TRRA 2E6UX 3GNTA 2FSSA 3PK0A 2V6MA 1CRWG 2AE2A 3WLFA 1UZLA 3ONFA 4B8ZA 1G0NA 3ETGA 1CWUA 3E6AA 4CV3A 4R5HA 1MXHA 1P1HA 2W98A 3ZWMA 3GPDG 2O3JA 4F6LA 2FRDA 3C7CB 3RQSA 1QR6A 1LA2A 3DHYA 3K5PA 4B4WA 4RF5A 4GI2A 3O9ZA 3HUDA 1RYDA 4YA6A 2C59A 5L4LA 1C1XB 4R16A 4IDEA 4O63O 4YAEA 5IJZA 2X5OA 3DBHB 2WD7A 4BUCA 2V65A 3DAFA 4WOKA 1GD1O 3NDRA 1ZMTA 2EKLA 3IP3A 2BFOA 4G65A 3UICA 1UXJA 1R66A 4IIUA 2ZJ0A 4ZU3A 2ZQZA 4TRJA 5K6AA 4L74A 5LDHA 5JDCA 3SVTA 4YEDA 4CQLB 3ENNA 2FPPA 4K9DA 2PV7A 2QIOA 3CSDA 5AQ1A 5EIOA 4RF3A 4L75A 3B6ZA 2ZB8A 4Q3AA 3E48A 1A5ZA 3TFOA 3LT0A 4ZJUA 3KSUA 1C0LA 3W4JA 4UUMA 1I2BA 2WYWA 4L8VA 1QSGA 3H3JA 5IDQA 4ESOA 5DP2A 4PLTA 1GR0A 3TL3A 3H9GA 2UDPA 1A27A 1AUPA 1H9BA 1B16A 4NBTA 2GR9A 1GADO 3DONA 3RC1A 3K31A 3RFVA 3I9OA 3G17A 1UP6A 5IN4A 2NACA 3GPIA 4KUHA 2VWHA 5JCJD 1XQ1A 2NU6A 1GUYA 4L4RA 1B7GO 2GNAA 3TFQA 4I9NA 3U62A 4IZIA 2WWRA 3O8QB 4Z3KA 2NU7A 2AEFA 3HDYA 2CD9A 3JQ6A 3QWHA 4J7XA 5EQDA 3HQ4O 2E48A 1EFLA 4RCVA 3SC6A 3INRA 2I66A 3JQGA 3NRCA 4GH5A 2EIHA 3E9NA 4L0QA 5IZCA 1NP3A 1KVRA 4NFHA 4J9UE 5L4SA 1JQBA 4Z9XA 4NU6A 1LSJA 4JX8A 1W0CA 5F1PA 5JO0A 3TSCA 3H9EO 3UCFA 3MWEB 1BTOA 5C7LO 5ENVA 2B5WA 4HY3A 2EJWA 1Z7BA 1V3TA 3PPIA 4J16A 3TZQA 3QW2A 3DHEA 3O38A 5DOVA 1NVMB 3M1LA 3TRIA 1DHRA 2OORA 3LC7O 4Z0PA 1KVUA 5KVQA 5F5LA 4R3NA 2OGUA 5DN9A 4GBJA 1Y8RB 3QWIA 1R4NB 4B3HA 3ONDA 3I52A 2PWZA 4E2YA 3GAZA 4ID9A 4BB6A 4MP8A 1U3UA 2PZLA 1RPNA 1WPQA 4WOJA 4FFRA 4J1SA 4W4TA 3RJ9A 4J1TA 1SOWA 2NTJA 1LBEA 3W6ZA 5JY1A 3WTCA 3TPCA 1ADGA 3ANMA 1IZ9A 5AOVA 4JGBA 2DKNA 5DDIP 3U3XA 5TRTA 1LQUA 4MVJF 3BAZA 5F21A 4RQUA 1NAIA 4XKJA 1LRKA 1DAOA 1ZKMA 5ES3A 3BMOB 1HDCA 4U6QA 4BNZA 3RFXA 1E7RA 3W4IA 5CEEA 4NPCA 3FPCA 1XKQA 3U4DA 5GZ3A 2HAEA 4K6FA 1TXGA 5A9TA 1TI7A 4PRLA 1ZO8A 3ST7A 3OIFA 4GKVA 3DTYA 3MJSA 4TZKA 5H81A 3ZWPA 4E3ZA 1JU9A 1XHLA 3Q9UA 4CL8A 5A05A 4G81A 4UUPA 5BSGA 3ZWAA 4HFJA 1HSZA 4BGVA 4WLFA 5JYDA 2Y1FA 3QVOA 1ZH8A 2O7QA 1VSUA 4BO3A 2HMUA 1HF3A 4XEHA 5TT0A 2OBYA 5TNXA 4YRDA 3VOSA 3JQAA 4YVFA 2HQ1A 3KLMX 1NX6A 4AJ4A 4F3YA 3DAGA 4INAA 1KC1A 3QVXA 4UVGA 2VT2A 1YKFA 3IOYA 4E12A 3PHLA 2P4QA 2PY6A 2FPGA 4IXWA 5IN5A 3ZHZA 2I3GA 3WICA 3C7DB 1LU9A 2VHWA 3D3WA 3KLPX 8ADHA 2E4AA 3AUUA 4GMFA 3CE6A 4YPOA 4TMFA 3RC7A 3E18A 1UZNA 1X0XA 4KOAA 3F46A 3W8DA 2JAHA 1I2ZA 4GX0A 1BDBA 1R0KA 2X0NA 3TZKA 4CM5A 3AUAA 4ZQHA 1XELA 4LCJA 4F45A 5C3MA 4FN4A 4CM9D 4IQ8A 3OEYA 3H7AA 3VZSA 4PG6A 1PJLA 2A35A 2PZKA 2GUGA 5IXSA 2VNSA 3WJ7A 3VKVA 4AJ1A 2GPTA 3UH1A 1HE5A 3GRKA 3KVOA 4OO3A 5T6BA 3PHHA 4MVJM 3VH1A 2YV3A 4MVJP 3HZZA 2CDBA 2PA3A 1M66A 4IBOA 4Y8VA 4IMPA 3JQFA 4CMHA 3KB6A 3ITDA 4G5HA 4FFLA 4BNFA 4XGKA 3MJ4A 1Q7GA 2ZQYA 4W99A 4ND5A 4AFNA 3COSA 4PLGA 5KKCA 4II3A 1EUCA 1ZEMA 3PI7A 1Y9AA 3RBVA 1R0LA 2W2LD 4YRAA 2HK7A 1IHYA 4NJMA 2NVWA 3JQ8A 3PLNA 4Q3NA 4NI5A 1KY5A 2C54A 1UJMA 3ZU4A 2H63A 4M87A 1EUZA 4JCOA 1ULUA 5DOZA 1NPDA 4QUKA 1PGJA 2X1HA 4DRYA 1V9LA 3K73O 1F14A 4NJMB 1HYEA 1NFFA 2PR2A 3UKOA 4OOEA 3AI3A 3OICA 3GC6A 2DQ4A 3E8XA 3QVSA 5BNFA 1BDMA 1T2FA 3SJUA 1XA0A 3X2FA 2B4RO 4PLYA 2PZJA 2X9GA 1JKJA 1HE3A 1I3LA 3R3JA 4UUOA 4JNKA 3U4HA 1BXGA 4BNTA 2HMTA 5KWEA 4I9UA 2TMGA 5COAA 1DDOA 5G0UA 4TVOA 3BZUA 5CPBA 4GVXA 4OYRA 4IGEA 3OECA 3JQFC 5I9NA 2CZCA 5THQA 3HNPA 2QYTA 3AWDA 5BSFA 1Y1PA 1T2DA 3OIDA 1DIRA 2NQTA 5AXDA 3B20A 1Q1NA 4YRBA 1D7OA 3DMTA 4BV8A 5TC4A 3BHJA 3ZU5A 5TSDA 4BKQA 1D4FA 1IZ0A 3AY6A 3ZWWA 3A06A 1EVZA 3FN4A 3PFFA 4CV0A 4BO7A 5F1OA 4A26A 4GQAA 2QZ9A 3D7LA 1DHTA 4AL4A 2QQ5A 4BO0A 2DUWA 4CMEA 3ZI0A 1D3AA 1YO6A 2X7HA 2QG4A 1TT5B 2CY0A 4YB8A 3QY9A 2J3KA 4XR4A 1G0OA 3MJEA 4J43A 4BNJA 1BW9B 4JLWA 1PZFA 2PGLA 2X5KO 3DOCA 4GMGA 3SBOA 2Y1CA 5CP8A 1U7TA 2OXIA 1PJ4A 1TVEA 4YCAA 3GUCA 3ORFA 3LVFO 1LJ8A 1P33A 2Q50A 4LSWA 2W2KA 4FC6A 4OQZA 5DBGA 4ZQFA 1XCBA 3GAFA 2EV9A 1GUFA 2UVDA 2VTDA 5GZ1A 1B3RA 4GX2A 1XWFA 2ILTA 1A4IA 4E32A 1WAMA 4MVJI 1GFSA 3KEOA 3KO8A 4IMRA 4II2A 4N7RA 1VL0A 3FTPA 3H4VA 4RPGA 2HRBA 1N7GA 3PWSA 4OSOA 5J23A 5GY7A 1KIFA 3C3XA 5L51A 2YDYA 1QYVA 4NDNE 4GGOA 4M55A 4GSKA 4B4OA 2X8LA 2BELA 4OXKA 1BVUA 4AJKA 3S2GA 4J4HA 1E3JA 1SCUA 1F17A 2DM6A 2VWGA 4O59O 1OC4A 4RORA 4YJGB 1CYDA 1NR1A 1U3WA 2WYVA 4PLZA 3JSAA 5JE8A 4A5OA 3WMXA 3NKLA 1C1DA 1MB4A 3PYXA 3Q3CA 4XQCA 5JYAA 3PJFA 2QX7A 2VWQA 3V2HA 2JAPA 4W7IA 1UDCA 3W8EA 4EJ0A 4KTVE 3GN1A 2DBZA 4BOYA 2H9IA 2FR0A 2VRCD 1HE4A 1SOVA 1GV0A 3GY0A 4GWKA 4YQZA 1X13A 3KSDO 4Z6KA 2DUUA 1DC3A 4MPDA 3TOZA 2YHIA 3WQQA 2O3TA 4P8RA 5EESA 4R41A 1MA0A 3JD4A 5IAAA 1NHWA 7ADHA 1JKIA 3P2OA 2EP5A 4NNJA 1O0SA 3V2UA 3ULKA 1ONOA 2NTNA 1QYXA 3TJRA 2EGHA 2YZ7A 5ICSA 4E21A 2BFMA 3Q2IA 1FDUA 4L76A 2G0TA 2O3SA 3H9QA 1OZAA 4FFOA 3DAPA 1HTBA 3UOGA 4D42A 2RH4A 4DPLA 3CTMA 3DQPA 3OP4A 1CEQA 3RU7A 3B1KA 5L3ZA 2PGDA 2C82A 5BNTA 4MVJG 2YHUA 4MOWA 2P5UA 4J6FA 4DQVA 2Q3EA 2JCYA 1EUDA 2AEJA 2A4KA 1NQTA 3PHJA 3EK2A 2BHLA 3E9MA 1EMDA 1H0KA 1VM6A 1N7HA 3L4BA 4ZD6A 1K6XA 4CUJA 2ZB7A 3H6KA 4GGPA 4CM8A 4QSMA 2FR8A 3FF4A 4S3MA 4WCFB 3PGJA 4M49A 4HWKA 5HS6A 3TN7A 1OFGA 4OSPA 3FRJA 4E5PA 4R69A 1HDZA 4OOFA 1Z75A 2Y0CA 3ZW8A 1NM5A 3SLGA 3WYBA 1GQ2A 3VTFA 3PXXA 3VH4A 3BTSA 1NASA 1VJTA 1T4DA 4EZBA 3JV7A 4XB1A 1N2SA 2CMDA 2HCTA 4YJHA 2Q99A 3I23A 1KERA 1Y5MA 3H5NA 4K26A 4M54A 3A9WA 2O48X 1QYDA 6LDHA 2ZIZA 3F6YA 4UEKA 5T8KA 1UXIA 2D5AA 5JDIC 1EQ2A 3EZLA 1UP4A 4FDAA 2V6BA 1K5HA 1WMBA 2AQ8A 2EXXA 1YB1A 3PTZA 1J6UA 3WBBA 4CM3A 4M1QA 1IB6A 3HB4X 4BKRA 1EK6A 3G0OA 4YT5A 1N92A 3CMCO 2C5EA 3VH3A 4L4SA 3JD0A 5A06A 2X58A 3H2ZA 1G6KA 3A4VA 3L4BC 4Y9DA 1HLDA 1QYCA 4NBUA 4B3IA 2BH9A 3GGGA 1PQWA 3AY3A 1PQPA 3IKVA 2TMDA 9LDBA 3OJEA 4N5LA 3GUYA 4LK3A 3SLKA 3GZNB 4J3FA 4DUPA 2GYYA 3H3FA 3HFSA 2DVMA 4CMCA 3DMYA 4FFNA 2PD4A 3RKUA 2JCXA 2XOXA 3ANNA 1GDHA 1K2WA 4GLOA 2O4UX 4LCEA 4ZGWA 3OJFA 3JYQA 1N9GB 1E7WA 1P0FA 5TJHA 1BMDA 2QYSA 4ND4A 1ZSYA 4BGIA 1DRWA 4QFCA 2J5QA 2EEZA 4Z9FA 1YBMA 4QEDA 1A72A 2VHXA 3ASVA 4XRGA 4LRTB 1Y5RA 4BS9A 5BNIA 3DBHA 4KQXA 4OGWA 4Q39A 2HLPA 4GLLA 4IQGA 4HFRA 4R54A 2D4AA 5ER6A 1BVRA 3FBGA 3GMDA 3NJ8A 2GCGA 4JJIA 1O8CA 3HJAA 3GVXA 5EJ2A 2Y1DA 1UXHA 3QE3A 3GLQA 3LC2O 1U4OA 1PL6A 2Y67A 4BMNA 4AJOA 1ZK3A 4J90A 4MO2A 4I1IA 4MVJA 2O4CA 1Y81A 2Q49A 2Y0EA 3VDRA 1LDNA 2YFQA 4HP8A 4YACA 5AVOA 4CPDA 2O23A 4J1NA 1JVBA 1E3WB 4YT2A 3BMCA 1IPFA 3LLVA 3IUPA 3K8ZA 1RM3A 3PYMA 1AXEA 3WNVA 1G1AA 4RVUA 1HETA 4RZIA 1ISJA 4DYDA 2Q4EA 4LW8A 1QYWA 3PIDA 2GN9A 4K1LA 2X23A 5IF3A 2Q22A 4UVDA 3WBFA 1PS9A 3GG2A 1C3VA 2CNBA 2AA3A 1PGOA 3U4CA 3P2YA 1WW8A 4R1TA 1GTMA 1E1MA 3DFZA 2O2SA 4WEOA 4TZTA 4XYBA 4TSKA 3PJDA 2JHGA 4IY1A 3PYLA 1KEUA 3FI9A 5A1TA 2NVUA 4MKXA 1NBOA
chains in the Genus database with same CATH superfamily
2Q62A 1D2NA 2NP6A 1NP6A 3LL7A 4LC9A 1OFUX 1OJ7A 1FDWA 3O4JA 3QELA 2P30A 3VOTA 5IKPA 1ACJA 5E1MA 1EM8B 4FXOA 3L6BA 3PNOA 4B7CA 2P9JA 3OC6A 5BMOA 1SVUA 2HRQA 2P90A 1Z6YA 3PVCA 2D2FA 4MYCA 1QIJA 4NOJA 9MHTA 2I6QA 3N86A 3VKUA 3O90A 1BYUA 1QC5A 2QB5A 3VQTA 3EEYA 4PX5A 3AFOA 2VF4X 2A0KA 3CLTD 3NRBA 5JC8A 1E2FA 3OJOA 3G0GA 3L2OB 1T0IA 1T9KA 1V5EA 3LZ6A 3OPVA 4GXTA 4KPUB 5LDDC 2WB4A 2LDBA 3SHVA 4JLBA 1T2UA 1VKJA 2QZJA 4AZVA 2Y9PB 2B1IA 5FFMA 1RAAA 2N1MA 1EBUA 2PWYA 1K0FA 1P44A 2BEKA 2GX6A 1UODA 3SF0A 1MPTA 1ADCA 1MABB 3EP9B 2Q46A 1DC6A 1U1GA 3FD8A 3O0DA 1BVHA 1J21A 2FP3A 3V4LA 4QIHA 5FNVA 4MWBA 2AVDA 1J0CA 3BIFA 4RETA 3PQ7A 3OFVA 1R18A 2B6HA 3AU8A 3Q0EA 1ORWA 4JB3A 4BMDA 2WMNB 4AMGA 3E5NA 2CDNA 2Q3FA 4JVNA 1IK6A 4GOKA 2BI7A 1T9ZA 3HM9A 1I9GA 2DGDA 3GNSA 3UWMA 1AKQA 1DIHA 3IR7A 1GCOA 1MOPA 1JQAA 2RGNA 3CVXA 3HY3A 3KLBA 4MCJA 2GEKA 2QRZA 3GJ6A 3AOGA 5AJWA 4CKBB 3GEDA 4HZGA 1Q95A 2JGDB 4D41A 2QRVB 3VX3A 2XMGA 3IPRA 1ZM4A 3LP5A 4C76A 2X2EA 2GOYA 2XHZA 4D74A 2Q28A 4U7HA 3GP3A 2O0JA 1M5TA 3MGKA 1YV9A 4BVGA 5KNCD 2W2PA 1G98A 1IN4A 4MV7A 1CQJA 2AMYA 4F71A 3M0EA 1XJQA 2CVQA 2Q0XA 4G4GA 5FYDA 1WE2A 2QDKA 2WTAA 1G21E 3EFOB 3PKIA 4N47A 1KQGA 1N78A 2G83A 1RYBA 2I67A 2RGEA 3F8SA 3K0HA 4W8OA 1FXWA 2GXUA 1H6CA 1MG0A 2XCLA 4WGFA 1GNPA 4GX1A 5J2TB 1L7NA 5TQVA 1CYEA 1FVFA 1KI1A 2RHDA 1QCYA 1ORVA 4HDNA 4QTZA 1QTIA 5IYZA 1LSSA 2P1RA 1Q0QA 1GU7A 4RH0A 3IR6A 2HYDA 3NP7A 2BY4A 5A3VA 2W90A 2AG1A 4YCMA 2DFPA 4P7JA 3RM3A 4AECA 4LBWA 2CFTA 2H29A 4D96A 1KTVA 3WO1A 4RIGA 4BGEA 4FVTA 3CS3A 1E8NA 5D01A 2AEEA 4FGSA 1T1RA 1YDWA 1X15A 1WG8A 3SZOA 3CRZA 5E2BA 2AIRA 2HOQA 5F4BA 1TF7A 5IULC 1J8FA 1XPJA 4GD3Q 4HWOA 4RGYA 1DTSA 3WGQA 1MQSA 3H4MA 5IBQA 1JBKA 1QG4A 1RI4A 5HZHA 1MGPA 2JCBA 3ZKWB 2D1TA 4WBXC 2YKGA 1EVLA 1QO7A 3U1VA 3GLKA 2NPIA 2OZPA 2JFGA 4IWXA 3TUIC 2UZ4A 1TTPB 2OB2A 5BQ3A 1PTJA 2CLOB 3V4OA 5IJAA 3O4RA 4X24A 1AKMA 5BSRA 3NX4A 2CK3D 4BQNA 4EYGA 2PQ6A 1J0XO 2XOKD 5AIAA 1GAJA 1AF4A 1FXSA 2J45A 3NHPA 4MR8A 3CEHA 4X1KB 3T7AA 3LKZA 5E38A 1M8KA 4AB1A 5IFKA 3LWBA 4A0SA 4HZIA 4RL4A 3O2JA 3RFFA 4AMZA 2JRLA 3ZWVA 4AJEA 2VA9A 3JD3A 4KWIA 4TL7A 3GRZA 2ACKA 2A9QA 3WYAA 1CY4A 4XA8A 1RWMA 5KYVA 1BNCA 1ZK1A 4UAJA 3UUFA 1OWMA 2PHZA 3ZJTA 3KHKA 4YP7A 1ENOA 3RJZA 1DCMA 1RVV1 1UBEA 3FR7A 1WU8A 1O5TA 2IODA 2ANCA 4HX9A 4LYFA 4LSGA 2VPZA 2GAAA 4PHGA 1U8FO 3FTQA 4OK5A 3ZWBA 1D07A 2ZYTX 5E9QA 3NDIA 4L15A 1ZITA 4KWEA 2W43A 4JBHA 1DIOB 3QY0A 4QWMA 5LN1A 1Z4KA 1OKKA 1NI4B 1K6IA 5G02A 2HJVA 3EAGA 4M76B 4BLOA 4XCVA 4TV8F 2JATA 1U9YA 1Y9DA 5AVXA 2R87A 3EPLA 4JJKA 2EERA 4BASA 2C8VA 2QR5A 4L5JA 4IHJF 1NRXA 2IY8A 4XSVA 5LQAA 3F5DA 4JJAA 2DHCA 3Q40A 4NYMQ 1W87A 2AQKA 5JLAA 1X87A 4H7KA 4ZPXA 1U2GC 3MWEA 5CA0F 3RRXA 5EUMA 1WCIA 3NT2A 4LUCA 4INJA 5JSKA 4IRXA 3SP1A 3ZQUA 4NC9A 4OB7A 3LX5A 2FPKA 5DHSA 3FNRA 1OZFA 4IZHA 3U7JA 3D0OA 2AVNA 1N1EA 1Y6ZA 2GZHA 3A58B 2UUOA 3EYAA 3OZTA 1E62A 1XTSA 4XQ9A 1UZAA 1VKNA 2FPSA 3O83A 3L7NA 1IB0A 1NU8A 3IV7A 3FBTA 4MINA 1F9AA 2R25B 5KYKA 1BFUA 2WWHA 3NHJA 4UVHA 3MOIA 4YLGA 1IQUA 2RGWA 3HXKA 3WVNA 2EHJA 4H3VA 3RSSA 1OW3B 2WAMA 5H4HA 2GYUA 3FSGD 4FBLA 3L8EA 1UKCA 4D7AA 2PE5A 1KZ7B 1P4SA 4NU5A 4ZU6X 2E82A 2WSIA 2J85A 1KVQA 1SM4A 3WGGA 4DXHA 4GO1A 5IVKA 5JMPA 3O7MA 4H16A 1W75A 2P91A 3G1TA 1CRLA 4BFXA 4Q1VA 3HKCA 3RASA 2BFDB 1OYYA 1RP1A 1KPIA 4LVNA 1XALA 1I79B 3AEUB 4RD4A 3D6NB 3GQBA 4TTJA 2DULA 4LRYA 3TQSA 1GTG1 2QPLA 3K9GA 3RHFA 5KWJA 4CGZA 1T9AA 1SZJG 2CJPA 4BU1A 4U7WA 2COUA 3ZDCA 2QN8A 2VLBA 3LBIA 2XNDD 1W5SA 1K3TA 1K4MA 4Y2RA 4LWQA 1IWPB 3VBCA 3OC0A 5HM8A 1COWD 1NLUA 4AK9A 1YBVA 2V98A 1NTOA 3B6KA 1NOKA 1PEKE 3JCZA 4QPZA 3QJGA 4X95A 3HKDB 4IIDA 2CLIB 1PP4A 3I9FA 1KAEA 4D26A 4C1NA 3LUBA 1UJ5A 3H0EA 5EHQA 5EMHA 2H1FA 3SCZA 3AJAA 3C5CA 4NX2A 4QAQA 3N74A 1JR2A 3ADPA 3P32A 2P2GA 1V1RA 1L9XA 2Q9CA 2QTAA 2H18A 3MBIA 3QBEA 2V9CA 4KRXA 5GP1A 3TG8A 1NVGA 4L8WB 4BE4A 5JQGF 1IN1A 1OI4A 3JATB 2QTRA 4YJ3A 1PVDA 2V7BA 3ND6A 1J8QA 1A82A 4QGFA 5TMDA 4N5MA 4DMMA 3G9QA 1GO2A 5J4LA 1RR6A 3VVMA 3LP6A 4MGHA 4PR0A 4CKWA 2I2AA 1I36A 3AVQA 2PIDA 4L28A 4RLQA 2IH2A 3QX7A 1RU3A 4L4XA 4WNAA 1YB5A 3OOJA 3L9WA 1TJNA 3VPHA 1FMJA 4JKIA 5I8PA 2D0DA 2CUZA 2VPYA 1R64A 3MIZA 3BEDA 4IUCS 4HRXA 4LY0A 2P3OA 1MV8A 4MWSA 5E9JA 4OP3A 4PZDA 1XJ5A 4PBRA 1U31A 3HBMA 4JEIA 2ZUVA 4JIGA 2DBQA 1NW9B 5DW3A 5ERGB 2BFBA 4FYMA 3AP2A 4BMOB 1YIAA 1PFVA 3JQRA 4JT9A 4QBGB 4MPJA 3MT0A 3BIJA 2A57A 1XEFA 3BHIA 1KMCA 2RGYA 4M1YA 1M1YE 3DE1X 3LZCA 1HX7A 3OT4A 3FFBA 3NBUA 2SNIE 4XJXA 3UV3A 3RV3A 4ENSA 2DPXA 2B4TO 4B6QA 1RWBA 1APBA 3C7AA 2QUKA 1DEAA 5AW1A 3RUHA 4KE6A 1KARA 3ESXA 1L8LA 4EKYA 3AUYA 1AB5A 4F4UA 1XYYA 2E4WA 1NULA 2Z4SA 4YAKA 1GYQA 1TA0A 4HWGA 2P2ZA 5BR4A 3FVVA 5KQRA 1YOVB 1YCFA 2ZUDA 3H5OA 4HGNA 4U9IS 1TB4A 4ZGBA 1L5LA 4AC9A 1LW6E 4DLZA 1D4AA 1T2EA 1CDEA 4PC2A 5J1SB 3Q88A 4H1UA 4WV3A 3UMFA 1SVLA 3LLCA 5EXDA 3SX4A 5FI5A 1QKKA 2MOKA 1G8MA 3ROKA 1XKXA 1NQVA 5FAKA 4BO5A 2YJ5A 1U0GA 1DQRA 1T9CA 1WRBA 1WTCA 2MSEB 1GQOA 2VAWA 4NATA 5DVZA 3R7DA 4CI9A 4M21A 4M46A 2Q2QA 3DE4X 1NUQA 5HIJA 5J40A 5CUQA 3EA5A 4IPTA 3DO5A 1I6WA 1PJ2A 1KYTA 1V9SA 3Q9NA 1PJQA 1AC5A 2G82A 4M0CA 4F0JA 4BZPA 3STHA 1SUWA 1CXZA 4ZICA 1JN0A 2HFJA 4UM7A 4ZN6A 1KEVA 1PS0A 5CYGA 2XA9A 1XYVA 3MUEA 3UAYA 3E70C 4NPHA 4EJSB 5E4FA 4ZYLA 2CV0A 2Q7OE 2Q9BA 3WGIA 3N05A 4BVBA 1FJXA 1ZZEA 1CQPA 1GFZA 2XMSA 5REQA 1A69A 2B2XA 4X61A 4WJLA 4EX6A 4NOMA 1ZXLA 4PG5A 1I4EB 2BTQA 1QGAA 2PL1A 3OIWA 1DG1G 3ZEAA 2FUG6 4FLFA 3GLTA 4B7UA 1B15A 2PX5A 4QUHA 4X8HA 4BZXA 3TR5A 1QV6A 1DWUA 3WRXA 1Q7CA 4M7WA 2OZKA 3EXEA 3KOOA 1PK8A 2NV6A 4AU1A 4JBGA 3H05A 2R1VA 5CGZA 3AEKB 3EF0A 3VR5A 4RTRA 2IPAB 3W9UA 2HRZA 4DAEA 1VPDA 1EUYA 1VJRA 4B3MB 3ZK7A 1PZEA 2JFUA 2OHOA 1QV9A 5DNEA 3VX4A 4E5KA 4RSGA 2D1SA 2F8TA 2IE0A 4UM8B 3LPNA 1P4RA 3M1IA 4QT0A 1QTNA 3PKJA 4HGYA 3LV8A 5AM5A 4UU7A 1JSCA 3ETDA 2VXOA 4EY5A 3GLFB 4FOOA 3THSA 4AKSA 2ONCA 3PZBA 3FM9A 3CBGA 3IIEA 2NSJA 2Z2KA 5ALIA 4Y0VA 5BNWA 2DHQA 4HDKB 4UHFA 2JLZA 4TROA 5L7YA 3LQ1A 2YWDA 1RQRA 1WVIA 3NFYA 4QJ4A 4QU9A 2XWQA 2PL3A 2R00C 1JHXA 1VPVA 3OOHA 3TS1A 3ZV4A 2MTBA 5T67A 3HHPA 3L49A 2I7XA 3CLRD 1KK0A 2XXJA 4FDUA 1AKRA 4MJLA 1PBNA 4D79A 2FCRA 2A1IA 1QMIA 4HX5A 3EGVA 5ABPA 1KXZA 1QV7A 2ZBVA 1K97A 3CZ9A 3AUSA 4U8HA 1XV5A 2ZCUA 4N6GA 2ANBA 2YC2C 3ZHQA 1JEYB 5I7AA 3MTIA 4NG5A 5T4EA 4NENA 4UU0A 1GVNB 4N82A 1JEJA 2OHGA 3BGSA 4CCSA 5IM4A 2ENWA 3C8ZA 1WP9A 3DUWA 1Z5ZA 1UEIA 3EWIA 3JWGA 1MJ5A 3T7RA 2QBYA 1MB9A 5L7WA 1D2AA 4RV5A 3LHKA 1E1DA 4QJIA 2TRSB 4IJVA 3ENZA 2PFGA 5KTKA 1XCPA 3MCVA 1B23P 1JIQA 1AA9A 4BLUA 1OLOA 3OZGA 3EZXA 5EFOA 4ZHQB 2PS0A 3GQBB 3BMCB 1U2PA 1X7GA 3FVWA 4UVEA 3PVZA 4PAGA 1IBMB 3EDQA 2IOFK 1YI8A 2G5CA 1E2HA 1JXAA 3UMJA 3STXA 5ICCA 2ZYDA 5AVVA 1Q22A 2VUSA 4Q03A 1NNI1 5CNKA 4MLPA 1SVNA 3K9QO 4ISBA 4N0QA 3VTZA 2D5LA 1WEKA 4DLRA 1VA4A 3ZD8A 1M0WA 4HJXA 1I7LA 5ESDA 2VJLA 3CEAA 4U6SA 3C3CA 5FPKA 2H1WA 5EJFA 3ZE7A 1UPAA 2YOGA 3NBZC 5C5DA 3LIIA 1I3NA 3D6UA 1P9OA 2ZZMA 2FYTA 2W6JD 4FGWA 2PWAA 4H77A 2IHBA 1IEWA 1L7QA 1P61B 1M1XB 2Z6QA 2A5DA 2VRBA 6NULA 2NYRA 3M6FA 3QOFA 4BX2A 4TWRA 3VPSA 3ETLA 1XLWA 2PX6A 2W48A 4HVAA 1O9BA 4MRMB 4WDRA 5BQ5A 2FLVA 5FTJA 5BSUA 1QMHA 5JALA 3LDHA 4B48A 1GHTA 2GUWA 2HBQA 5AQEA 2JVIA 2XUGA 4HSEA 2BE7A 3PC6A 3K30A 2C3UA 4NBRA 1BS2A 1FFEA 2FB9A 3M2PA 4OAPA 2GPWA 2VDWB 3VYUB 1KP2A 2ZKLA 3N6RA 1V7ZA 4UNSA 4CR6A 3NBMA 4N7MA 1RDFA 3MUOA 3TLMA 3JQBC 3G8YA 4OM8A 4IJMA 4RIIA 3LPAA 3HXPA 1SC1A 2ZAYA 4RANA 2HK6A 5F64A 3C5WP 5B6JA 4B87A 2C00A 2HMYB 4JN6B 2EFHB 2IHKA 2QZ4A 1QDEA 4DLBA 4X1IA 3GEMA 1E1NA 4MKIA 5GMOA 5J47A 1T5IA 1OB5A 4BTEA 2CXXA 4C30A 3NKFA 2BM9A 5K3EA 1P6UA 1J0AA 3OZEA 2AJTA 1KS2A 4R51A 1GUBA 2HWYA 3GGCA 4TQUS 3D3WB 4DWOA 3RIHA 4NAVA 1KEKA 4BMXA 1CLUA 3PZRA 1D4OA 4MW5A 5T4HA 3UGQA 5JXWA 1E1YA 3PPXA 4XM0A 1MJNA 1PK7A 1CY6A 2C92A 3I9MA 4TT8A 3UWOA 2HBYA 2XA1A 3WO0A 8MHTA 2BBSA 3B89A 3CYFA 2DR0A 3HLKA 2E18A 2IQ5A 3CCFA 3IURA 3M1AA 4X84A 4L6AA 3TDMA 3V7YA 4GAEA 3JTEA 4NOLA 5F7OA 4B3RB 1ESZA 5DEIA 3ZIUA 4DWJA 2PZMA 1AQYA 4BVKA 2W6ZA 5JBIA 2FQXA 3DOUA 2H3HA 3CRRA 4IJUA 4Z4GA 3ZHTA 2WJPA 4P3XA 2JGLA 3F7NA 4N0DA 1XXHE 2PBRA 3FGNA 4OYYA 4YJHB 1KMHA 1QF7A 3JASB 5GJBA 4CEIB 4DDUA 3D7KA 2AE1A 2ODWA 3H6GA 3WWOA 1ECCA 3IO3A 4FFVA 4ODIA 1A9ZA 2NZ8A 2WK1A 3IDQA 1VIYA 4ML3A 1T5HX 5I8ZA 5B6PA 1H0HA 4KFTA 2B98A 1DIBA 3ADKA 1BA3A 4E5DA 3EG5A 2D0IA 4L7QA 1M8FA 1PGPA 3F8TA 3NU1A 4TS9A 4ARSA 2I4MA 2WM8A 1ZJ6A 3DLCA 4IH4A 3C48A 3ZWQA 4U3JB 2IHZA 3KQTA 1N2IA 1BGVA 3CX3A 3TTVA 1T1JA 4LJKA 3TSOA 3ZE8A 1TEHA 2IYXA 3F96A 3HRKA 3AXSA 3IH5A 4L9WA 1KU6A 2XX3A 2ECKA 4PQFA 4PXYA 1B41A 3TVTA 1UT5A 3T7KA 3UJ3X 3BREA 2ZS8A 3F4KA 2YIDA 1IUKA 3DQQA 2G04A 3TSAA 2AV6A 1ISIA 3GGPA 4NE2A 3RIMA 4G56A 4LNHA 4E07A 2QN9A 2WV7A 2WWFA 1Y8QA 3H16A 3UT0A 4H1TA 1UMKA 2IHYA 2OO7A 2ZIWB 3W6UA 3Q98A 2GD1O 2QN2A 3GLSA 2X0RA 3ZX4A 1ZKDA 5IUJC 1JP7A 4KGVA 4N0EA 4CMBA 3EP5B 1UBUS 2N9UA 4HLUA 3DS8A 4K7JA 4LX0A 2XBUA 2R2AA 1BDJA 2EGGA 2GYWA 1M34E 4O4JB 4PYJA 1RI3A 1SVOA 1MG5A 2WI8A 1CUAA 2J3JA 2J6BA 4PN7A 4IP0A 1ZRSA 3C87A 3R9KA 1I10A 4GM1A 3TDKA 1FQKA 1DBWA 3DMTC 1MT0A 3N58A 2QX6A 2CF6A 4ZVSA 2ONZA 3IAUA 4QPJC 3PA6A 4ASUD 4P93A 1N2CB 1OI7A 4EAAA 4IQFA 1DFHA 2FG5A 4LXUA 4MMZB 2J9ZB 5A3JA 1YH3A 1FSGA 1XAHA 1BFKA 1JZSA 2VHZA 4HQNA 5DHRA 5I9LA 1HNWB 2R1TA 1OGYA 1YBFA 2WU0A 3R6LA 2RG1A 5ARBA 1H5NA 1DRUA 3EXHB 3PGMA 1U8UA 3A37A 2PX0A 2VJBA 4ZI5A 3RVDA 3X1DA 1GRVA 2IXBA 1FE8A 1WEHA 5DGIA 2QLMA 3FRHA 3PGA1 2JGNA 5FBHA 3MSCA 1TYCA 5SYMA 1B0AA 2IYPA 1CTQA 4JH0A 4MUXA 1C8LA 1EKXA 2R8ZA 1G8JA 2O1SA 1I4DD 3USCS 2PTHA 3E9DA 2G67A 3GMSA 2CKMA 2Z8XA 2Q1TA 2P2DA 3JWJA 4GE0A 4HGZA 1PF7E 2QY6A 3IJEB 1VE5A 3CVJA 4QDUA 4P9NA 4GXQA 1YZUA 4Z4CA 1GITA 4UDXX 2QYHA 5B4TA 1JHOA 5BUZA 3HN7A 4FEEA 4LQDA 5B58T 5TGTA 5AW8A 1JT2A 5LZ8A 2AI1A 5ARDA 5BV2P 5I4BA 1USVA 3G9UA 4HNVA 3UW3A 1W94A 2OZEA 3LTEA 3EVEA 5C4IA 1EFDN 3COWA 4NF2A 5EXEA 2RMKA 4DA4A 5DLQC 4RA9A 3FPJA 1MEOA 1VL5A 4NENB 4QYIB 4W5RA 5ILGA 1DSSG 1FS5A 4E4RA 2WNIA 3BDIA 4NJOA 4FIDA 1J33A 4F04A 1J42A 2IE8A 2EKDA 4FPXA 4YDHB 5JAHA 1ZJ5A 4AJPA 4TMXA 1YE3A 3N7AA 4LQ4A 4BC0A 3WLLA 3N0WA 5C1OA 3I8XA 4X20B 4PLPA 4PTLA 5T41A 1RE1A 5CVVA 1A9SA 1O4VA 2J4DA 3R5HA 3OM1A 2VS1A 1HT0A 2CUKA 2W2KB 2J5BA 1OZGA 2C58A 1HLGA 3KUUA 2I1WA 3H2BA 1AHHA 3DDZX 4HMQA 1CFZA 4K6OA 2VOJA 4QECA 1F8UA 5KHAA 4AG3A 1R6DA 2J6IA 5E0OA 3IWCB 3HGMA 1J25A 3Q8WA 5LU8A 5HK9A 2V59A 2IU3A 2Z8ZA 1NVDA 3KJHA 4ZU1X 4TZ6A 3KQWA 3L1VA 4A27A 3F78A 1NJ2A 2WG1A 5BN4A 2VSQA 1VL8A 5DM0A 1P18A 3LVQE 2HV8A 4I6EA 4UEJA 2G07A 1A8UA 1KGDA 1NG1A 3N2KB 3B48A 4YLEA 3C41J 1P9LA 2ODEA 2REOA 4DNQA 1WSBA 1E4EA 1WUYA 1B2RA 2MR5A 4FKZA 5SYAA 3IT2A 3OIGA 5ALUA 2ZK7A 3PJGA 1TM1E 3U7QB 3IGFA 2PKWA 3E2PA 4DLLA 2H9YA 4KFSA 4CV1A 2RH9B 4QUGA 3VU9A 5ITWA 1JX6A 2QU7A 1U9IC 1A96A 5F7JA 2DBYA 4QO7A 3FIJA 2CLFB 3BD8A 2DBRA 1EX9A 2X1LA 3LX4A 4PLFA 4ZCRA 1TK2A 3VNVA 1RJFA 4U7DA 3P7MA 3KQHA 4E5YA 2PM8A 3H2SA 4LPKA 4GPD1 1IXRC 2Q5FA 1Z08A 3IS3A 3VMFA 4Y9UA 2NUAA 3EXIA 4FN5A 4PO1A 1PZHA 1VI6A 3WR5A 4EY6A 3TRJA 5JO9A 4QTTB 3FMVA 2FSVC 3LLMA 3IUMA 4RY0A 3UAVA 2D2EA 4JBNA 1F4LA 1YB6A 2Q4OA 2EX1A 3Q72A 3HADA 1AS0A 1SH7A 4A8JA 5DJ5A 1BGXT 3CLKA 3NWBA 4GMHA 3U19A 3IEPA 2R3SA 3TECE 5KJ1A 1KPGA 2YTZA 1Q3TA 2LWIA 1GUDA 2P9CA 4DIBA 1SA0B 3S2UA 2WD8A 4PANA 3VZBA 1GN9A 3WIEA 1TEXA 4X1YB 2Z6VA 4PQGA 1N9ZA 1XEXB 2WJYA 1J99A 4KQ9A 2PNFA 4F4CA 3I5UA 3ASUA 3HB9A 1E6CA 3HSYA 5ITVA 4V39A 1FOEB 3HE3A 5DNYB 3HBLA 1FMCA 2AN1A 2ZB4A 4ZAYA 1K5GA 2ODPA 4YRQA 2FJUA 1PDWA 1PIWA 4LMPA 2B7CA 1EWKA 1TGVA 1P6QA 3DGFC 2JI7A 3DLAA 5F2NA 2PX3A 1C3OB 1U5BA 1SEVA 3D81A 2P3QA 3K1AA 5KB3A 2BZSA 1GVHA 4KQFA 5EZ6B 1X94A 4M88A 1J0EA 3U3OA 4G5SA 3GVHA 4HN4B 2BTQB 1ZCFA 4ZVPA 5JNTA 2W8ZA 4AUKA 3NHBA 4B74A 3A1CA 4G1BA 2RHGB 3WIDA 4B3TB 4BXOB 4HDNB 1GILA 3ZJUA 1ID8A 2GPYA 2SCUA 1TECE 3K2IA 4S2UA 4JODA 3EMKA 1P1JA 4MP6A 4TS4A 4CMGA 3Q3GE 2CL7X 2LIVA 4PG4A 2WUDA 2OVFA 1XKTA 4AIRA 3PUKA 3OP1A 4YMHA 5BPHA 5BW8A 1FU8A 3FKJA 3LC1O 3RUFA 5JTTA 1RRFA 1BG6A 2ZTLA 1E79A 4QDXA 4ZT3A 5KQSA 1XPRA 2DFNA 3D8SA 4IHAA 3Q6IA 4Y0AA 3W06A 3OU7A 4LV6A 1HXHA 2O1XA 3FLBA 5CURA 4YAJA 5TB5A 4BCDA 3OZWA 4UQLA 3FR8A 4C0WA 4GNKA 1OXUA 1SU8A 1VRWA 2Z5LA 5EHNA 4DMCA 2XRZA 3H11A 1Y1SA 4X6YA 3VR0A 2Q1SA 2GZRA 4M2LA 3RT7A 3PHCA 4RTOA 4L85A 3G5AA 3ROEA 3P9YA 4REMA 4RMNA 5LNK6 3DLHA 2OQVA 3EW7A 5EJ9A 4NKRA 3T9EA 4L2IB 3KQVA 3D2BA 1BSVA 1E7QA 2FOXA 3V33A 3GELA 3WQSB 4EW6A 3GFPA 3LL4A 1FYWA 1LBIA 3KT0A 4A15A 3AM3A 2ZUWA 1A97A 1DV1A 2DPHA 2OBNA 3AEKA 5YASA 2JANA 2JB9A 3L0BA 3P9XA 1HPLA 4ZI2A 3GLHE 3SF8B 1F8YA 2HQSA 2YHSA 3L7MA 4TXMA 2IW3A 2J0SA 2ZR8A 3M5DA 2XMBA 1Z5UA 4AUNA 2G72A 3DKIA 3IBSA 2CZQA 2VNKA 4MVXA 4GYKA 1JPNA 1IVSA 1SUSA 1XMQB 1PV4A 2UYGA 3ZV3A 2Q7DA 1ZH0A 2II6A 4MWGA 5F1KA 2G63A 2JBWA 4UMFA 1J2YA 2G9UA 4YIKA 3BSYA 1F38A 2OXRA 1VKOA 2RHRA 3AHIA 3DNPA 4OXRA 4OQ4A 4UAGA 5CNIA 4YRRA 4PNHA 3JW8A 1P29A 2WZDA 3CWQA 2YXNA 2J9FB 3OLVA 1NRWA 1H4QA 2IEBA 2PNJA 4GI3A 4MR9A 1I8TA 1EYZA 2B37A 4O4LB 2P2YA 3W3AH 3BTOA 3IFSA 3V4RA 5G0SA 4KH0A 4L6CA 2CLSA 4WIAA 5COQA 3M82A 4PZEA 4CIXA 5A6SA 2XZOA 1M6VA 1D8AA 4LDQA 3SQOA 1FF9A 2IWRA 2P6OA 3KB8A 3M89A 3MHPA 2D0OB 3NASA 3ODGA 2G88A 1YFZA 4HNHA 4AUMA 5FI3A 3UXYA 3D43A 4ZP1A 2PUCA 4CTMA 2C31A 4B4KA 4AKHA 4OXYA 4BPRA 2HBZA 2P6UA 2J8ZA 3H5WA 5J4YA 2PL9A 4DJAA 1E32A 1T2VA 2REQB 5LOVB 4FHCA 3KSAC 3CKYA 2ZU0C 1NIPA 5C8YF 1A9RA 1Q0RA 1XG5A 3JQ9A 4OAQA 4LGMA 2O5RA 1ZIYA 3HO8A 1BMFA 3UK6A 1N5IA 1UWVA 1EZ1A 1WIWA 2J7PA 4IKPA 4KUEA 5IG2A 2BGTA 3I9KA 1QOQB 4Q7MB 1W48A 1FRNA 4YJ3F 3S7TA 5CLFA 1Q84A 3TR6A 1XYGA 3EP7B 3UJ9A 1JMKC 4MHOA 2OY0A 1NJ8A 3GI1A 5EERA 1WKVA 4IX9A 2O8DA 2G8NA 3V1MA 3ER6A 4FQ8A 3T6KA 2GRUA 1H1LA 2Y1WA 4TMKA 2BEVA 3T3GA 4CMKA 3B1FA 3MD0A 1PV2A 2Q1XA 4WVLA 4ZTZB 2I6XA 3JALA 3W5CA 4JL5A 2IT1A 4WNYA 3JQBA 3AILA 5E8JA 1PWZA 1Y9JA 2WAOA 2JGKA 4BLVA 4DREA 5IP5A 1OBFO 3MWGA 4FMDF 4G1VA 4F6CA 2CVPA 3IBTA 2RAVA 4M1ZA 4ITRC 1KFEB 4B6RA 2AMFA 4FX2A 1CE8A 2YV2A 5KWVA 3OUTA 1FDVA 4LKRA 4IIVA 4ZOBA 2CBGA 4YO7A 4N3BA 5EGSA 3PDHA 1N25A 3E3LA 3UVEA 4R84A 4QXMA 4LVOA 4OAOA 4RMJA 1K6MA 1WHTB 1XWIA 1G3UA 2ODNA 3LYLA 4EPTA 2GZ1A 1IHPA 3B38A 3LXUX 1BXZA 4CLDA 1M83A 2VJKA 2NO5A 4ZGGA 3KT8A 1BN6A 1DQZA 2CNLA 3ECSA 1KPHA 4BRSA 1ODLA 1TLTA 4J2OA 4EVQA 2R48A 3P9NA 3TLKA 1FIUA 4Z7NB 4NBNA 1B2LA 4YYZA 3A04A 2BMFA 3EGOA 2NU7B 4UNRA 5BYKA 5C80A 2XGJA 4LYYA 1E5TA 5H1YA 2PEZA 3AJDA 3SJ7A 5EVCA 5HBGA 1BHSA 3PR3A 4MDYA 4KSCA 5FF9A 4CM1A 1WVGA 2IU4A 1S1CA 3LGAA 1NW3A 2EATA 3OA2A 5KNBD 4JIMA 2BL4A 3THYA 3JYHA 1WETA 4RA6A 3GG9A 5AMXA 3I2FA 4OYHA 3VC2A 4M9QA 3EQ7A 5KWIA 2QT0A 2PUBA 2IQIA 4ZOQI 5IT5A 1YBAA 4EMSA 1YA6A 5A5DA 1ONNA 2B4KA 5IW8A 1WD7A 3ENVA 4LOIA 3NV9A 2CNWD 4Q9JA 3CH5A 3N3AC 2Q4TA 2WIGA 1PX0A 5AJTA 2WAXA 3RSLA 2WE8A 4DDWA 1Z16A 1P60A 4EPYA 1KC3A 5ALDA 1XRRA 1V2HE 1MC1A 3HCFA 4FEYA 1J8MF 4ZQBA 3WLAA 5EWJB 5ITZA 4YR7A 2VXCA 1RXWA 3ONNA 3OPXA 1TVKB 3SM3A 1LLQA 5KI6A 4DADA 3SEQA 2VYND 4HDOB 4I5GA 2P41A 5BSMA 4LF6B 2ZJ2A 1WXDA 1H2ZA 3EVZA 1X7YB 2R6ZA 4N39A 4ED9A 2FGJA 2QJFA 4M8NE 2RB5A 3K15A 3NAQA 5LJIA 1KDZA 4D44A 2XKBA 2CV1A 1CUGA 4ZMRA 1KZGB 4DLWA 2XI4A 4AM8A 2VF2A 4UASA 1U7XA 4L95C 1LRJA 3AFNA 4YO8A 3K0CC 1Y1TA 5H02A 2NIPA 4IL5A 3TNLA 3QGMA 5DW0A 1GPMA 1L7PA 4IMJB 3DOIA 1PKXA 3PQEA 3PWKA 2O2ZA 3UK0A 3WGNA 5TS2A 1OXTA 1JS1X 3RTAA 4CL3A 4XWWA 1IN5A 2QJRA 3E9YA 3IDOA 1GNLA 1MRNA 1MIHA 4YCCA 5EJ6A 1MP0A 2J3EA 2O1WA 1I80A 3W8FA 2AD1A 5BN3A 4HOYA 1BFDA 2DLDA 2WWGA 3A31A 2W6CX 3BQNB 3KZXA 3QPVA 4Q9KA 4OHZA 3RSGA 3DULA 3F71A 3V55A 1NZJA 4B5LA 4HC4A 2PX8A 1CF9A 5DNVA 4WY5A 3RS7A 2XLBA 4OBBA 1YS4A 3PNMA 4NIMA 1MOZA 1FVXA 2H8KA 4RTJA 3TTTA 2ZRNA 3K1YA 4UOEA 2JJ2A 3CW9A 5K2MA 2UZ0A 2QVCA 2XXAA 2P69A 2ZE7A 4H4CA 3G2PA 1ZWKA 1U7ZA 2FW1A 1B14A 2QD4A 4WK2B 2B1RA 4Y1GA 1K1EA 2CE7A 2QLTA 2FFAA 1U9CA 3KOXA 5EN4A 4QM7A 2GCEA 1DBVO 2P9QA 2FN7A 5U4XA 5G0TA 3HEBA 4LJ4A 1AV6A 2HJSA 1J00A 1OXXK 1X1CA 3BIWA 2IVFA 2R8BA 4Y2HA 1DX6A 1L7OA 3HO6A 3KWLA 4L51A 4WQMA 4I3HA 2AG5A 3RSQA 1B8NA 2PV0A 2I8CA 2D1RA 3CF4A 1GXSA 5FPQA 3AGQA 5ICMA 1GA1A 1UP7A 3CZAA 4Q21A 4BFYA 1T91A 1OROA 2VSNA 1ZD9A 2I6GA 3NETA 4FC7A 3TW0A 4KSBA 3NDJA 4WKPA 3P8ZA 2FF5A 4W9RA 1XX6A 3VR3A 2LW7A 4HDQB 1U0JA 1TRHA 1GSHA 4MQEA 2IL1A 2PTGA 4J0GA 4DLUA 2O50A 3WADA 3GV0A 4GNRA 3U9TA 1CY1A 4HGOA 1RHRA 5P8WA 4DTCA 2QW8A 1GZUA 4URWR 2JIOA 2QUIA 2BKAA 3SPXA 2H51A 2OILA 3BWMA 3ZVRA 5L40A 1H8HD 3DZIA 721PA 4R01A 4BXOA 3GOHA 3EUWA 3A28A 3NG1A 4GOXA 2I4TA 4F60A 5JXGA 1EM6A 4TUYB 2BRUA 3N8NA 1DUSA 2ZDHA 4I3FA 1E9SA 1W85B 5EKSA 1DT5A 2CXPA 3R0XA 3PEFA 3RI3A 5IC5A 2GASA 2ZRIA 2HTFA 1X74A 4LOKA 4PZ0A 4ZDJA 4BQEA 3OA0A 1IULA 3ZW9A 3ZBUA 2C0CA 4JB8A 5F33A 2QRPA 2O7NA 3UA4A 4E1AA 1Z0IA 1KBOA 2C5GA 2VQDA 4UE3S 3N0VA 3MM4A 4MWDA 3AIKA 4PC3A 3NT5A 3K1JA 3KV3O 2XB8A 3QU5A 1OE0A 1NVXQ 1LWOA 3B2EA 3N59A 1N6NA 4J4BA 1YS9A 3K16A 1WOYA 4LJLA 2CL0X 2R5NA 4XRRA 4BVLA 2GF9A 2X2PA 1HZJA 3CNLA 3ZWNA 5LD2C 4M1SA 4BGUA 1MJHA 2J5RA 1M2KA 4RSRA 5KJCA 1M2NA 1NW6A 4DZRA 2IXAA 1MRSA 1U5AA 4JHXA 4YFVA 2AOWA 1DFGA 4BNHA 1G20B 4B71A 3TQFA 5DT9A 3BTUA 2GI4A 2R97A 4EG4A 5CIWA 1JJIA 4EF4A 1GPYA 3BAFA 3DPUA 4RWZA 1CUXA 1N5DA 1E99A 5HZGA 4FGKA 4JOSA 4UBLA 3UAXA 4YMIA 2QQFA 1NW8A 3KX2A 3J7TA 4AQ7A 2J3MA 2NU6B 1QP7A 1RWNA 4XQEA 1D6JA 3MERA 3H5TA 3WJAA 1JAHA 3GLGE 1ULSA 1OASA 1UT8A 4I5DA 4R68A 2X8JB 3RUIA 1RZ3A 1OYWA 2IHVA 1KI8A 3O8QA 2AYXA 1FVOA 5JQWA 1OV6A 1Z6QA 2GF2A 4KN6A 3AV3A 5DSXA 1VIDA 1BXRB 2ZI6A 3F7MA 3MMPA 5B37A 1SCUB 4TYWA 3EOBI 2VTEA 1ZUIA 2PLNA 3P19A 2HA6A 4PSCA 3U4MA 4MVJE 5CVDA 5JAMA 1EAMA 3H2IA 3E4CA 2ID4A 4WFQA 5CFOA 2VJMA 5IZ4A 6PFKA 1BQ4A 3E9CA 1KORA 3KQOA 4U63A 1A95A 3E7WA 4HYYA 3LCVB 1H66A 2OBBA 2QK4A 3KB1A 5DYGA 3PIIA 4J49A 2Y93A 1YL6A 4KP7A 1DOHA 1SC6A 4B6SA 4E3WA 4FNAA 2C9MA 5EIWA 1QORA 1VDMA 4IXMA 1FP4B 3RANA 3CINA 4HG2A 1P4JA 2VPWA 4AWXA 4MA5A 2FW9A 2YYZA 2TECE 2GM3A 4RAQA 1L4EA 3U7IA 4D4IA 1XT6A 4AS1A 5IPFA 4CMJA 3CG4A 2Z1MA 4A73A 4GZ5A 4M7OA 1YACA 3H9BA 1HKHA 3CX6A 5CTAA 5I9BA 1U90A 2NXEA 3I09A 3GBVA 4RJKA 2IBTA 2V7EA 4H6XA 4OH1A 4WCFA 1GTRA 4TXLA 4CQNA 4EITA 2OCAA 4JLDA 2OO5A 4X91A 3SDBA 2VJPA 3OZFA 3L6EA 1FX0B 2RFLA 5CFQA 4CDGA 1MBZA 3MQ4A 4LHWA 1TC2A 3T35A 5LOVF 3G0IA 3LECA 3RWBA 2YS6A 5DX1A 2YFHA 3AYZB 2VP5A 1VQ1A 2VP4A 4J2TA 2OXEA 2LNDA 3FPSA 4Y9SA 3QEMA 3NATA 1GU1A 3RRJA 1PLLA 4JKYA 3C15C 1NMXA 4K3VA 1NG9A 5MGBA 3B1VA 4J3NA 3NNSA 2AOVA 5HOQA 5KREA 1WU7A 3AB8A 1CUDA 1XRMA 1XD8A 3EDRA 3LBAA 4D3FA 4QNRA 5CYPA 3UWDA 1V1JA 1P91A 4DIOA 4GUAA 4MCHA 4ZO9A 5JPCA 1XHEA 3VO9A 1W34A 5L9AA 1YB7A 3KDAA 3NIBA 2A92A 4RAOA 3UOAB 4L1KA 3FTNA 1S2IA 2LKCA 1MXFA 5TT1A 5A6VA 1UWKA 2PMBA 1UINA 4O3MA 2GERA 5CB4A 1F2DA 1PR0A 4O4JF 3A4LA 1KMHB 1Z25A 2NG1A 2QRKA 3JASA 4RM3A 4X6XA 5TPZA 4J3JA 3GJ7A 3G23A 3AERB 4KDRA 2IYOA 1SN7A 2V9ZA 3I5MA 1B93A 1VE7A 4F92B 1U5BB 3KIPA 4EEXA 1YBHA 1DJQA 1PL0A 1T43A 3KWMA 4XWKA 4UCQA 3ETNA 3ZN2A 4NMHA 3O75A 1GUZA 1H6DA 2IF2A 5J63A 4C29A 2YMMA 4IV5A 1ZGAA 1MC5A 2BUCA 2GEBA 1ZL0A 4R4JA 2NX2A 1V3VA 4PCLA 3HVRA 5K4AA 2J5KA 1KEEB 3T9FA 5JI2E 4Q3BA 1NXTA 4OHYA 1K98A 4EECA 1YMUA 3RCBA 1ATIA 3M6IA 3ZV6A 1JDJA 3NB0A 5EE5B 4OXXA 4YQEA 1VKRA 3CUVA 1G59A 1KMQA 3EG9A 3HABA 4IV8A 4XWTA 1YVEI 1E8DA 1K8XB 2OLJA 4NBKA 4ZCIA 2X42A 3LT1A 5JCOC