2I40B

Cdk2/cyclin a complexed with a thiophene carboxamide inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title 5-(1H-Benzimidazol-1-yl)-3-alkoxy-2-thiophenecarbonitriles as potent, selective, inhibitors of IKK-epsilon kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 95
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2i40B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2i40B02
1N4MA 2WMBB 4EOSB 3BLHB 1F5QB 1OIYB 3MY5B 4EC9B 2F2CA 2W99A 3QHRB 2WIHB 4CFUD 1OGUB 2EUFA 2BKZB 3MIAB 1FVVB 2BPMB 4Y72B 2WIPB 3G33B 2PK9B 1AD6A 1O9KA 4BCQB 1URCB 5IDPB 1GY3B 1H4LD 2UZDB 2W2HA 3H4CA 3K7AM 4CFVB 4ROCA 5IF1B 1P5EB 5HBHB 3O0GD 2V22B 5CYIB 4KRDB 4CFNB 4BCMB 5L2WB 3EOCB 1FINB 1UNLD 4EOKB 2PHGA 4F6SB 5FGKB 1VINA 1H26B 3DDQB 3LQ5B 5HBJB 4EOJB 1BU2A 5HBEB 1H25B 2CCIB 2WPAB 3BHVB 4YC3B 1H1QB 4EOPB 4ELJA 2IVXA 4OGRB 4OR5B 4F7LB 4F7SB 4BCIB 2G9XB 4NSTB 2QDJA 1W98B 4KRCB 2W96A 1D3UB 1GUXB 4BCND 2X1NB 2R7GA 3BHUB 2UUEB 5IDNB 2I53A 4F7NB 3POMA 4ROEA 2W9FA 1OI9B 4IMYB 1E9HB 2UZBB 5HNBB 1OIUB 1UNHD 4BCFB 4F70B 4F7JB 4CXAB 4CFUB 1JOWA 1H27B 3M03A 2C6TB 4ELLA 4F6UB 1JKWA 4EONB 4BCGB 4F6WB 5LMKB 1TFBA 2WFYB 1H24B 3TNIB 5HVYB 4EOIB 1GUXA 2UZEB 4BCNB 5I5ZB 1H1SB 3EIDB 3RGFB 4EOMB 4TTHA 4UN0A 4CFMB 2UZLB 4CRLB 2C5OB 4EORB 4BCKB 5EFQB 2WEVB 2CCHB 2PMIB 4BCQD 1G3NC 1VYWB 1ZP2A 2IW8B 2JGZB 1KXUA 2PK2A 2WHBB 3F5XB 4G6LB 3TNWB 1GH6B 2C5VB 4EOLB 5ICPB 5HQ0B 1OL1B 3TN8B 3BLQB 4BCMD 5ACBA 4YOOA 1UNGD 4BCHB 1H1PB 4EC8B 4YOZA 5LQFB 4YOSA 2C4GB 2IW9B 3MI9B 1C9BA 1JSTB 4EOOB 3DDPB 4II5B 5BNJB 3QHWB 1PKDB 2W9ZA 3DOGB 4I3ZB 5CEIB 4BCPB 1AISB 2C5XB 1QMZB 1XO2A 1VOLA 3TNHB 2B9RA 1H1RB 3BLRB 3MY1B 4CFXB 1OKVB 3BHTB 2WMAB 1O9KB 3EJ1B 4FX3B 1JSUB 2I40B 4EOQB 1OKWB 4CFWB 1OL2B 2CJMB 2IW6B 2WXVB 1H28B 4RODA 4BCOB 2C5NB 4BCJB
chains in the Genus database with same CATH superfamily
1F5QB 4Y72B 2BPMB 2KR6A 1O9KA 5IDPB 2UZDB 3H4CA 5IF1B 5CYIB 4CFNB 4BCMB 1FINB 1UNLD 3A8LB 3DDQB 2IVXA 4OGRB 1V29B 2QDJA 4JX4A 2QGSA 1D3UB 4BCND 2X1NB 3PO3S 5IDNB 2UUEB 3DJBA 4F7NB 4FM4B 5HNBB 4F70B 2ZPGB 4ELLA 4F6UB 1JKWA 4EONB 5I5ZB 4CRLB 2QQ8A 2UZLB 4EORB 1QLBA 2CCHB 1ZP2A 1KXUA 3TNWB 2AHJB 3QYBA 4BBSM 5EJCA 1OL1B 4BCMD 4BCHB 4EC8B 4YOZA 4YOSA 3MI9B 2IN3A 1C9BA 1JSTB 1PKDB 2W9ZA 3DOGB 4I3ZB 4BCPB 1QMZB 1XO2A 3TNHB 2BS4A 1H1RB 4JX5A 3BHTB 3EJ1B 4FX3B 1E7PA 1JSUB 1OKWB 4CFWB 1OL2B 2CJMB 4QSHA 4BCOB 4EOSB 3BLHB 4EC9B 2F2CA 3QHRB 2BS2A 2DXBB 3VKGA 4NC6A 2WIPB 3G33B 1GY3B 3K7AM 3QWLA 3KHIA 2ZPIB 4OB2B 4KRDB 3EOCB 2DXCB 5FGKB 1H26B 3LQ5B 4MFDA 1H25B 2WPAB 3X20B 3BG5A 4BCIB 2G9XB 4NSTB 2W96A 4AKGA 1AHJB 2DPPB 4M6VA 4ROEA 2CZ7B 1OIUB 4BCFB 4HNVA 4LOCA 3B57A 4CFUB 3VKHA 4ZGJB 4BCGB 1UGPB 2WFYB 2CYZB 5HVYB 2UZEB 4ZGEB 4EOMB 3HB9A 4TTHA 2DD4B 3DTOA 3HBLA 2PMIB 1VYWB 2IW8B 3HHTB 4EOLB 3F5XB 3A8OB 5ACBA 4YOOA 1UNGD 3A8GB 4EOOB 5BNJB 1UGQB 2DD5B 3X24B 4BBRM 2B9RA 5IHYA 4EOQB 3QYHB 4JX6A 2LW4A 1H28B 1ENWA 2ZPEB 3QYEA 5DQWA 4AKIA 4HNUA 4BXXX 2WIHB 4CFUD 3MIAB 2EUFA 1UGSB 4HL4A 2PK9B 1URCB 3BG3A 2CZ6B 4CFVB 4ROCA 2WJ9A 2KMGA 4BY7X 5HBHB 2V22B 5L2WB 4AI6A 4EOKB 2PHGA 4F6SB 1VINA 3X25B 3X28B 5HBJB 4EOJB 2QF7A 1BU2A 5HBEB 2CCIB 1H1QB 4EOPB 4ELJA 4OR5B 4F7SB 1GUXB 4OB0B 2R7GA 4Z6YA 3BHUB 3QZ5B 2I53A 3QXEB 3X26B 1E9HB 2UZBB 1UNHD 3HZJA 4AKHA 4CXAB 1JOWA 3TW7A 1H27B 2C6TB 4F6WB 5LMKB 3QZ9B 1TFBA 2PJQA 1H24B 4BCNB 1H1SB 1FKMA 4CFMB 3NDQA 4BCKB 5EFQB 3A8HB 2PK2A 1GH6B 2C5VB 2ZZDB 5ICPB 3TN8B 4OB3B 2C4GB 2BS3A 4MIMA 1UGRB 2DMEA 3WVEB 3TW6A 3BLRB 3MY1B 4CFXB 3GTMS 4MFEA 1O9KB 2I40B 2CZ0B 2G77A 2IW6B 3VYGB 4RODA 3HO8A 5DQVA 1N4MA 2WMBB 1OIYB 3MY5B 2W99A 1OGUB 1IREB 2BKZB 3QYGB 1FVVB 1AD6A 3WVDB 4BCQB 1H4LD 2W2HA 4HLQA 1P5EB 4OB1B 3O0GD 4YC3B 3BHVB 2QFZA 4F7LB 1W98B 3VYHB 4KRCB 3POMA 2W9FA 1OI9B 4IMYB 2QDYB 4F7JB 3M03A 3TNIB 4EOIB 1GUXA 3EIDB 3RGFB 4UN0A 2C5OB 3BG9A 2WEVB 4BCQD 1G3NC 2JGZB 2WHBB 4G6LB 2CZ1B 2ZPHB 3A8MB 2ZCFB 5HQ0B 3BLQB 3DL1A 1H1PB 5LQFB 2ZPFB 2IW9B 3DDPB 2D0QB 4BY1X 2ZPBB 4II5B 3QHWB 5CEIB 1AISB 2C5XB 1VOLA 4ZGDB 1OKVB 4HNTA 2WMAB 2WXVB 2C5NB 4BCJB 1TD6A
chains in the Genus database with same CATH topology
1N4MA 2WMBB 4EOSB 3BLHB 1F5QB 1OIYB 3MY5B 4EC9B 2F2CA 2W99A 3QHRB 2WIHB 4CFUD 1OGUB 2EUFA 2BKZB 3MIAB 1FVVB 2BPMB 4Y72B 2WIPB 3G33B 2PK9B 1AD6A 1O9KA 4BCQB 1URCB 5IDPB 1GY3B 1H4LD 2UZDB 2W2HA 3H4CA 3K7AM 4CFVB 4ROCA 5IF1B 1P5EB 5HBHB 3O0GD 2V22B 5CYIB 4KRDB 4CFNB 4BCMB 5L2WB 3EOCB 1FINB 1UNLD 4EOKB 2PHGA 4F6SB 5FGKB 1VINA 1H26B 3DDQB 3LQ5B 5HBJB 4EOJB 1BU2A 5HBEB 1H25B 2CCIB 2WPAB 3BHVB 4YC3B 1H1QB 4EOPB 4ELJA 2IVXA 4OGRB 4OR5B 4F7LB 4F7SB 4BCIB 2G9XB 4NSTB 2QDJA 1W98B 4KRCB 2W96A 1D3UB 1GUXB 4BCND 2X1NB 2R7GA 3BHUB 2UUEB 5IDNB 2I53A 4F7NB 3POMA 4ROEA 2W9FA 1OI9B 4IMYB 1E9HB 2UZBB 5HNBB 1OIUB 1UNHD 4BCFB 4F70B 4F7JB 4CXAB 4CFUB 1JOWA 1H27B 3M03A 2C6TB 4ELLA 4F6UB 1JKWA 4EONB 4BCGB 4F6WB 5LMKB 1TFBA 2WFYB 1H24B 3TNIB 5HVYB 4EOIB 1GUXA 2UZEB 4BCNB 5I5ZB 1H1SB 3EIDB 3RGFB 4EOMB 4TTHA 4UN0A 4CFMB 2UZLB 4CRLB 2C5OB 4EORB 4BCKB 5EFQB 2WEVB 2CCHB 2PMIB 4BCQD 1G3NC 1VYWB 1ZP2A 2IW8B 2JGZB 1KXUA 2PK2A 2WHBB 3F5XB 4G6LB 3TNWB 1GH6B 2C5VB 4EOLB 5ICPB 5HQ0B 1OL1B 3TN8B 3BLQB 4BCMD 5ACBA 4YOOA 1UNGD 4BCHB 1H1PB 4EC8B 4YOZA 5LQFB 4YOSA 2C4GB 2IW9B 3MI9B 1C9BA 1JSTB 4EOOB 3DDPB 4II5B 5BNJB 3QHWB 1PKDB 2W9ZA 3DOGB 4I3ZB 5CEIB 4BCPB 1AISB 2C5XB 1QMZB 1XO2A 1VOLA 3TNHB 2B9RA 1H1RB 3BLRB 3MY1B 4CFXB 1OKVB 3BHTB 2WMAB 1O9KB 3EJ1B 4FX3B 1JSUB 2I40B 4EOQB 1OKWB 4CFWB 1OL2B 2CJMB 2IW6B 2WXVB 1H28B 4RODA 4BCOB 2C5NB 4BCJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4M A;  2WMB B;  4EOS B;  3BLH B;  1F5Q B;  1OIY B;  3MY5 B;  4EC9 B;  2F2C A;  2W99 A;  3QHR B;  2WIH B;  4CFU D;  1OGU B;  2EUF A;  2BKZ B;  3MIA B;  1FVV B;  2BPM B;  4Y72 B;  2WIP B;  3G33 B;  2PK9 B;  1AD6 A;  1O9K A;  4BCQ B;  1URC B;  5IDP B;  1GY3 B;  1H4L D;  2UZD B;  2W2H A;  3H4C A;  3K7A M;  4CFV B;  4ROC A;  5IF1 B;  1P5E B;  5HBH B;  3O0G D;  2V22 B;  5CYI B;  4KRD B;  4CFN B;  4BCM B;  5L2W B;  3EOC B;  1FIN B;  1UNL D;  4EOK B;  2PHG A;  4F6S B;  5FGK B;  1VIN A;  1H26 B;  3DDQ B;  3LQ5 B;  5HBJ B;  4EOJ B;  1BU2 A;  5HBE B;  1H25 B;  2CCI B;  2WPA B;  3BHV B;  4YC3 B;  1H1Q B;  4EOP B;  4ELJ A;  2IVX A;  4OGR B;  4OR5 B;  4F7L B;  4F7S B;  4BCI B;  2G9X B;  4NST B;  2QDJ A;  1W98 B;  4KRC B;  2W96 A;  1D3U B;  1GUX B;  4BCN D;  2X1N B;  2R7G A;  3BHU B;  2UUE B;  5IDN B;  2I53 A;  4F7N B;  3POM A;  4ROE A;  2W9F A;  1OI9 B;  4IMY B;  1E9H B;  2UZB B;  5HNB B;  1OIU B;  1UNH D;  4BCF B;  4F70 B;  4F7J B;  4CXA B;  4CFU B;  1JOW A;  1H27 B;  3M03 A;  2C6T B;  4ELL A;  4F6U B;  1JKW A;  4EON B;  4BCG B;  4F6W B;  5LMK B;  1TFB A;  2WFY B;  1H24 B;  3TNI B;  5HVY B;  4EOI B;  1GUX A;  2UZE B;  4BCN B;  5I5Z B;  1H1S B;  3EID B;  3RGF B;  4EOM B;  4TTH A;  4UN0 A;  4CFM B;  2UZL B;  4CRL B;  2C5O B;  4EOR B;  4BCK B;  5EFQ B;  2WEV B;  2CCH B;  2PMI B;  4BCQ D;  1G3N C;  1VYW B;  1ZP2 A;  2IW8 B;  2JGZ B;  1KXU A;  2PK2 A;  2WHB B;  3F5X B;  4G6L B;  3TNW B;  1GH6 B;  2C5V B;  4EOL B;  5ICP B;  5HQ0 B;  1OL1 B;  3TN8 B;  3BLQ B;  4BCM D;  5ACB A;  4YOO A;  1UNG D;  4BCH B;  1H1P B;  4EC8 B;  4YOZ A;  5LQF B;  4YOS A;  2C4G B;  2IW9 B;  3MI9 B;  1C9B A;  1JST B;  4EOO B;  3DDP B;  4II5 B;  5BNJ B;  3QHW B;  1PKD B;  2W9Z A;  3DOG B;  4I3Z B;  5CEI B;  4BCP B;  1AIS B;  2C5X B;  1QMZ B;  1XO2 A;  1VOL A;  3TNH B;  2B9R A;  1H1R B;  3BLR B;  3MY1 B;  4CFX B;  1OKV B;  3BHT B;  2WMA B;  1O9K B;  3EJ1 B;  4FX3 B;  1JSU B;  2I40 B;  4EOQ B;  1OKW B;  4CFW B;  1OL2 B;  2CJM B;  2IW6 B;  2WXV B;  1H28 B;  4ROD A;  4BCO B;  2C5N B;  4BCJ B; 
#chains in the Genus database with same CATH topology
 1F5Q B;  4Y72 B;  2BPM B;  2KR6 A;  1O9K A;  5IDP B;  2UZD B;  3H4C A;  5IF1 B;  5CYI B;  4CFN B;  4BCM B;  1FIN B;  1UNL D;  3A8L B;  3DDQ B;  2IVX A;  4OGR B;  1V29 B;  2QDJ A;  4JX4 A;  2QGS A;  1D3U B;  4BCN D;  2X1N B;  3PO3 S;  5IDN B;  2UUE B;  3DJB A;  4F7N B;  4FM4 B;  5HNB B;  4F70 B;  2ZPG B;  4ELL A;  4F6U B;  1JKW A;  4EON B;  5I5Z B;  4CRL B;  2QQ8 A;  2UZL B;  4EOR B;  1QLB A;  2CCH B;  1ZP2 A;  1KXU A;  3TNW B;  2AHJ B;  3QYB A;  4BBS M;  5EJC A;  1OL1 B;  4BCM D;  4BCH B;  4EC8 B;  4YOZ A;  4YOS A;  3MI9 B;  2IN3 A;  1C9B A;  1JST B;  1PKD B;  2W9Z A;  3DOG B;  4I3Z B;  4BCP B;  1QMZ B;  1XO2 A;  3TNH B;  2BS4 A;  1H1R B;  4JX5 A;  3BHT B;  3EJ1 B;  4FX3 B;  1E7P A;  1JSU B;  1OKW B;  4CFW B;  1OL2 B;  2CJM B;  4QSH A;  4BCO B;  4EOS B;  3BLH B;  4EC9 B;  2F2C A;  3QHR B;  2BS2 A;  2DXB B;  3VKG A;  4NC6 A;  2WIP B;  3G33 B;  1GY3 B;  3K7A M;  3QWL A;  3KHI A;  2ZPI B;  4OB2 B;  4KRD B;  3EOC B;  2DXC B;  5FGK B;  1H26 B;  3LQ5 B;  4MFD A;  1H25 B;  2WPA B;  3X20 B;  3BG5 A;  4BCI B;  2G9X B;  4NST B;  2W96 A;  4AKG A;  1AHJ B;  2DPP B;  4M6V A;  4ROE A;  2CZ7 B;  1OIU B;  4BCF B;  4HNV A;  4LOC A;  3B57 A;  4CFU B;  3VKH A;  4ZGJ B;  4BCG B;  1UGP B;  2WFY B;  2CYZ B;  5HVY B;  2UZE B;  4ZGE B;  4EOM B;  3HB9 A;  4TTH A;  2DD4 B;  3DTO A;  3HBL A;  2PMI B;  1VYW B;  2IW8 B;  3HHT B;  4EOL B;  3F5X B;  3A8O B;  5ACB A;  4YOO A;  1UNG D;  3A8G B;  4EOO B;  5BNJ B;  1UGQ B;  2DD5 B;  3X24 B;  4BBR M;  2B9R A;  5IHY A;  4EOQ B;  3QYH B;  4JX6 A;  2LW4 A;  1H28 B;  1ENW A;  2ZPE B;  3QYE A;  5DQW A;  4AKI A;  4HNU A;  4BXX X;  2WIH B;  4CFU D;  3MIA B;  2EUF A;  1UGS B;  4HL4 A;  2PK9 B;  1URC B;  3BG3 A;  2CZ6 B;  4CFV B;  4ROC A;  2WJ9 A;  2KMG A;  4BY7 X;  5HBH B;  2V22 B;  5L2W B;  4AI6 A;  4EOK B;  2PHG A;  4F6S B;  1VIN A;  3X25 B;  3X28 B;  5HBJ B;  4EOJ B;  2QF7 A;  1BU2 A;  5HBE B;  2CCI B;  1H1Q B;  4EOP B;  4ELJ A;  4OR5 B;  4F7S B;  1GUX B;  4OB0 B;  2R7G A;  4Z6Y A;  3BHU B;  3QZ5 B;  2I53 A;  3QXE B;  3X26 B;  1E9H B;  2UZB B;  1UNH D;  3HZJ A;  4AKH A;  4CXA B;  1JOW A;  3TW7 A;  1H27 B;  2C6T B;  4F6W B;  5LMK B;  3QZ9 B;  1TFB A;  2PJQ A;  1H24 B;  4BCN B;  1H1S B;  1FKM A;  4CFM B;  3NDQ A;  4BCK B;  5EFQ B;  3A8H B;  2PK2 A;  1GH6 B;  2C5V B;  2ZZD B;  5ICP B;  3TN8 B;  4OB3 B;  2C4G B;  2BS3 A;  4MIM A;  1UGR B;  2DME A;  3WVE B;  3TW6 A;  3BLR B;  3MY1 B;  4CFX B;  3GTM S;  4MFE A;  1O9K B;  2I40 B;  2CZ0 B;  2G77 A;  2IW6 B;  3VYG B;  4ROD A;  3HO8 A;  5DQV A;  1N4M A;  2WMB B;  1OIY B;  3MY5 B;  2W99 A;  1OGU B;  1IRE B;  2BKZ B;  3QYG B;  1FVV B;  1AD6 A;  3WVD B;  4BCQ B;  1H4L D;  2W2H A;  4HLQ A;  1P5E B;  4OB1 B;  3O0G D;  4YC3 B;  3BHV B;  2QFZ A;  4F7L B;  1W98 B;  3VYH B;  4KRC B;  3POM A;  2W9F A;  1OI9 B;  4IMY B;  2QDY B;  4F7J B;  3M03 A;  3TNI B;  4EOI B;  1GUX A;  3EID B;  3RGF B;  4UN0 A;  2C5O B;  3BG9 A;  2WEV B;  4BCQ D;  1G3N C;  2JGZ B;  2WHB B;  4G6L B;  2CZ1 B;  2ZPH B;  3A8M B;  2ZCF B;  5HQ0 B;  3BLQ B;  3DL1 A;  1H1P B;  5LQF B;  2ZPF B;  2IW9 B;  3DDP B;  2D0Q B;  4BY1 X;  2ZPB B;  4II5 B;  3QHW B;  5CEI B;  1AIS B;  2C5X B;  1VOL A;  4ZGD B;  1OKV B;  4HNT A;  2WMA B;  2WXV B;  2C5N B;  4BCJ B;  1TD6 A; 
#chains in the Genus database with same CATH homology
 1N4M A;  2WMB B;  4EOS B;  3BLH B;  1F5Q B;  1OIY B;  3MY5 B;  4EC9 B;  2F2C A;  2W99 A;  3QHR B;  2WIH B;  4CFU D;  1OGU B;  2EUF A;  2BKZ B;  3MIA B;  1FVV B;  2BPM B;  4Y72 B;  2WIP B;  3G33 B;  2PK9 B;  1AD6 A;  1O9K A;  4BCQ B;  1URC B;  5IDP B;  1GY3 B;  1H4L D;  2UZD B;  2W2H A;  3H4C A;  3K7A M;  4CFV B;  4ROC A;  5IF1 B;  1P5E B;  5HBH B;  3O0G D;  2V22 B;  5CYI B;  4KRD B;  4CFN B;  4BCM B;  5L2W B;  3EOC B;  1FIN B;  1UNL D;  4EOK B;  2PHG A;  4F6S B;  5FGK B;  1VIN A;  1H26 B;  3DDQ B;  3LQ5 B;  5HBJ B;  4EOJ B;  1BU2 A;  5HBE B;  1H25 B;  2CCI B;  2WPA B;  3BHV B;  4YC3 B;  1H1Q B;  4EOP B;  4ELJ A;  2IVX A;  4OGR B;  4OR5 B;  4F7L B;  4F7S B;  4BCI B;  2G9X B;  4NST B;  2QDJ A;  1W98 B;  4KRC B;  2W96 A;  1D3U B;  1GUX B;  4BCN D;  2X1N B;  2R7G A;  3BHU B;  2UUE B;  5IDN B;  2I53 A;  4F7N B;  3POM A;  4ROE A;  2W9F A;  1OI9 B;  4IMY B;  1E9H B;  2UZB B;  5HNB B;  1OIU B;  1UNH D;  4BCF B;  4F70 B;  4F7J B;  4CXA B;  4CFU B;  1JOW A;  1H27 B;  3M03 A;  2C6T B;  4ELL A;  4F6U B;  1JKW A;  4EON B;  4BCG B;  4F6W B;  5LMK B;  1TFB A;  2WFY B;  1H24 B;  3TNI B;  5HVY B;  4EOI B;  1GUX A;  2UZE B;  4BCN B;  5I5Z B;  1H1S B;  3EID B;  3RGF B;  4EOM B;  4TTH A;  4UN0 A;  4CFM B;  2UZL B;  4CRL B;  2C5O B;  4EOR B;  4BCK B;  5EFQ B;  2WEV B;  2CCH B;  2PMI B;  4BCQ D;  1G3N C;  1VYW B;  1ZP2 A;  2IW8 B;  2JGZ B;  1KXU A;  2PK2 A;  2WHB B;  3F5X B;  4G6L B;  3TNW B;  1GH6 B;  2C5V B;  4EOL B;  5ICP B;  5HQ0 B;  1OL1 B;  3TN8 B;  3BLQ B;  4BCM D;  5ACB A;  4YOO A;  1UNG D;  4BCH B;  1H1P B;  4EC8 B;  4YOZ A;  5LQF B;  4YOS A;  2C4G B;  2IW9 B;  3MI9 B;  1C9B A;  1JST B;  4EOO B;  3DDP B;  4II5 B;  5BNJ B;  3QHW B;  1PKD B;  2W9Z A;  3DOG B;  4I3Z B;  5CEI B;  4BCP B;  1AIS B;  2C5X B;  1QMZ B;  1XO2 A;  1VOL A;  3TNH B;  2B9R A;  1H1R B;  3BLR B;  3MY1 B;  4CFX B;  1OKV B;  3BHT B;  2WMA B;  1O9K B;  3EJ1 B;  4FX3 B;  1JSU B;  2I40 B;  4EOQ B;  1OKW B;  4CFW B;  1OL2 B;  2CJM B;  2IW6 B;  2WXV B;  1H28 B;  4ROD A;  4BCO B;  2C5N B;  4BCJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...