2I45A

Crystal structure of protein nmb1881 from neisseria meningitidis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
96
Chain Sequence
ETINLKQHLAAIKEYWQPEIINRHGFQFHLVKLLGDYGWHTHSDKVLFAVEGDMAVDFADGGSMTIREGEMAVVPKSVSHRPRSENGCSLVLIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of protein NMB1881 from Neisseria meningitidis
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 16
structure length 96
sequence length 98
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2i45A00
5I8YA 1SFNA 3HT2A 3H9AA 2KXLA 4QXKA 1PM7A 1ZZBA 4HZFA 4MUVA 1YLLA 2GC3A 2HJIA 4XETA 5JSOA 4Q0SA 1ZREA 1DGWA 3CF6E 3KCCA 3SMHA 3WW1A 4IERA 4TLFA 1VP6A 2PHDA 3U10A 4EV0A 4FAGA 4I02A 4RD7A 4BH9A 5LEKA 4IEXA 1SEFA 1EYBA 3PNAA 4I0BA 5KBFA 3ES4A 2GC2A 3BALA 5C8WA 2VECA 3S0MA 2F4PA 1WGPA 3RYRA 3IDBB 2UY9A 4Q0VA 3MPBA 3ES1A 4HSLA 4IEWA 4A2UA 4UXAA 2XHKA 2V09A 5JSPA 3EQEA 4HBNA 4YSFA 4XFBA 4I0AA 5KHIA 1GQHA 4Q0PA 4F7ZA 3FWEA 1ZZ9A 5FQ0A 5FDBA 4MGIE 3I59A 4Q0UA 3E6BA 5KHJA 3LWCA 4I2OA 1ZNPA 3C3VA 1CAVA 4PIZA 2H6BA 4OLLA 1CGPA 3DKWA 3M3IA 5BUVA 5I91A 1QWRA 3CO2A 2IXLA 3RPQA 2DCTA 5E16A 1Y9QA 4N9HA 1ZZ6A 3OCPA 3KGLA 2PYTA 1VJ2A 4QGNA 1RL3A 4YARA 1NZCA 2D5FA 1XE8A 4JV4A 5I93A 1O3QA 2IXCA 4HLTA 1GQGA 3GYDA 1J3PA 1IPKA 1QXRA 3MZHA 3HT1A 5KHGA 4AQ6A 4O9EA 4AXOA 3U0ZA 3EHKA 1Q5OA 3HIFA 4ZU7A 2E9QA 5E1RA 4HN0A 3H7JA 4XFGA 4BIFA 2FQPA 4AQ2A 2IXIA 4O9GA 2VPVA 2P17A 1RGSA 4QM8A 4IETA 2B8MA 4Z82A 1UIKA 5KHKA 2D93A 2CAVA 2PAEA 5T3NA 1ZRFA 1DGRA 4LULA 1LR5A 4XF1A 2PQQA 1RTVA 3BU7A 2ZKLA 4LUMA 3NW4A 4H7LA 4MZUA 4HVOA 3I7DA 1OFNA 2C0ZA 3N4MA 3DN7A 4WVZA 4FAHA 3NL1A 4MV2A 3ELNA 2EVXA 2UY8A 1YFXA 4PJYA 3R6SA 4R8HA 3UKTA 4JTOA 4HVQA 3BB6A 1O3TA 3IDCB 2XL9A 4LEJA 1H1MA 4I01A 4ORFA 3DL3A 4D7SA 2B5HA 2GC0A 2OZJA 5JCTA 3RZZA 1YFYA 3LA7A 1ZRDA 1OD5A 4WBBA 2XKPA 3E5XA 5FQ0B 2PTMA 3I59B 3D82A 4Z07A 5LRRA 1CAVB 2QJVA 3UKNA 2EAAA 3QOPA 4DINB 3OTFA 1CAUA 2BGCA 4XEZA 2I45A 5I0SA 2XLAA 2QNKA 4QGLA 2OA2A 3D0JA 5FPXA 2B9UA 4YRDA 3U11A 5LEJA 2UYAA 3OD0A 1PMIA 1UW8A 3H1MA 5FCCA 3KSCA 3E6CC 5BY5A 1I5ZA 2WC2A 3HQXA 3EO6A 2CAUA 2ETEA 4QM9A 4GULA 1HW5A 3MDPA 1LB2A 1Q43A 4L2NA 4HSJA 4HVRA 2OYZA 1SQ4A 3LAGA 3RYPA 4MX3A 4EWAA 3WW2A 4L11A 3H3UA 3MYXA 1RUNA 5F1RA 1O3RA 1V70A 4MGKE 4KWKA 4XF9A 2ET7A 3ST7A 1ZX5A 1J3RA 4KWLA 4LLOA 4XF0A 1NE4A 1O5UA 2PHLA 4IEOA 4I09A 3G7DA 4HMZA 5J3UA 2D5HA 2N7GA 1XE7A 1ZZ8A 3M70A 2IXKA 3PLQA 3ETQA 5LRSA 3CLPA 4OFGA 1CX4A 1EP0A 1QY4A 2UYBA 4AVCA 3CJXA 3S7IA 1UPIA 1YFWA 3FJSA 1WA4A 3SCFA 3QACA 5I0RA 5I0UA 1LKNA 2K0GA 5FLIA 5BPXA 4EROA 3TNQA 2D40A 1OI6A 4WZCA 1NE6A 4QMAA 5KHHA 4Q0QA 3GBFA 5FLJA 1CAXA 4KWJA 2WFPA 3FE5A 4XFAA 5FLHA 2Q30A 4META 5C6CA 1YUDA 3UKVA 4LTAA 4KU8A 4NVPA 2BNMA 5K8SA 1ZRRA 4JTNA 5D1IA 4FBFA 1YWKA 2Z69A 4XF3A 3FX3A 1IPJA 5JAXA 2O8QA 3BCWA 2Z2SB 4Q29A 3CEWA 3DV8A 2QDRA 2GC1A 4XFHA 4MGZE 2Q1ZB 1CAUB 2XL7A 5JSRA 5CADA 1NXMA 1X8MA 4J1WA 5BV6A 2PAMA 4BHPA 2K9ZA 1O7FA 4MH0E 3LZZA 2ET1A 3TNPB 3H1YA 5CU1A 3VHRA 2IXHA 4IEZA 4BYYA 4K8FA 3WW3A 1I6XA 1X82A 1RC6A 3E5QA 3L2HA 1J58A 3IBMA 4J1XA 1X7NA 1UD1A 2Q4SA 3E97A 3O14A 4HN1A 1O3SA 1FXZA 4X6QB 5J48A 3EJKA 4IEPA 5AVPA 4AVBA 2OPKA 4IEUA 3KMHA 3NJZA 3PVBB 1UCXA 3BPZA 2PAKA 2PFWA 1DZRA 3H3ZA 4ZU4A 3H8UA 2XLGA 3IWZA 2XLFA 4UBGA 1VR3A 3ACLA 4CYDA 1J3QA 5J7MA 3NKTA 3H50A 2XKOA 3LA3A 4P9GA 2PA7A 3JZVA 2BNOA 2CV6A 3ZDSA 4D7TA 4EWDA 3FFQA 4AVAA 5FPZA 2XGXA 3FZ3A 3B02A 3CL1A 4IEYA 4MGYE 1CAWB 3NSTA 1QXJA 1ZVFA 3RDIA 4B29A 4IEVA 1X8EA 1EY2A 4PIYA 1RUOA 1CAXB 4X6RB 2VQAA 4ONUA 1WLTA 5I8TA 1ZZ7A 1OMIA 1NYWA 1UIJA 1YHFA 4XFFA 4KL1A 1ZZCA 2H0VA 3IIAA 4FT8A 3E6DA 2Q0AA 4YNIA 4QGMA 2EA7A 5JR7B 1O4TA 4ZU5A 1L3JA 1EPZA 2BNNA 3SCGA 3SXWA 3EBRA 3SCHA 4XF4A 5BXXA 1YFUA 5CVRA 1J1LA 4UBHA 2OZ6A 1CAWA 2H6CA 2BYVE 3LOIA 4YYOA 4E2SA 3NVCA 1ZRCA 3LA2A 4I3PA 2CGPA 2IXJA 3OF1A 4IEQA 2MHFA 2HKXA 3I54A 4QX5A 1XRUA 2QCSB 1U12A 4KU7A 4F8AA 3H7YA 3ROUA 5I8SA 2MNGA 1O5LA 3E5UA 4LA2A 4IESA 4LUKA 4XFCA 4E2GA 1TQ5A 2QVSB 1DZTA 1G6NA 5EFUA 5EZWA 2GH2A 1FT9A 2MPFA 1H1IA 1JUHA 1J59A 5HI0A 3USSA 3OGJA 2ZCWA 3WW4A 3SHRA 1FI2A 3FHIB 4N9IA 4PIXA 3H1WA 4JVAA 3RNSA 2IC1A 2GZWA 1Y3TA 2Y0OA 3RYKA 4XFIA 2FMYA 4LA3A 3KGZA 1LRHA 4E2QA 3S7EA 2BEOA 3D0SA 2GAUA 2GU9A 1Q3EA 5I0TA 4R52A 2ATFA 2O1QA 4EWEA
chains in the Genus database with same CATH superfamily
2JG9C 3KF3A 4OI0A 4YWAA 3W5MA 2WAAA 3H42B 4QXKA 2HWD2 4LLFA 1VPHA 3CNAA 2HJIA 5FMOL 2WT2A 5JSOA 1UU4A 1ZREA 2RR13 1H1AA 3K48A 3POFA 4AFAA 2FMDA 3S5AA 1YQ5A 5FYTA 5KXDA 2GNTA 3N9MA 1F35A 2G4IA 3CJIC 1GNYA 4BOWA 4FAGA 4I02A 1GU3A 5TSWA 3NNMA 1V6IA 1SMVA 1W8ZA 4IEXA 5FYSA 1BQPA 4BH9A 4C8DA 4YGEA 4EN7B 4K9SA 2Y33A 3R4SA 5L7OA 1JTZX 5JZGA 4CDWA 5C8WA 4BJ0A 1UOFA 2WFF1 4P9JA 2F4PA 4M01A 3S0MA 5L9VA 4XDPA 5ERLA 2UY9A 4YGCA 1CESA 1R091 2R062 2Y0IA 1S0JA 2VM9A 2VU9A 3ZKUA 3O1TA 4WVWA 4A6SA 3ES1A 2L9LA 4DMIA 5FO7B 4IDZA 1R1A3 3EQEA 5FKBA 2Y6FA 5FZ3A 4XFBA 4LO7A 2XHNA 1NCRC 4F7ZA 3NQHA 1ODNA 5ISLA 1IZ3A 4A6OA 4AEDB 2FDHA 4I3GA 2VBDA 4ASKA 3I59A 3LOBA 1AR72 5H9QA 1IG0A 2OS2A 2Q1MA 4KH9A 5BNNB 4FPKA 5EP9A 2JDUA 4I2OA 4PDWA 2PLV1 4QDSA 1CAVA 5B4XA 2H6BA 3BUCA 5FMOS 1FMD1 2VOTA 2RM21 4JC1A 4CA9A 5BUVA 3C8XA 1VBA1 1FYUA 1POV3 3KCYA 5DDJ3 3WQ1A 2D97A 3CO2A 3QH7A 2ZS6B 5FMBA 1ULGA 3RMXA 4BLIA 1QQP3 3OCPA 1PIV1 4Q4Y2 4HKLA 2NYYA 3VKNA 1QOSA 1OF3A 1F8VA 2D5FA 1TMF1 3MI8A 4FPCA 4ISRA 5GLZA 4JV4A 1H6XA 1KJRA 5BNOB 5CFCC 3BTXA 4BE3A 4IL7A 2IXCA 2GMPA 1SPPA 1UF2C 2XQXA 2E53A 3T2QA 1DQ1A 2XOMA 4TTGA 1C8M3 1QXRA 5FYZA 4MSVA 2JG8C 5EQUA 1N1YA 4M0HA 2SBAA 3HT1A 4B3NA 5KHGA 1QOOA 4DY5A 4LBOA 1LU1A 2C4XA 1QH6A 2JX9A 4AXOA 4RS5C 4HONA 1KXGA 3JU9A 4NPMA 1Q5OA 4M3CE 2GN3A 3HIFA 4ZS3A 3KQ4B 4JX0A 1RUI2 3PVNA 1V0AA 2FQPA 2HWC2 4AQ2A 4XMAA 1AR83 4Y4RA 2P17A 3OGRA 4A3ZA 1HRV2 4OUMA 5DPNA 2B8MA 5KXBA 1K5MC 3WDUA 4URAA 3WNLA 3MUY1 2B42B 1UXZA 5EV7A 2KR2A 3ECQA 4Y5SA 4XTPA 1I1EA 2PAEA 4PI0A 5T3NA 2RHPA 4ITCA 5CZKA 3D8CA 2ZBJA 1RITA 4QPIB 3VV1A 4DOUA 2PQQA 1RTVA 3BU7A 3HN1A 2WINB 3U37A 2ZKLA 1BBT1 1OPMA 1SLAA 1WLCA 4LUMA 4QU2A 3BIEA 3O1RA 2I07B 4XACA 1UZ0A 2WIIB 5C70A 3ZLIA 3N4MA 2VUDA 1ONAA 1QDCA 4GJYA 3VDDA 1LOEA 4MLOA 3WP5A 4LO8A 2NP0A 4FSJA 1YQCA 1FPN2 3WLUA 2DBIA 1BEV1 1QJFA 1RIRA 2WA4A 4B4RA 1VMJA 1B09A 3GCXA 3UGHA 4R8HA 1QH7A 4BDVB 3RRDA 4AI2A 3GZTB 1QJY2 1MS3A 3BB6A 1SCSA 2WNUC 1QKQA 3VBOC 3ILRA 4XJ8A 4QKDA 1O3TA 4Y1ZA 3MW2A 1WMFA 1H1MA 1VBE1 5JLVA 2QZ3A 4FVVA 2BDRA 2P6CA 5FPUA 4Q4W2 2XVKA 4QPGC 4D7SA 2B5HA 1WBLA 1LCLA 2WSUA 4RR3C 5A6ZA 3VGIA 4YFZA 3VBSC 1MS8A 1NKGA 2ZAHA 3CMGA 5FZEA 3T2PA 4QX3A 5KC6A 2OT7A 2D3PA 3U07A 3WQBA 3VZJA 2WZR2 4YZ1A 5FZFA 1OXCA 2NMOA 1W6NB 4LR4A 1GZWA 1QJU1 3U4SA 3ZPOA 1O4YA 5A7PA 3ZM8A 3DKQA 4W6WA 5FPLA 1BZWA 1L7LA 3JB8A 3I2KA 3VZLA 1WLWA 1ST8A 1EUUA 4LE4A 1XNCA 2QJVA 4QX0A 4M3CA 2WL1A 1VE0A 1S0BA 2EAAA 1XOYA 2JDHA 3ZIWA 4HT1T 4Q1RA 3V64A 2D6NA 4DINB 4YVSC 2BGCA 5GLWA 4CP0A 2GP5A 1AHSA 4WM7C 4CDQC 4FPJA 3Q8EA 4FP3A 4AFDA 1GFF2 2AZ5A 4DIQA 3GF6A 3D0JA 3WP3A 2B9UA 2PHXA 5FPXA 2JDAA 5HCBA 3JBG2 2VXJA 5DN2A 3WHTA 1ND3A 1YEWA 3O0VA 3OD0A 4JGYA 2UURA 3VHOA 2VUCA 4AHZA 1W3VA 3DPRA 1TME1 2GMMA 1I5ZA 4QWNA 4W6XA 5LA0A 2AEZA 3J7LA 3IDAA 4L9BA 4QM9A 4GULA 4HFSA 3VL9A 4D69A 2RS33 5B4NA 1OH3A 4G9SB 4PBOA 1ZRIA 2CHHA 1XNKA 4JKKA 2HH9A 4YFWA 3RYPA 5GLVA 2VOXA 1ULPA 1OURA 1WW6A 3AKQA 3H3UA 1UN1A 1W0NA 4E4SA 3N9QA 1AXYA 1PO21 1PK6A 5F1RA 1O3RA 1RUNA 3AKRA 1HRI3 2HWE3 3VBRB 5IVCA 1PVC2 1S0GA 4CCEA 1OA4A 3MV01 1NLSA 4OZOA 5JXHA 3ZXLA 4YM1A 4TXWA 5FZCA 2ZHMA 3TN93 5JUVA 4KMQA 1XC6A 4LLOA 2YGMA 1O5UA 4N53A 2PHLA 4IEOA 3LD8A 2BW8A 1ASJ1 1PZ7A 4CP9B 1YI7A 2ARCA 1H2KA 3ZYHA 5A33B 5DUVA 5EHDA 2WZEA 3KV4A 1SDWA 2O0OA 4NE9A 1LOCA 4BISA 2V5DA 1QNYA 2WNEA 5DUXA 3MF6A 5AC92 5IVJA 5J1XA 4OCTA 4E8DA 5GZEA 2YC0A 3FLPA 2TEPA 3OY8A 1GMMA 4UF0B 2ZMKA 1XU2A 1CX4A 2VZRA 3MGUA 2A3WA 2TUNA 4QQPA 5FPBA 2AH2A 2Y6GA 3R4DB 1RUF2 3S7IA 4CPBA 1CN1A 1UPIA 2EICA 1LHWA 2WFF3 2DVAA 2K0GA 1KRIA 3I8TA 4XXPA 5IVYA 2TNFA 5BPXA 2D6KA 3H8OA 3O5SA 1D2SA 3AZZA 5JXGA 1R093 2WNVC 3PTRB 5FKCA 4LO6B 1JHNA 3M3OA 4CCNA 4EN8B 3GBFA 5FUIA 2QQKA 1Z7S2 5A3OA 1PNFA 1OF4A 4KWJA 3AXEA 3FE5A 5FLHA 5F3CA 4META 3VUOA 3UKVA 4LHKA 4Y20B 1PHMA 1MR5A 1RUJ2 2DTWA 4GA9A 4NVPA 3RMYA 3N9OA 4L8QA 3I2DA 4IXLA 4YVWB 5IW0A 3VKLA 4FPGA 4XOGA 3AMPA 2QQPA 1IPJA 1TNRA 1IGOA 4Q4V1 5CFDA 5FJKA 3K51A 3TRSB 1FAYA 4ATFA 2PXJA 4AL9A 5DZFA 3CEWA 4K20A 1JH5A 2R0FA 5F5CA 5L7OC 4FPOB 3NAPB 5F37A 5JZGC 4CDWC 1UX6A 2ZTNA 3N7JA 5FP9A 2WWJA 4FPLA 4GZ9A 1TMF3 1CAUB 4IV1A 2RV9A 5JSRA 1VBD2 1X8MA 2QQWA 3JUUA 4Y26A 1DP0A 2JD9A 5LCWL 1U5ZA 1W90A 3FFZA 5C7GA 1F2NA 4BHPA 1X9TA 2C26A 2DCJA 2K9ZA 3MLKA 4GAZA 4Q4X2 1XBFA 4Y33A 2HBUA 3H8RA 2QQUA 5LWBA 4GB33 2WYFA 3ZXEA 4WM8A 4GD4A 3H1YA 5F5QA 5J37A 1NLRA 5FWJA 1H0BA 4Y1XA 3FMGA 1A8DA 3GHMA 4I0WB 3VHRA 4UW3A 3L2YA 4LPLA 4E27A 3ZYIB 5FZIA 5GKAC 3E5QA 3W5NA 1R081 1JOPA 3I4IA 4PDWC 1YYNA 3B9IA 5G04L 1X7NA 2JKBA 4KNCA 4NROA 3HN3A 5CKNA 1CPNA 4Q27A 4M00A 2J1AA 5FMCA 3SISA 3E97A 3BPSA 2JDNA 3ON7A 1S0IA 5KXCA 5C9AA 3SHRA 5D21A 4YM2A 3WINE 1YC61 2HWF2 4X6QB 4LHSA 5EJ3A 2HEWF 5JPMB 2WO1A 5AVPA 2ENRA 4HG6B 3BVCA 5EYYA 1BBT3 2DURA 4Q8KA 1MS4A 2VCCA 3PVBB 3INAA 3ZXKA 2A6VA 1DZRA 4COYA 5K0UB 2JICA 1F5JA 3WDXA 5D8AB 2JKXA 3IWZA 2VY0A 4Y5Z0 4E4DX 3TEWA 2UWAA 2XWJB 1NY71 1G86A 3ZKYA 1NUKA 1BEV3 1CQ9A 4IE7A 2JG9A 3AFGA 5IT6A 4LITA 5JXJA 3OUIA 2DVGA 4LMFA 1REDA 2XQRA 3H50A 3N7LA 1J83A 2V4VA 5FOJB 1O8PA 4X8NA 1GZ9A 1F31A 3WT3A 4BZ4A 5A3UA 3JZVA 4GJZA 1Y43B 2YXSA 1C1LA 4D7TA 3U4XA 5HPOA 1NZIA 1DYOA 1NCQB 4GKYA 2F6BA 2RMU2 3D3AA 1VBE3 2XGXA 2EIEA 1VMHA 2E31A 2QQJA 5FY0A 5JXIA 5M0TA 5F5IA 1RMU1 2XBO1 5FJHA 1AX0A 4MGYE 2QE3A 1H9WA 2WT0A 2VW2A 5ANQA 1CAWB 1KS5A 2OW4A 1ZVFA 3NSTA 3MLLA 1S55A 4LKFA 1RUD1 4XAAA 3WG2A 3ZN6B 1EY2A 1CAXB 4ZZ5A 5F8PA 1W2TA 4X6RB 5J09A 3OOXA 4Y4YA 3UL2A 1WLTA 5DUUA 2YBKA 4IV3A 3VDDC 1ZZ7A 1SDDB 2BWCA 1OMIA 1AYM2 1NYWA 1QJU3 1ZZCA 1VRBA 2H0VA 3IIAA 3E6DA 4ZS2A 4XAEA 2EA7A 3AP4A 3B7MA 4QXCA 3U14A 4UT5A 2DF7A 5JR7B 2GDFA 2GP3A 3HWJA 2RS52 1EPWA 4YG3A 1L3JA 3FLRA 3WD5A 2ZEXA 3ZXJA 1JU3A 3SCGA 5FYBA 3SXWA 4V2VA 1IS3A 2LTNA 4TLGA 1IS4A 1UY1A 3RZGA 2CTVA 5LA2A 1YFUA 2RR11 4UBHA 1LENA 5FMDA 3ZMNA 4CCDA 1RUE2 2X5IB 4GMP1 4XHBA 3H8XA 3A0NA 2ZGKA 2VTFA 2P3JA 3IB3A 1A8MA 1CJPA 2JWPA 1OFSA 4XILA 1TME3 2P1BA 2UU8A 3NNGA 4JHZA 4XYXA 3VZOA 3UETA 5ACA1 4R4ZA 3NKGA 5F5AA 2XJSA 3I54A 1T2XA 2J7MA 4X8PA 5BNPB 2QCSB 1ND2A 1N1TA 1SZBA 5T5JA 5FK7A 1OPOA 2ZGNA 4KU7A 3CZUA 3AYCA 4CDUA 1JZ5A 5T5LA 5CFCA 3WQ0A 4BQXA 2ZACA 4IESA 4NN0A 1REEA 4XE9A 1T6GC 3ZIXA 1W8HA 4DNYA 5FP7A 2HWB3 3MEPA 3O12A 3ZN5A 1DZTA 1G6NA 1OT5A 3OUHA 1V6OA 3J9SA 4A4AA 2VOVA 2D6MA 3R0RA 4XW3A 1DG6A 4CXYA 2W94A 1UZVA 1TE1B 2WQZC 4UFKA 1FT9A 3A7QA 3WF2A 1JUHA 3ZR6A 4QPWA 5T52A 3LSEA 3OGJA 4AVTA 1LHVA 5GM0A 1W2NA 1Q56A 1ASJ3 1FI2A 2OIIA 2A6ZA 1GLHA 3I2IA 3AP7A 3QH6A 4N9IA 1ND3C 4JGYC 4JVAA 1CZTA 4RN5A 4NIIA 4CU7A 4CDXC 2IC1A 3UGFA 5L73A 2CDPA 2R6QA 4FOYA 3DPRC 2D6LX 4PI2A 2VVEA 4XFIA 1Q8QA 3KGZA 4L99A 4CUBA 5DABA 3LSDA 3D0SA 2BPA2 1OC1A 3VZKA 3ZYBA 1VLNA 4LBQB 2SLIA 3M8LA 2A73B 2C6SA 5CYYA 1JZ3A 3O1MA 1EAH1 2E7AA 2UWCA 4UI9L 3KHBA 1D4VB 3J8F1 3AP6A 4L97A 4ZONA 2YDEA 1PMJX 3VZNA 4NRPA 3ZFFB 5I8YA 1JZ6A 1H2MA 5F39A 5C8CB 1UZZA 1PK6C 2ADEA 3IMNA 3SEEA 5FZ1A 4LORA 1DGLA 1PM7A 1US2A 3LEIA 4HZFA 2GC3A 4KGQA 4MUVA 5KR7A 4Y5TA 1MPXA 5GLUA 3WDVA 3SMHA 4N7IA 3RWKX 1UKGA 3M7AA 2D98A 1PGL1 2D43A 2BFUL 2ZABA 4N53C 4RSUA 1R1A2 2BV4A 4JZRA 3U10A 1UY0A 3KZ4C 4EV0A 5LEKA 1WMDA 1B35A 4DUVA 3PNAA 4NUBA 4K21A 3C2UA 3VBFA 2GC2A 4IE0A 3BALA 1Q8SA 2VECA 4BK5A 4K1ZA 4F83A 4HK9A 1WGPA 2B9VA 3RYRA 3Q8AA 3AYAA 2E7TA 1JUIA 3APBA 3Q8BA 3OBZA 4MVTA 4Q0VA 2VUJA 4Q4V3 4QPGA 1LAJA 1QIQA 4UW4A 2BU9A 1XQNA 3CU7A 4IEWA 4ASMB 4DRVA 1W39A 3GM8A 5DDJ2 4A2UA 4RR3A 5CG9A 3POJA 2WZPP 5FOBB 1QQP2 2V09A 5JSPA 2O14A 3MV11 3N9NA 4YSFA 4FXGB 1SLLA 4CUAA 5FXVA 3OSDA 4DXRA 3ASIA 1GQHA 4Y3OA 1E5SA 1HB1A 4Q0PA 1SPPB 2Y64A 3EXUA 3FWEA 1MZFA 1N3OA 4JRLA 4AEDC 5C3OA 1ZZ9A 3SITA 5CAZA 3LDBA 1WW5A 5FDBA 5FYVA 1C57A 1G7YA 1LGBA 5CBLA 3MIBA 3KV5A 3T0DA 4M3CF 1C8M2 4PIZA 1OUSA 2CWSA 2R1DA 3NNLA 4DQAA 3DKWA 3M3IA 1CGPA 1OKQA 2GNDA 1KEXA 4FOWA 3LDKA 3JQXA 4R9AA 5I91A 3B00A 1UYXA 1QWRA 3TYJA 4GWNA 2IXLA 4H2AA 4BM8A 3V0BA 4CDQA 1Y9QA 1ZZ6A 5JMCA 3KGLA 3B3QE 2BFUS 1VJ2A 2K2SA 4QGNA 3TOJA 3UJQA 5LY2A 4YARA 5IFTA 4FFGA 1AR82 1D7PM 1R083 1QGLA 5A3WA 1S2BA 4JKLA 2KD7A 2WSVA 2AGSA 3AJZA 2IFWA 1UU5A 2Z4FA 5FZAA 4N43B 4GQ7A 5FYIA 1GQGA 2TBVA 3RS6A 4DZGA 3MZHA 4B1MA 4QQLA 1VAVA 2YBSA 3POSA 3VL8A 3WF3A 2ORZA 3I2FA 4KG8A 2VO5A 1CX1A 4LT5A 2XJTA 1R1ZA 3AP5A 4ZU7A 3TBDA 3PVEA 5HBAA 1XSQA 2QDNA 4O9GA 4A7YA 1VRH1 4B7KA 4NHMA 3POWA 2W92A 4QM8A 4CCCA 4IETA 1ENRA 3IDEA 1CJDA 2Z5WA 4B7EA 1FATA 3QLQA 5AVAA 4DS0A 3POYA 2ZMLA 1GV9A 5F6LB 5FZOA 2D93A 2CAVA 5EYXA 3VHPA 1DGRA 3VLBB 1JYCA 4OHVA 4QPIC 4XF1A 3MIDA 2DCYA 5FBJA 4OQ9A 3OBAA 2BP6A 4RA0A 5GZCA 4D6RA 3ENRA 1SHWB 4OMDA 4XBNA 1VBC3 1DCSA 3WUDA 1G9FA 1MS1A 1NLQA 3M3CA 1ULFA 4MZUA 2RVAA 3ATGA 3I7DA 3ZFEC 4GMP0 5A6QA 5C9AC 2XH6A 1YXWA 2RS31 1W2UA 4FAHA 4JKMA 1CZVA 2WLQA 1NA1C 1RMU3 3NL1A 5LBFA 2XBO3 3ELNA 1JODA 1W6PA 3AMQA 5FY9A 3PUAA 3NV2A 1RUD3 1H2NA 2HWE1 3MBWA 3HQRA 2VMEA 4NHKA 5IVVA 2WN3A 2J1SA 4HVQA 4RL7A 3NJVA 5C4WB 3IDCB 2XL9A 4LEJA 2WNVA 3ZSKA 1DGWX 1NXD1 4Y1VA 3GXUA 1FOD1 4I01A 1D4M1 1ENQA 5CISA 2DBNA 2GC0A 2OZJA 2FBEA 2NMNA 4A7ZA 5HXVA 2E32A 5T55A 5FZBA 1BVVA 3NV3A 3O1SA 5A3NA 2J1UA 2AACA 2R061 3ZSJA 3LIGA 3K4AA 1OLQA 2JIGA 5FPAA 3RFRA 3HJRA 4GMP3 4RGKA 4WBBA 3RZJA 1D0HA 3VDAA 4CCOA 1UPSA 1LGCA 2Y8KA 3E5XA 5FQ0B 5H9SA 3NWKA 1OQEA 3D82A 4PQ9A 3SH5A 1SFYA 2R30A 4RQPB 5ACA3 3AX4A 4EN6B 3UKNA 1S2EA 1C8NA 1AR71 2JDMA 3UV9A 3AZVA 1CZSA 2E26A 4XEZA 4IV3C 1APNA 1H8VA 4P02B 1AR92 1XNTA 4KQ7A 2QNKA 3RI8A 4PF5A 3LKJA 1VB4A 1HRI2 4AAPA 3GNEA 4YRDA 5T5PA 1UMZA 3U11A 2W0XA 5LEJA 4AWDA 5FFOC 1GZCA 3H1MA 2KA3A 5KXEA 3E6CC 3B93A 5BY5A 1RVF2 2E33A 4C1XA 2ZA9A 3TN92 4UFMA 1L7QA 2ETEA 4H3WA 5GJ6A 2ZPXA 2FCUA 1SCRA 3KCXA 2OYZA 4HVRA 1JBCA 4Q8LA 4CU8A 1G9AA 1W3XA 1SQ4A 3V65A 2OQ6A 3IAPA 1RHI1 5LBCA 3OY8B 2XJVA 5A7WB 1RUH1 5FP4A 4XABA 2VMGA 1K12A 1V70A 2W95A 4MGKE 5B2GB 4BLJA 1SBFA 1URXA 3JB4C 4XF9A 2WS93 2MEV1 2R071 1BVP1 3VKMA 5IHRA 1ND2C 1W8WA 4QQHA 1F9KA 1EAH3 2LW8A 3ST7A 4CDUC 1OVPA 3J8F3 4BK4A 4XF0A 4OUEA 3VBUC 3S30A 3WNNA 2ZGLA 5ABJC 4YGDA 3KHCA 1L7RA 3G7DA 4HMZA 3BTAA 4DB5A 3OBRA 4Q1PA 4BXFA 2O8OA 2C9KA 4H14A 1FV2A 4GB31 2VMHA 4Q5OA 4A42A 3DGTA 1IKPA 3N35A 5FUNA 3M70A 2XONA 1ENXA 3PLQA 4GWJA 5L36A 2BWAA 4MHRA 1UZWA 3D5OA 1UMIA 2DVBA 4HPKA 3ZO0B 3BU0A 4SBVA 3AKTA 2RS11 5CFDB 4OHWA 1DYPA 1LGNA 1YFWA 3URFA 1HV0A 1FPN1 3QACA 3SH4A 3O7OA 4U2AA 1BKZA 5I0UA 3UYJA 1PGW1 1XNDA 2PLV2 2WQ8A 4AEMA 2EIBA 5HV4A 1KFXL 2D40A 4ZPIA 1FMD2 4YW3A 4WZCA 1DF0A 2RM22 4WV8A 4D3WA 1VBA2 4IV1B 3UK9A 2ZX2A 1GUIA 4HXCA 4S2DA 4LE3A 4YM3A 2LM3A 3M3QA 2FD8A 1PIV2 3VBHC 1UMHA 3ZR5A 1TMF2 2Q30A 1GZTA 5AFEA 3AZXA 5BNQA 3ZXDA 4W6YA 1OOPA 3DYMA 4WM8B 2YZ4A 3MF9A 3J4UH 4LQRA 3WUCA 4OQ8A 5D1IA 4PLOA 2Z69A 3B9CA 4XF3A 2EXKA 5FY8A 2X09A 5JAXA 2WZR1 3SKVA 1IS6A 3LPGA 3BCWA 1B35C 4Q29A 3K77A 4WVMA 2EIDA 3R05A 1WD3A 3VBFC 3NAPC 5A32B 4AFMA 4XFHA 1CONA 1XU1A 1Y9MA 2YROA 1GICA 3FBYA 3HBKA 4JDOA 4P9LA 1NQJA 4ISQA 4NWWA 1RJ7A 5FXXA 4J1WA 3ILFA 1QJZA 1C5HA 1D0GA 2B46X 5L9BA 2J1VA 5A7NA 4IE5A 4DO0A 3ZSMA 3KT4A 5C33A 2FDGA 3I3MA 5FO9B 5FPVA 4TWTA 2QTWB 4QXBA 2FHRA 1ZA7A 3TNPB 4GALA 1XYNA 1YQ6A 5CU1A 1BLZA 5AFBA 2Q8DA 4PBPA 1WCSA 3BOWA 4PCRA 3A0KA 1W8NA 3OEAA 2B4KA 1BBT2 4K8FA 1D2QA 4BYYA 1RC6A 4QB1A 3W21A 2VGDA 4BCUA 5F9TA 2ZGUA 1OD3A 3KVAA 1KS4A 3ME2A 2HLEA 2VOWA 1VRH3 4GH4A 4LO5B 1OLME 1PX4A 2K46A 2P6HA 2XMLA 1LOFA 1W6OA 1H30A 1XYPA 1UD1A 2GSYA 4QB2A 1COV1 2P3YA 1CD3G 2Q4SA 3DUIA 5H9RA 3WEZA 5A70A 3TEZA 3O14A 5FZ4A 4ZHNA 4HN1A 5EPAA 4IE6A 1STMA 3CIHA 2OUHA 1OLRA 1YI9A 3DEMA 3U78A 4AEJA 1G9BA 1VAMA 1O3SA 1GP4A 4EQVA 4IEPA 3ZYPA 1OBNA 4JGZA 3HAGA 3TB0A 4CEWA 4XHXA 4U36A 4CDXA 5FIXA 4AFCA 3CJIB 3VKFC 5LBEA 3NJZA 4F3JA 1UCXA 3A23A 4XPVA 3C7EA 3ZMOA 1AX1A 1VBE2 5A80A 4MGSA 5SV5A 3RGBA 3ZXGA 3H8UA 4UBGA 4XXAA 3OPZA 4AHWA 2JECA 4JQRA 4MXWB 5E6HA 2ZX3A 3ACLA 3GGLA 2EIGA 3PMEA 4AGRA 3N7KA 3WG4A 2HWB1 1BK1A 2XKOA 1AXZA 5LA9A 4D0QA 2PA7A 1C4RA 1MS0A 2CV6A 1QJU2 4R4XA 5LASA 3ZDSA 3AKPA 1YRZA 2XJUA 2Z42A 5F32A 3FFQA 5GZFA 4Z1VA 4EZ4A 3MIFA 2JDKA 3OGVA 1NCRB 2XXZA 1C28A 1FOD3 1SLCA 2C5DA 3B02A 3CL1A 1D4M3 4BB3A 1AF9A 3RI9A 1DYKA 3GJBA 3RDIA 4HK8A 4B29A 3C7OA 2WABA 4BIOA 1HIXA 4IEVA 1X8EA 4PIYA 5LZ6A 2VQUA 2R063 4W50A 2BVVA 2W87A 3MFAA 2J1EA 3LDRA 4ONUA 4XUTA 5A3TA 3PIGA 2FDIA 4CEYC 5FYMA 4XFFA 5A7OA 2E51A 4NOTA 5T5OA 2QQMA 4FT8A 1HX6A 1TME2 2QKDA 5JOZA 3HQUA 5E88A 2RDSA 1IPSA 5L9RA 1AR73 2KM2A 2BNNA 3R4UA 3SC7X 3P1IA 3WNMA 4AEDA 5HCHA 2Q8EA 2JG8B 1OLMA 4UYBA 1J1LA 5CVRA 1X9PA 1W0OA 1PO22 5IK7A 3GHNA 3AYEA 3NNJA 2LRPA 4LK7A 4RHV1 4RS5B 4YG6A 4W65A 3RVHA 5JPNB 4QX1A 2HYXA 5H9PA 3ZXAC 1SLIA 2QUOA 5F3IA 5IVFA 1K5JA 5HCFA 3ZOIA 3WF0A 1VBD1 2R0HA 2CGNA 2QQOA 1KITA 4GXLA 4BQYA 5F3GA 3M2MA 3TEXA 4QX5A 3N9LA 4XUOA 4Q4X1 3BKZA 4FPYA 2LUWA 1ASJ2 2D3RA 1K5MB 2CWMA 1OHFA 1GOHA 1RHI3 5I8SA 2IUWA 1O5LA 1OQDA 2BJSA 2VULA 4M0NA 4ZXKA 4HKOA 3ZVXA 1RUH3 1QU0A 4QB6A 1JOJA 1UYPA 2W5FA 3PVOA 4YW5A 4MOAA 4DFSA 1W99A 2VZUA 1TQ5A 4BQWA 3AJYA 2MEV3 2R073 2VMDA 5CNAA 3N3HA 4EYUA 4A7KA 3WF4A 2ZX0A 1H1IA 5A7SA 4FP2A 3IPVB 1ZBA1 3USSA 4Z92B 1VBB2 3ZFGB 2ZCWA 2JB4A 2VBBA 4O65A 3WW4A 3RG0A 2CL2A 1MZ5A 4AR2A 1E5RA 3H1WA 1O91A 3AZYA 4WZFA 2XUMA 2RE9A 4CTEA 4AVVA 4D6SA 3KVBA 3J7NA 1OQ1A 2Y0OA 2XJRA 1BMV1 1JU4A 1LRHA 1OA3A 2VCAA 4LXLA 2ZX4A 5FREA 1S0FA 2GU9A 2WNUB 5I0TA 4R52A 3VBOB 1UOJA 1JHJA 2QBXA 4QPIA 3VB9A 2BUKA 3POIA 4GWMA 3WG3A 1RXGA 3HT2A 4AI1A 1W6QB 3H9AA 3WX5A 1E5IA 5FYCA 4QPGB 1W9TA 2RS13 2AR6A 1PM4A 2VZTA 5IVEA 4URTA 2ERFA 1FPN3 3ZFEA 1ZZBA 3V0AB 4RR3B 1WKYA 3AVSA 3VBSB 3W9AA 3SEPA 1GANA 4W4ZA 3KCCA 1JZ8A 1NA1A 3WW1A 3LEGA 2WO2A 2ZZJA 4GKXA 4IERA 2JENA 3UT0A 2D7FA 2A6YA 3HBZA 3ACFA 3PUHA 2PHDA 1XB9A 2OKXA 2JDYA 2VUAA 3FBMA 5DAWA 1U0AA 1UQXA 2VNVA 4RD7A 2VBPA 4AI0A 5IYYA 3MICA 2BOIA 2YGLA 5KBFA 5FZGA 1W9WA 1NQDA 4PHZA 1V00A 5IK8A 1IQDC 4JQTA 2WZ8A 3LB9A 2NLRA 1XYOA 2PN5A 3IDBB 4YVSB 4AHYA 4YGBA 3V0BB 4WM7B 4CDQB 1PO11 1A3KA 5LW9A 1Q8PA 2GALA 3MPBA 2WZR3 2F17A 2W91A 4BMBA 2AYHA 1MVQA 4LIVA 3N36A 1TZOA 1VBC1 1AYM1 4QU1A 5LY1A 1HKDA 4HBNA 5KHIA 3Q8CA 2VVFA 1FNZA 4MO3M 1REFA 1W6NA 2R1BA 4NAMA 3ETPA 4R9CA 3KB5A 4Y24A 3FHQA 4MGIE 2CYFA 2DU0A 2DUPA 3FUOA 3I2HA 4OHYA 1SLBA 2AENA 1R64A 1ZNPA 4BQ5A 3KQRA 3C7HA 3VD5A 1W9FA 2R041 1LTEA 1A6CA 4OLLA 1RUE1 1JYNA 1H8TB 3T4VA 1ZBE1 3RPQA 2DCTA 2VZVA 5E16A 4N9HA 3MPPG 2V72A 1OVSA 1OOPC 1IQAA 1RL3A 5DXDA 3VDBA 5FWEA 3AL6A 1RINA 5FZDA 2XPJA 4XDQA 5I93A 3A21A 1DQ6A 3AM2A 4K6BA 4QHBA 3T09A 4FXKB 4RHV3 4D94A 1O3QA 1COV3 3I3EA 3GYDA 3NNFA 3OB8A 2Y6LA 2IVIB 2F4LA 3O1PA 1JYIA 1JYXA 1NG0A 1QJX1 2PHWA 2JIJA 4AQ6A 3BTZA 4YG0A 4NIAA 4CE8A 4M4RA 5A3PA 5EWSA 2C9AA 1PVC3 4HN0A 1AYN2 1MZ6A 3H7JA 4XFGA 3WSOA 4B4PA 2WWSA 3VBRA 3OGSA 1GWLA 1W6PB 2PELA 1K45A 2VPVA 3NV1A 1N1SA 2RG4A 4QD2A 1RMU2 5FY1A 4CUGA 1JYVA 4Z82A 2XBO2 4LO4B 3Q8FA 3JD71 3PUQA 1OSGA 1MEC1 3VBUA 5KHKA 1RUD2 3JQWA 4XJ9A 3TEYA 3V56A 5ABJA 2WNVB 4Y22B 3ZYJB 2NQYA 5A33A 3O1UA 1TG7A 2GN7A 2PHRA 2VOKA 1UU6A 4GH4C 4LBQD 3U75A 1DBNA 4CU6A 1LOFC 1W05A 4G4FA 4NMIA 3PHMA 1U5YA 2WRAA 3IT8A 5FRAA 2C0ZA 1V9U1 4JDNA 3NMBA 3DN7A 4UF0A 5F6KA 3T0AA 2ZGRA 1W6MA 2PMWB 5C3SA 1CWPA 4JGZC 2EVXA 4CEWC 1AJKA 2UY8A 3CBNA 2XUEA 4LKSA 1YFXA 4PJYA 3R6SA 2RR12 2VZQA 1HJGA 4B4QA 1LOBA 1MQTC 3KV6A 2A71A 4YZ2A 3UKTA 4JTOA 2P37A 2WS91 3DXTA 3E1F1 3GDBA 1AVBA 3HNYM 1PZ9A 2ORXA 5L7OB 4Z2AA 5JZGB 3HNMA 3AMNA 4CDWB 1ULDA 4IGPA 1GBGA 5JOYA 4YPJA 5FUPA 5ACA2 5FZ9A 4OHXA 3DL3A 1N47A 2BZDA 3IMMA 2A3XA 3VD9A 1YQ8A 2CGOA 3VBHA 5DUWA 1ULEA 2YUEA 4Y20A 3A22A 2YBPA 2Y26A 2QQNA 4PQQA 4FTEA 3LA7A 4H7MA 2JD4A 4OVEA 5FAXA 4CP1A 2W2IA 4YVWA 4A44A 4FTBA 1S0EA 3I3BA 4NHXA 4AQSA 1UAIA 4Y1UA 3I59B 4LBLA 1V6MA 2QQLA 5CIRA 4Z07A 5LATA 4CXWA 5LRRA 3MFCA 1VBD3 3HNBM 2ZXQA 4PDWB 2J1TA 1CAVB 3NAPA 4NWVA 1XJAA 3CKHA 4Q4X3 1CAUA 1WCQA 2IWGB 5I0SA 4KBBA 2DWRA 3FUQA 4AG4A 1HLCA 1EV11 1EUTA 3W20A 1GOFA 1WUVA 4NIGA 2UYAA 3JXSA 3OUJA 1PMIA 1UW8A 4XBLA 3KLSA 1UWWA 3KSCA 4OUSA 2OQ7A 1H9PA 4XUQA 3HQXA 3EO6A 1JYWA 1EAH2 4QKNA 4YW2A 3J8F2 1HXS1 3DF0A 1HW5A 1HN0A 5FZHA 1ZBA3 4ET7A 5DAVA 3S57A 2JDPA 4L2NA 1LB2A 4FOVA 3A4UA 2ZZQA 5BNNC 4YZ3A 1X36A 4CCJA 2NM1A 3LAGA 1CIWA 5FYUA 4EWAA 5FO8B 3T1MA 4PLNA 2EALA 1KQRA 3MYXA 3ORJA 2CNAA 2VJXA 3POGA 4KWKA 5IAVA 3ZYFA 1QXPA 2ET7A 4IUGA 4QHOA 2I2SA 1GP5A 1T6BX 3LF7A 4QPYA 3WNKA 4FPEA 4QKBA 1J3RA 4QT6A 4KWLA 4ZKTB 5BNOC 1NE4A 1TEIA 4R9BA 5KWRA 3T0BA 2ZMNA 5J3UA 1PNGA 1S4CA 1AL21 3GALA 1LOAA 5K0UA 4FQ4A 1KDMA 4LOSA 4IE4A 3P5BA 1BJQA 5D8AA 3WOGA 4FQZA 4QAWA 1BYHA 3AZWA 2E6VA 2N7GA 1V6LA 1HQLA 1GWMA 3NJYA 3FHAA 1VMFA 2D6OX 3VDDB 3LE0A 3PDQA 4BQ2A 2IXKA 3ETQA 1IHMA 2YPJA 4OFGA 2VAUA 2Y6HA 4CU9A 2RMU3 2GMEA 5FZMA 1ULCA 2UYBA 2CU5A 3CJXA 4E8CA 3W59A 2ARAA 3OGGA 1WA4A 4XC9A 1NCQA 1VIWB 1LKNA 1C5IA 4MHUA 4WVMB 3WDWA 3H0OA 3HPNA 4RGGA 2BOJA 2C1FA 3T3YA 1PO13 4AGVA 4EROA 1RUG1 4YZ4A 1AL0G 1RUC1 2W1QA 2HEYF 3TWIA 3LPFA 3AYDA 5FLJA 3ZN6A 1XNAA 1S2KA 2JJ6A 3RZMA 1CAXA 1AYM3 4XJUA 3UNPA 2WFPA 4N8MA 4V2WA 1UYYA 3I49A 4XJZA 4CEYA 4XZPA 4LTAA 4MADA 1LECA 2BNMA 2FDKA 5K8SA 3OPWA 1LODA 2W3JA 2Q1FA 2HWD1 4JTNA 1YWKA 4TN7A 1GZWB 1YIPA 3FX3A 5FP3A 2R043 4C0HA 2WWUA 3AXDA 3WNOA 2W1SA 1RUE3 3LCPA 3ZYRA 4S2GA 1MACA 4QQOA 3VD7A 4DEQA 1WD4A 2QDRA 1LHUA 1ZBE3 4HANA 3F2ZA 5ANNA 5DAQA 4MGZE 1C1FA 1UY3A 2A6XA 3LIHA 4M3CB 4S2FA 4TZDA 4MYEA 4A45A 2Q1ZB 3K46A 1W04A 5CADA 5BV6A 2V73A 5EXOA 3HVDA 3MW3A 1PX3A 4E4ZA 5IUQA 3LGRA 3ZDVA 1MZEA 4UFLA 2A5ZA 1SBEA 3KS7A 2PHUA 1CPMA 1AZDA 4Z2WA 1ND3B 4JGYB 4CDXB 1QJX3 1X50A 2P2KA 2ZGOA 3DPRB 2DTYA 2EF6A 1N3QA 3IAQA 4PT6A 4IEZA 3WNXA 1S0DA 3WW3A 5A3LA 2FCTA 1RVF1 2JEMA 1X82A 2JE9A 2AREA 4NRQA 2A6WA 4AOCA 4B1LA 3L2HA 5FTTC 1W8TA 3OJBA 4J1XA 4AYUA 5JMOA 3T1LA 2RS32 2ADDA 2E7QA 4KI5M 1OH4A 4RGAA 3F95A 5GZDA 2XVGA 1PK6B 4G3YC 4N90A 2BGOA 2W46A 2A7AA 5JVVA 4OI1A 3T30A 3M3EA 3OD4A 1GNZA 3SH3A 2D3SA 3CDZB 4ARYA 3JD73 1UOGA 1MEC3 4K7JA 3OYWA 1FXZA 5DG1A 2LS6A 4JCKA 5J48A 3HR9A 3T08A 4COZA 2HWE2 1WA6X 3L9JT 1SACA 4AVBA 1UY4A 2IFRA 2OPKA 4OI4A 1GKBA 4FFIA 4N53B 4IEUA 4Q4Y1 4CPBD 2IVJA 3KMHA 3PTYA 4XQ4A 1GOGA 2PAKA 1W2AX 3B94A 2PHFA 3DYOA 5JIAA 1POV0 1JS9A 1FOD2 1AX2A 1G8WA 1V9U3 2VZ1A 1WCDJ 5FZ7A 5FZ8A 3ZX7A 4LBQA 1VALA 2XLGA 3VZMA 3AFKA 1D4M2 4DEVA 2XLFA 3HEIA 1VR3A 3ZFFA 4HOOA 4HL0A 2GH8A 1HQNA 2VE1A 1ZM1A 5FY4A 5C8CA 1J3QA 1X33A 4UAPA 1O6UA 4LKEA 4E4HA 3NKTA 1I9RA 2VMCA 3VBRC 1O59A 3LA3A 4P9GA 2DUQA 4S2HA 1G9CA 1WMXA 1BK0A 1RUI1 2JB8A 2HWC1 3VD4A 5C3PA 4SLIA 2ZKNA 4AVAA 2BGPA 3K3NA 2WDBA 5FPZA 3USUA 1JI6A 4ASLA 1HRV1 2DCZA 5IWFA 3FZ3A 1PGSA 4W8JA 3WQ7A 3I2GA 2RJKA 4LHLA 2WFF2 1QXJA 1FNYA 1LNSA 2OXBA 3WVJA 4YW6A 3RZHA 5IK4A 4EN9B 1R092 1ULOA 2HBTA 2VQAA 1AR63 5I8TA 1UX7A 1N1VA 1YJKA 4XTMA 4AHXA 5JOWA 2DDUA 1PZ8A 1UIJA 1YHFA 1CIYA 4KL1A 3TAYA 1UNBA 4UFHA 5LK7B 4QGMA 2FZ2A 1CR7A 2W52A 2Y60A 4P9WA 4XQWA 1GQPA 2VH9A 4ZY9A 1O4TA 5SV8A 3UGGA 1ACCA 4AEKA 5HXMA 3THPA 4BQ3A 1BXHA 1EPZA 1DHKB 3EBRA 3C7GA 3VN4A 1KFUL 2DV9A 2LROA 4XF4A 1RHI2 2AUYA 1SLTA 1SFPA 2YB7A 3WV6A 1RUH2 3NRUA 1EV13 2NN8A 2RJLA 1QJY1 1ZYBA 2CDOA 3CZJA 4NRMA 3AVRA 1ZRCA 4YYOA 2JE8A 3LOIA 4E2SA 3NVCA 3LA2A 2MEV2 2R072 2CGPA 5DZEA 3OF1A 5FZ0A 3T4HB 4IEQA 4NHLA 1V6NA 1UO9A 2HKXA 4Q4W1 5APAA 3W58A 1HXS3 3D4KA 4RYDA 2C24A 1GR3A 2ZHNA 3POBA 4YVWC 1U12A 4P9YA 2WT1A 4F8AA 2WJSA 3AL5A 3BIWE 2BBAA 3EMRA 3THCA 1G9DA 2MNGA 4GB32 4LUKA 4O61A 4XFCA 4N43A 4XDOA 3THTA 3ZSEA 2YU2A 4LBMA 2WUHA 2ZOEB 3LEMA 1WLDA 4QDQA 1BCXA 1WWYA 5EFUA 1BHGA 3PUSA 1US3A 4KGGA 5EZWA 2GH2A 3RJRA 1DQ2A 3ZFEB 4C0BA 1IG3A 4H55A 1Z0HA 3ZPYA 5C9AB 1JOBA 3ZN4A 5F7UA 5HI0A 4CCKA 5T54A 3ZFGC 5K9YA 3VDCA 1OA2A 1P8JA 2RS12 1NA1B 4NPLA 4COVA 1A78A 3FHIB 4PIXA 3WXPA 1AL23 4IW3A 3BTYA 3RNSA 3P3NA 4LNVA 3WY6A 1PGW2 4P9XA 2GZWA 3O1OA 4RFT0 3QD6A 4Z8BA 2VNRA 3MW4A 3RYKA 3ACIA 3U1XA 3JBG1 4LA3A 3WDYA 4DXTA 2ES3A 2WKKA 2XJPA 3FL7A 4ARXA 1UOBA 4WVVA 3UESA 1WZXA 1V6JA 3WR0A 1O8SA 1YQ2A 2YV8A 4AVSA 2W39A 3ITQA 3AMHA 4HKWA 1HDKA 3J7MA 2JDZA 2VXRA 1SFNA 2JG9B 3S5QA 3ABZA 3N7MA 4AGGA 2ZAAA 2VC9A 3THDA 2KXLA 1YLLA 3K3OA 3M1HA 4XETA 1BEV2 3RSJA 4Q0SA 3LFIA 2WR9A 4E9KA 1DGWA 1DQ5A 2X10A 3CF6E 5DMYA 3NO8A 4NO4A 1RUG3 5K7PA 1WW4A 1RUC3 1PVC1 2BTVC 4RFRB 4TLFA 1VP6A 3SQOA 1QEXA 2VNGA 4L92A 5C5UA 1SEFA 1MQTA 4XZUG 5K0UC 2J42A 1EYBA 4I0BA 4MGQA 2ILMA 5D8AC 3ES4A 5C4WA 1TNFA 2YFZA 2RDRA 3C7FA 2AEYA 3PUIA 1AR62 5FYHA 1XE0A 2HWD3 4IV3B 4LBJA 2ARBA 3BGAA 3FN9A 5FP8A 1V6KA 1E57A 3O0WA 1XPWA 5FZ6A 4HSLA 5AC91 3AK0A 1MVEA 3OBTA 4UXAA 2XHKA 3K4ZA 1JZ2A 1YJLA 3IKWA 3KWVA 3RJ2X 3QCWA 1C3HA 2PQSA 4XIKA 4ZXEA 1FV3A 4I0AA 1NCQC 4P08A 4YM0A 4OULA 2OVUA 3PMSA 1ALYA 2VTXJ 4LOTA 1RUF1 5JI7A 1K3IA 4OI2A 4R9DA 4CP2A 5FQ0A 4RHV2 3I3DA 4XCBA 3K2OA 4Q0UA 2A1XA 3E6BA 1COV2 4AZZA 4RQPA 3LWCA 5KHJA 1WCUA 5CEHA 3C3VA 1AR93 3B69A 1W8FA 2GNMA 2Y34A 5EJZB 1H8TC 4YZ5A 1GYKA 2DVDA 3Q9OA 3SLIA 1Z7S1 2VMIA 3WDTA 2PYTA 3HOBA 1RVF3 1ND2B 1NZCA 4K1YA 4FO9A 5EJ1B 3K75B 3J7HA 1XE8A 4Y1YA 4FOQA 1RUJ1 4FPFA 4CDUB 4XQDA 5CKQA 3VBUB 5CFCB 1KD7A 1Y9GA 5ABJB 1UY2A 4HLTA 5LA1A 1HB2A 1J3PA 4IGOA 4FI9A 1IPKA 2WQ4A 3POEA 4C91A 2X5IC 3OG2A 4O9EA 2E63A 5DG2A 2VG9A 4EE2A 5BNNA 3U0ZA 4ATEA 2HWB2 3EHKA 1MS5A 4UW6A 1QDOA 5IFPA 2P5BA 2VNOA 5A7WA 2E9QA 2EAKA 4Q4Y3 5E1RA 3I2OA 2VZOA 4BIFA 3PIJA 1W6MB 3WCSA 2YC4A 3MIGA 2IXIA 1WBFA 4YW4A 1W8UA 1VBB1 2CY6A 1RGSA 5BNPC 4XMIA 5L19A 2YY1A 3IM0A 5FBZA 1LULA 5CG8A 1UIKA 3M4FA 1XSRA 3OEBA 5BNOA 2ZJCA 5FXZA 4YW1A 1ZRFA 2FZ1A 3ZSLA 3FLTA 1M4WA 4LULA 4PF1A 2X8KA 1LR5A 1RJ8A 1J84A 3KM5A 4L0PA 4BU2A 3IIIA 3VHNA 1QJEA 3NW4A 4H7LA 4CSWA 1RUI3 1J1TA 3KT7A 2DFCA 4HVOA 4XVHA 4FTSA 2HWC3 2V5YA 3VBHB 1OFNA 4Q2FA 1Z78A 2EXHA 3ILNA 2FDJA 3DYPA 4WVZA 3NV4A 1HRV3 3LEKA 2G1MA 2RJ2A 3B5LB 4MV2A 4UWDA 3O1VA 3KV9A 2PLV3 2HWF1 1QF3A 2WAOA 2LALA 2VVDA 1FMD3 2RM23 3BI3A 1M06G 1VBA3 4OZXA 1B35B 2VW0A 3BYWA 3MHZA 4P14A 4NPRA 3VBFB 3EYPA 4PLMA 2W1UA 1LEMA 2R32A 1PIV3 3ZFFC 5IAXA 5JDBA 4BQ1A 5C8CC 2XG3A 4ORFA 4A41A 2RDQA 2ZHLA 4ES8A 2HEVF 1QHDA 4BPZA 3RZZA 5JCTA 2QZ2A 3VKOA 1YFYA 5CKMA 3RWNA 3S6PA 1ZRDA 2A70A 4Q4V2 1OD5A 5JR2A 2XKPA 2XWBB 1QJY3 5A1LA 1SG3A 2P3IA 2XVLA 2HYKA 2PTMA 4GWIA 2WN2A 2RMU1 1JW6A 3DCQA 2I74A 5GLTA 4BMEA 3I2JA 4FPHA 2X53S 5A32A 4TYSA 4P00B 2DU1A 1ZBA2 2WNOA 3QOPA 4Q4W3 5J96B 1RB8G 5FY5A 1W8OA 3AC0A 2ZEWA 3OTFA 2VCMA 2I45A 3H3LA 5K4LA 2VZ3A 1U5IA 2XLAA 2X05A 4CVUA 1W06A 4QGLA 2OA2A 4Q26A 1F5FA 1QOTA 1UL9A 2ZGQA 2PHTA 1BMV2 2X29A 1Y7BA 5A6XA 4DPNA 3D6EA 3AKSA 2W68A 5FCCA 3DXUA 1YIFA 1MS9A 2D44A 2WC2A 4K3UA 1POQA 3WCRA 2CAUA 3PU3A 1R082 4UOJA 2YC2A 1JMUB 4AAXA 2W08A 3MDPA 2RS51 2ZGPA 4AFBA 5FY7A 5LBBA 4AE2A 1Q43A 2BRTA 4HSJA 2ZEYA 4XBQA 1CVNA 2Y38A 4B8EA 2RDNA 4MX3A 4NJ4A 3BODA 1HB4A 3WW2A 5JIUA 4L11A 2ZGSA 1YO8A 3PJYA 4AW7A 4DRRA 3KT1A 1Y4WA 1GSLA 2EXIA 4MG2A 4OMCA 2VW1A 3JBG3 4QKFA 1YCIA 4OHZA 2YPDA 2J22A 1AYN1 2V4AA 4CXXA 1GNHA 2A3YA 3RZLA 1DFQA 1ZX5A 4FCAA 4GIQA 5FZOB 1QNWA 1W9SA 2D6PA 4I09A 3CJIA 4XIOA 3SKJE 5A1AA 4JRAA 4N43C 2ZEZA 4M4PA 1JZ4A 1HN1A 3GBWA 4A3XA 1OUXA 1VAKA 1NY72 2G19A 4QXHA 3GBGA 2W9XA 5C3QA 1JZ7A 2W47A 1PO12 2OUJA 3JCIA 2D5HA 1DGRN 4JHTA 3MO4A 1XE7A 4MXWA 2G9ZA 5T50A 4DXSA 1UKRA 1ZZ8A 5FYYA 4NR1A 4CEYB 1Q8OA 1HV1A 1SBDA 2ID4A 4QDRA 4DXZA 1VBC2 3I97A 1W0PA 2BVBA 3CLPA 5LRSA 4AK3A 1EP0A 1QY4A 4E2QA 2YU1A 2VQ0A 3PL0A 4AVCA 4P9IA 5C5TA 4HETA 3WHUA 1WCKA 3SCFA 3FJSA 3P6BA 5I0RA 1NCRA 4MGTA 2OPWA 3SNMA 3UJOA 3GZAA 4KBZA 4KWUA 1NX9A 5FLIA 3TNQA 2R042 4CP9A 2Q8OA 1OI6A 1UXXX 4J6GA 1I3HA 1NE6A 4QMAA 5KHHA 4Q0QA 5A3MA 5AC93 2R49A 3BN6A 5F2SA 4C1WA 5J36A 3ACHA 1ZBE2 1H6YA 2EXJA 1NOVA 1E5HA 3MIEA 2WO3A 3AB0A 2VCBA 4UFJA 4XFAA 4CUCA 2JE7A 2B39A 2WYSA 1YUDA 5C6CA 5IVBA 1JN2P 4KG0A 3MLJA 1LHOA 4KU8A 1RUF3 4UFIA 2B45X 5IJRA 1DQ0A 1S0CA 4K8RB 1ZRRA 1DQ4A 2B7YA 4FBFA 2P34A 2QQVA 1NAEA 4QQ2A 5BYNA 1NT0A 1LOGA 4LIUA 1QJX2 3LFMA 1KGYA 1PO23 2O8QA 2XR4A 4BQ4A 2Z2SB 4BXSV 3KD4A 3DV8A 3EB7A 1R1A1 1Z7S3 5C4WC 5FK8A 2GC1A 2JG8A 1UYZA 5FZLA 1IOAA 3PU8A 1KDKA 5A6YA 4MXVA 3T2TA 4LJHA 4RS5A 2VL4A 4IQPA 2VQTA 2XL7A 2WO7A 1NXMA 4QX8A 1RUJ3 1HB3A 4YW7A 2PAMA 3OYWB 3MIHA 4FFHA 4C90A 4NIDA 1PMHX 1O7FA 4MH0E 4XJWA 3LZZA 2Y6JA 5FR3A 2BERA 4LKDA 4COWA 4XUNA 3JD72 2VR4A 1MEC2 2ET1A 3KF5A 1AR61 3N9PA 4XJAA 1H4GA 1POV1 5DDJ1 1KJLA 1A34A 2BBVA 1K5MA 2IZWA 4D6QA 2Q5TA 4CRQA 1QQP1 2IXHA 3X29B 2R7EB 5IATA 1I6XA 1LJ7A 3IN9A 4XURA 3VD3A 3O0XA 5JI9A 4RQPC 1J58A 2DFBA 3GZEA 2YG0A 4DUWA 1V9U2 3IBMA 1DLLA 1VBB3 2WBKA 3FC0A 5J98B 4AF9A 1ENSA 1F15A 2G9FA 4IGQA 4LK6A 2JXAA 1C8M1 3J26N 2YMZA 4XCAA 3IPVA 5C71A 2NPIA 4QX7A 5E89A 3ZFGA 1VB2A 1I5PA 1O4ZA 3EJKA 2YFUA 1TVGA 1FX5A 2Q8CA 3WP4A 4EJRA 3USUB 2CSGA 5FV3A 1IKQA 2A75A 2WS92 4J25A 4AI9A 1LESA 5D2AA 3BPZA 3PURA 4CCMA 1AR81 3WG1A 2PFWA 3RQ0A 3H3ZA 5A7QA 1DU3D 4YLZA 4ZU4A 2DYCA 2W1WA 1HQWA 2WNUA 1W9YA 4BA6A 4N7UA 3VBOA 5HV0A 1RYYA 3WNPA 1UZYA 5LK5A 4JAAA 4D7YA 2QQIA 4CYDA 4NAOA 3WP6A 1W6QA 2FCVA 2HWF3 2VMFA 3NJXA 5C3RA 1JXNA 5J7MA 1JYTA 1LU2A 4HPKB 4UW5A 4EN0A 2AC1A 4JDMA 3V0AA 1K42A 1XNBA 2DCKA 2VD7A 3DECA 5DQ0A 3VBSA 1PGL2 2BNOA 2J1RA 2VZPA 4EWDA 3PJQA 4P5HA 4TSVA 1AJOA 4ES9A 1F4HA 4INDA 5IK5A 2DVFA 4IEYA 1W28A 5DAXA 4AI8A 1DIWA 5F2WA 5GZGA 1RUOA 2ZX1A 5HCAA 4LHNA 3CQOA 3LQCA 3ZYGA 3I3QA 1EV12 4YVSA 1H2LA 3GCWA 2XJQA 4WM7A 2GNBA 5E8AA 3HD8B 1W03A 2WA3A 1DZQA 4AQTA 1OOPB 2XB6C 2ZGTA 3K4DA 5G05L 2Q0AA 2ZGMA 4YNIA 4D8MA 3ALQA 3RZKA 3IZOA 4ZU5A 2YYOA 5CFDC 1HXS2 1YNAA 1DDLA 1U5XA 2ARXA 2Y6KA 3SCHA 1PVXA 2WLPA 4COUA 5BXXA 4LBNA 1QMJA 3MUZ1 5A1FA 2OZ6A 2G9GA 4IV1C 1CAWA 1XXNA 2Z79A 4NIHA 1HJFA 4V1PA 2H6CA 2BYVE 4I3PA 2IXJA 1DLCA 1H8TA 4DUXA 3GJAA 3B01A 1GWKA 4QHZA 1IS5A 2MHFA 2XDVA 4LBKA 5F3EA 5KC5A 4WM8C 2RS53 1XRUA 4O7XA 1W2OA 4OYUA 1AL22 1OKOA 1WMEA 2QFEA 2NZ9A 2VZSA 4K40A 5JOXA 1WW7A 3H7YA 3ROUA 2H0BA 3E5UA 4LA2A 2FDFA 1ZA4A 1AUYA 4P5YA 4E2GA 3HMYA 3QBQA 2QVSB 1GP6A 5DAPA 3P3PA 4GH4B 5FZKA 5JWPA 1LHNA 3AP9A 1W6OB 3OPTA 4ZZ8A 1AYN3 4XUPA 2X5IA 2YHJA 1S1AA 4QX2A 5DZGA 3WF1A 4CZSA 2UWBA 5EIYB 1ODMA 3ZXFA 1LEDA 2MPFA 4I30A 2OX0A 1J59A 1VRH2 5CB7A 3CHXA 2ZHKA 3G6JB 3AMMA 4BWOA 3T2OA 4AI3A 5CA6A 3GZUC 4JGZB 5LB6A 1AR91 2P3KA 4CEWB 3WZ1A 5GALA 2R16A 1AXKA 1Q8VA 1Y3TA 5BNPA 1HRI1 1RUG2 3ACGA 4EZHA 2FMYA 5I0DA 4CCLA 1MQTB 1RUC2 1RXFA 1N3PA 2BEOA 2BQPA 1H4HA 1F4AA 5FXWA 2P4EA 3S7EA 2GAUA 4NHYA 1Q3EA 2VTXA 4Y22A 3TN91 2ATFA 4DY3A 2O1QA 4FFFA 2DUOA 4EWEA 3BOPA
chains in the Genus database with same CATH topology
2JG9C 4OI0A 4QXKA 2HWD2 4LLFA 3CNAA 5FMOL 2HJIA 2WT2A 5JSOA 1UU4A 1ZREA 2RR13 1H1AA 3K48A 4AFAA 2FMDA 5KXDA 2GNTA 2G4IA 3CJIC 4BOWA 4FAGA 4I02A 5TSWA 4BH9A 1V6IA 1SMVA 4IEXA 3LOBA 4EN7B 1BQPA 4YGEA 4K9SA 3R4SA 5L7OA 1JTZX 5JZGA 4CDWA 5C8WA 2WFF1 3S0MA 4P9JA 2F4PA 4M01A 2UY9A 4YGCA 1CESA 1R091 2R062 2Y0IA 1S0JA 2VU9A 4WVWA 3ES1A 4DMIA 5FO7B 1R1A3 3EQEA 4XFBA 4LO7A 1NCRC 4F7ZA 1IZ3A 4AEDB 4I3GA 3I59A 1AR72 5H9QA 2Q1MA 4KH9A 5BNNB 4FPKA 4I2OA 4PDWA 2PLV1 1CAVA 2H6BA 5FMOS 1FMD1 4JC1A 2RM21 5BUVA 1VBA1 1FYUA 1POV3 3KCYA 5DDJ3 3WQ1A 2D97A 3CO2A 3QH7A 2ZS6B 3RMXA 1ULGA 4BLIA 1QQP3 3OCPA 1PIV1 4Q4Y2 4HKLA 2NYYA 3VKNA 1QOSA 1F8VA 2D5FA 1TMF1 3MI8A 4FPCA 4ISRA 5GLZA 4JV4A 1KJRA 5BNOB 5CFCC 4BE3A 4IL7A 2IXCA 2GMPA 1UF2C 2E53A 1DQ1A 1C8M3 1QXRA 4MSVA 2JG8C 1N1YA 4M0HA 2SBAA 3HT1A 4B3NA 5KHGA 1QOOA 4DY5A 4LBOA 1LU1A 2JX9A 1QH6A 4AXOA 4RS5C 1KXGA 3JU9A 1Q5OA 4M3CE 2GN3A 3HIFA 1RUI2 3PVNA 2FQPA 2HWC2 4AQ2A 4XMAA 1AR83 2P17A 1HRV2 4OUMA 2B8MA 5KXBA 1K5MC 3WDUA 2B42B 5EV7A 3ECQA 1I1EA 4XTPA 2PAEA 5T3NA 2RHPA 4ITCA 3D8CA 2ZBJA 1RITA 4QPIB 3VV1A 4DOUA 2PQQA 1RTVA 3BU7A 3HN1A 2WINB 2ZKLA 1BBT1 1OPMA 1SLAA 1WLCA 4LUMA 4QU2A 2I07B 2WIIB 3N4MA 1ONAA 1QDCA 3VDDA 1LOEA 4MLOA 3WP5A 4LO8A 2NP0A 4FSJA 3WLUA 1FPN2 1BEV1 1RIRA 2WA4A 4B4RA 1B09A 4R8HA 1QH7A 3RRDA 4AI2A 3GZTB 1QJY2 1MS3A 3BB6A 1SCSA 2WNUC 1QKQA 3VBOC 3ILRA 4XJ8A 1O3TA 4Y1ZA 3MW2A 1WMFA 1H1MA 1VBE1 5JLVA 2QZ3A 4FVVA 4Q4W2 2XVKA 4QPGC 4D7SA 2B5HA 1WBLA 1LCLA 2WSUA 4RR3C 3VGIA 4YFZA 3VBSC 1MS8A 2ZAHA 5KC6A 2D3PA 3U07A 4YZ1A 3VZJA 2WZR2 2NMOA 1W6NB 4LR4A 1GZWA 1QJU1 1O4YA 4W6WA 1BZWA 3JB8A 3VZLA 1WLWA 4LE4A 1XNCA 2QJVA 4M3CA 2WL1A 1S0BA 2EAAA 3ZIWA 4HT1T 4Q1RA 3V64A 2D6NA 4DINB 4YVSC 2BGCA 5GLWA 4CP0A 1AHSA 4WM7C 4CDQC 4FPJA 4FP3A 4AFDA 1GFF2 2AZ5A 3GF6A 3D0JA 3WP3A 2B9UA 2PHXA 5FPXA 5HCBA 3JBG2 3WHTA 1ND3A 3O0VA 3OD0A 4JGYA 3VHOA 2UURA 4AHZA 3DPRA 1TME1 2GMMA 1I5ZA 4W6XA 4L9BA 4QM9A 4GULA 4HFSA 3VL9A 4D69A 2RS33 4G9SB 4PBOA 1XNKA 4YFWA 3RYPA 5GLVA 2VOXA 3AKQA 1WW6A 3H3UA 4E4SA 1UN1A 1RUNA 1AXYA 1PO21 1PK6A 5F1RA 1O3RA 3AKRA 1HRI3 2HWE3 3VBRB 1PVC2 1S0GA 1OA4A 1NLSA 3ZXLA 4YM1A 2ZHMA 3TN93 4LLOA 2YGMA 1O5UA 4N53A 2PHLA 4IEOA 2BW8A 1ASJ1 1PZ7A 1YI7A 1H2KA 5A33B 5DUVA 1SDWA 2O0OA 1LOCA 1QNYA 2WNEA 5DUXA 3MF6A 5AC92 5GZEA 2YC0A 3FLPA 2TEPA 3OY8A 2ZMKA 1XU2A 1CX4A 3MGUA 2A3WA 2TUNA 4QQPA 2AH2A 3R4DB 1RUF2 3S7IA 1CN1A 1UPIA 1LHWA 2WFF3 2DVAA 2K0GA 1KRIA 3I8TA 4XXPA 2TNFA 5BPXA 2D6KA 3O5SA 1D2SA 3AZZA 1R093 2WNVC 4LO6B 1JHNA 3M3OA 4EN8B 3GBFA 1Z7S2 1PNFA 4KWJA 3AXEA 3FE5A 5FLHA 4META 3VUOA 3UKVA 4LHKA 4Y20B 1PHMA 1MR5A 1RUJ2 2DTWA 4GA9A 4NVPA 3RMYA 4L8QA 3I2DA 4IXLA 4YVWB 3VKLA 4FPGA 4XOGA 3AMPA 2QQPA 1IPJA 1TNRA 1IGOA 4Q4V1 5CFDA 3K51A 3TRSB 1FAYA 4ATFA 5DZFA 3CEWA 4K20A 1JH5A 2R0FA 5L7OC 4FPOB 3NAPB 5JZGC 4CDWC 1UX6A 2ZTNA 3N7JA 4FPLA 1TMF3 1CAUB 4IV1A 5JSRA 1VBD2 1X8MA 3JUUA 4Y26A 1U5ZA 3FFZA 1F2NA 4BHPA 4Q4X2 2K9ZA 2DCJA 3MLKA 4GB33 3ZXEA 4WM8A 5F5QA 3H1YA 5J37A 1NLRA 1H0BA 4Y1XA 3FMGA 1A8DA 3GHMA 4I0WB 3VHRA 4UW3A 3L2YA 4E27A 3ZYIB 5GKAC 3E5QA 1R081 3I4IA 4PDWC 1YYNA 3B9IA 1X7NA 2JKBA 4KNCA 1CPNA 4Q27A 4M00A 3SISA 3E97A 1S0IA 5KXCA 5C9AA 4YM2A 3WINE 2HWF2 4X6QB 5EJ3A 2HEWF 5JPMB 5AVPA 2ENRA 5EYYA 1BBT3 2DURA 4Q8KA 1MS4A 3PVBB 3INAA 3ZXKA 2A6VA 1DZRA 4COYA 5K0UB 2JICA 1F5JA 3WDXA 5D8AB 3IWZA 2VY0A 4Y5Z0 4E4DX 2UWAA 2XWJB 1NY71 1G86A 5IT6A 1BEV3 1CQ9A 2JG9A 3AFGA 2DVGA 1REDA 3N7LA 3H50A 5FOJB 3WT3A 4X8NA 1GZ9A 1F31A 4BZ4A 3JZVA 1Y43B 2YXSA 1C1LA 4D7TA 3U4XA 1NCQB 4GKYA 2F6BA 2RMU2 1VBE3 2XGXA 1RMU1 2XBO1 1AX0A 4MGYE 2QE3A 1H9WA 2WT0A 2VW2A 1CAWB 1KS5A 2OW4A 1ZVFA 3NSTA 3MLLA 1S55A 3ZN6B 1RUD1 3WG2A 1EY2A 1CAXB 4X6RB 4Y4YA 3UL2A 1WLTA 5DUUA 4IV3A 3VDDC 1ZZ7A 2BWCA 1OMIA 1AYM2 1NYWA 1QJU3 1ZZCA 2H0VA 3IIAA 3E6DA 2EA7A 3AP4A 3B7MA 2DF7A 5JR7B 2GDFA 3HWJA 2RS52 1EPWA 4YG3A 1L3JA 3FLRA 3WD5A 3ZXJA 3SCGA 3SXWA 1IS3A 2LTNA 1IS4A 2CTVA 1YFUA 2RR11 4UBHA 1LENA 3ZMNA 1RUE2 2X5IB 4GMP1 4XHBA 3A0NA 2ZGKA 2P3JA 1A8MA 1CJPA 1OFSA 4XILA 1TME3 4XYXA 2UU8A 5ACA1 3VZOA 4R4ZA 3NKGA 2XJSA 3I54A 5BNPB 4X8PA 2QCSB 1ND2A 1N1TA 5T5JA 1OPOA 2ZGNA 4KU7A 3AYCA 4CDUA 5T5LA 5CFCA 3WQ0A 2ZACA 4IESA 4NN0A 1REEA 4XE9A 1T6GC 3ZIXA 4DNYA 2HWB3 3MEPA 3O12A 3ZN5A 1DZTA 1G6NA 1V6OA 3J9SA 2VOVA 2D6MA 3R0RA 4XW3A 1DG6A 1TE1B 2WQZC 1FT9A 1JUHA 5T52A 3LSEA 3OGJA 4AVTA 1LHVA 5GM0A 3SHRA 1Q56A 1ASJ3 1FI2A 2OIIA 2A6ZA 1GLHA 4N9IA 3AP7A 3QH6A 1ND3C 4JGYC 4JVAA 4CDXC 2IC1A 5L73A 2R6QA 4FOYA 3DPRC 2D6LX 2VVEA 4XFIA 1Q8QA 3KGZA 4L99A 3LSDA 3D0SA 2BPA2 3VZKA 1VLNA 4LBQB 2SLIA 3M8LA 2A73B 1EAH1 2E7AA 2UWCA 1D4VB 3J8F1 3AP6A 3VZNA 3ZFFB 2YDEA 5I8YA 1H2MA 5C8CB 1UZZA 1PK6C 3IMNA 1DGLA 1PM7A 4HZFA 4MUVA 2GC3A 4KGQA 5GLUA 3WDVA 3SMHA 4N7IA 1UKGA 3M7AA 2D98A 1PGL1 2D43A 2BFUL 2ZABA 4N53C 4RSUA 1R1A2 3U10A 4EV0A 3KZ4C 5LEKA 1WMDA 1B35A 3PNAA 4K21A 3C2UA 3VBFA 2GC2A 3BALA 1Q8SA 2VECA 4F83A 4K1ZA 4HK9A 1WGPA 3RYRA 3AYAA 2E7TA 1JUIA 3APBA 4MVTA 4Q0VA 2VUJA 4Q4V3 4QPGA 4UW4A 1AR62 3CU7A 1XQNA 4ASMB 4IEWA 4DRVA 5J09A 1W39A 5DDJ2 5CG9A 4A2UA 4RR3A 2WZPP 5FOBB 1QQP2 2V09A 5JSPA 4YSFA 4FXGB 1SLLA 3ASIA 1GQHA 4Q0PA 3EXUA 3FWEA 1MZFA 1N3OA 4JRLA 4AEDC 5CAZA 1ZZ9A 3SITA 1WW5A 5FDBA 1C57A 1G7YA 1LGBA 5CBLA 3MIBA 4M3CF 1C8M2 4PIZA 2CWSA 2R1DA 4DQAA 3DKWA 3M3IA 1CGPA 1OKQA 2GNDA 4R9AA 4FOWA 3JQXA 5I91A 3B00A 3TYJA 1QWRA 4GWNA 2IXLA 4BM8A 3V0BA 4CDQA 1Y9QA 1ZZ6A 5JMCA 3KGLA 3B3QE 2BFUS 1VJ2A 2K2SA 4QGNA 3TOJA 3UJQA 4YARA 1AR82 1R083 1QGLA 1S2BA 2WSVA 2AGSA 3AJZA 2IFWA 1UU5A 4N43B 4GQ7A 1GQGA 2TBVA 3RS6A 4DZGA 3MZHA 4QQLA 1VAVA 3POSA 3VL8A 4KG8A 4LT5A 2XJTA 1R1ZA 3AP5A 4ZU7A 3TBDA 3PVEA 5HBAA 2QDNA 4O9GA 4A7YA 1VRH1 4B7KA 4NHMA 3POWA 4QM8A 4IETA 1ENRA 3IDEA 1CJDA 2Z5WA 4B7EA 1FATA 3QLQA 5AVAA 4DS0A 3POYA 2ZMLA 1GV9A 5F6LB 2D93A 2CAVA 5EYXA 3VHPA 1DGRA 3VLBB 1JYCA 4OHVA 4QPIC 4XF1A 3MIDA 2DCYA 5GZCA 4RA0A 3ENRA 4XBNA 1VBC3 3WUDA 1G9FA 1MS1A 4MZUA 3M3CA 1ULFA 3ATGA 3I7DA 3ZFEC 4GMP0 5C9AC 2XH6A 1YXWA 2RS31 1W2UA 4FAHA 2WLQA 1NA1C 1RMU3 3NL1A 2XBO3 3ELNA 1W6PA 3AMQA 3NV2A 1RUD3 1H2NA 2HWE1 4NHKA 4HVQA 4RL7A 5C4WB 3IDCB 2XL9A 4LEJA 2WNVA 3ZSKA 1DGWX 1NXD1 4Y1VA 1FOD1 4I01A 1D4M1 1ENQA 2GC0A 2OZJA 2FBEA 2NMNA 4A7ZA 5HXVA 5T55A 1BVVA 3NV3A 2R061 3ZSJA 1OLQA 4GMP3 4WBBA 1D0HA 1UPSA 1LGCA 3E5XA 5FQ0B 5H9SA 3NWKA 1OQEA 3D82A 4PQ9A 3SH5A 1SFYA 2R30A 4RQPB 5ACA3 3AX4A 4EN6B 3UKNA 1C8NA 1AR71 3UV9A 3AZVA 4XEZA 4IV3C 1APNA 1H8VA 1AR92 4KQ7A 2QNKA 3RI8A 4PF5A 3LKJA 1VB4A 1HRI2 3GNEA 4YRDA 5T5PA 1UMZA 3U11A 2W0XA 5LEJA 4AWDA 5FFOC 1GZCA 3H1MA 2KA3A 5KXEA 3E6CC 3B93A 5BY5A 1RVF2 4C1XA 2ZA9A 3TN92 2ETEA 4H3WA 5GJ6A 2ZPXA 1SCRA 3KCXA 2OYZA 4HVRA 1JBCA 4Q8LA 1G9AA 1SQ4A 3V65A 1RHI1 3OY8B 2XJVA 1RUH1 5B2GB 2VMGA 1V70A 4MGKE 4BLJA 1SBFA 1URXA 3JB4C 4XF9A 2WS93 2MEV1 2R071 1BVP1 3VKMA 1ND2C 4QQHA 1F9KA 1EAH3 3ST7A 4CDUC 3J8F3 4XF0A 3VBUC 3S30A 2ZGLA 5ABJC 4YGDA 3G7DA 4HMZA 3BTAA 4DB5A 3OBRA 4Q1PA 2O8OA 4H14A 1FV2A 4GB31 2VMHA 3DGTA 1IKPA 3N35A 3M70A 1ENXA 3PLQA 5L36A 2BWAA 3D5OA 2DVBA 4HPKA 3ZO0B 4SBVA 3AKTA 2RS11 5CFDB 4OHWA 1DYPA 1LGNA 1YFWA 3URFA 1HV0A 1FPN1 3QACA 3SH4A 3O7OA 4U2AA 1BKZA 5I0UA 1PGW1 1XNDA 2PLV2 4AEMA 1KFXL 2D40A 1FMD2 4YW3A 4WZCA 1DF0A 2RM22 4WV8A 4D3WA 1VBA2 4IV1B 3UK9A 2ZX2A 4S2DA 4LE3A 4YM3A 2LM3A 3M3QA 1PIV2 3VBHC 1TMF2 2Q30A 5AFEA 3AZXA 5BNQA 3ZXDA 4W6YA 1OOPA 4WM8B 2YZ4A 3MF9A 3J4UH 3WUCA 5D1IA 4PLOA 2Z69A 3B9CA 4XF3A 2EXKA 5JAXA 2WZR1 1IS6A 3BCWA 1B35C 4Q29A 4WVMA 3R05A 1WD3A 3VBFC 3NAPC 5A32B 4AFMA 4XFHA 1CONA 1XU1A 2YROA 1GICA 3FBYA 4JDOA 4P9LA 1NQJA 4ISQA 4NWWA 1RJ7A 4J1WA 3ILFA 1QJZA 1C5HA 1D0GA 2B46X 3ZSMA 3KT4A 5C33A 5FO9B 4TWTA 2FHRA 3TNPB 4GALA 1XYNA 5CU1A 5AFBA 4PBPA 1WCSA 3BOWA 4PCRA 3A0KA 4BYYA 1BBT2 4K8FA 1D2QA 1RC6A 2VGDA 4BCUA 5F9TA 2ZGUA 3ME2A 4LO5B 1KS4A 2VOWA 1VRH3 4GH4A 4N7UA 4L97A 4RHV1 1LOFA 1W6OA 1H30A 1XYPA 1UD1A 2GSYA 5H9RA 1COV1 3DUIA 1CD3G 2Q4SA 3O14A 4HN1A 1G9BA 2OUHA 1OLRA 1YI9A 4AEJA 1VAMA 1O3SA 4IEPA 3ZYPA 4JGZA 3HAGA 3TB0A 4CEWA 4XHXA 4U36A 4CDXA 4AFCA 3CJIB 3VKFC 3NJZA 4F3JA 1UCXA 4XPVA 3ZMOA 1AX1A 1VBE2 5SV5A 3ZXGA 3H8UA 4UBGA 4XXAA 3OPZA 4AHWA 2JECA 4JQRA 4MXWB 2ZX3A 3ACLA 2EIGA 3PMEA 4AGRA 3N7KA 3WG4A 2HWB1 1BK1A 2XKOA 1AXZA 2PA7A 1C4RA 1MS0A 2CV6A 1QJU2 4R4XA 3ZDSA 3AKPA 1YRZA 2XJUA 2Z42A 4Z1VA 3FFQA 5GZFA 3MIFA 1NCRB 1C28A 1FOD3 1SLCA 2C5DA 3B02A 3CL1A 1D4M3 1AF9A 3RI9A 1DYKA 3RDIA 4HK8A 4B29A 4BIOA 1HIXA 4IEVA 1X8EA 4PIYA 2R063 2BVVA 3MFAA 4ONUA 4CEYC 4XFFA 2E51A 4NOTA 5T5OA 4FT8A 1HX6A 1TME2 2QKDA 5JOZA 5E88A 1AR73 2KM2A 2BNNA 3R4UA 4AEDA 2JG8B 5CVRA 1J1LA 1W0OA 1PO22 5IK7A 3GHNA 3AYEA 4RS5B 4YG6A 4W65A 5JPNB 3ZXAC 5H9PA 1SLIA 2QUOA 5HCFA 1VBD1 2R0HA 2CGNA 1KITA 4GXLA 3M2MA 4QX5A 4Q4X1 4FPYA 2LUWA 1ASJ2 2D3RA 1K5MB 2CWMA 1OHFA 1RHI3 5I8SA 1O5LA 1OQDA 4M0NA 2VULA 4ZXKA 3ZVXA 4HKOA 1RUH3 1QU0A 1JOJA 4YW5A 3PVOA 4DFSA 1TQ5A 3AJYA 2MEV3 2R073 5CNAA 3N3HA 4A7KA 2ZX0A 1H1IA 4FP2A 3IPVB 1ZBA1 3USSA 4Z92B 1VBB2 3ZFGB 2ZCWA 3WW4A 3RG0A 1MZ5A 2CL2A 3H1WA 1O91A 3AZYA 4WZFA 2XUMA 2RE9A 4CTEA 4AVVA 1OQ1A 2Y0OA 2XJRA 1BMV1 1LRHA 1OA3A 2ZX4A 5FREA 1S0FA 2GU9A 2WNUB 5I0TA 4R52A 3VBOB 4QPIA 2BUKA 4GWMA 3WG3A 3HT2A 4AI1A 1W6QB 3H9AA 3WX5A 4QPGB 2RS13 2AR6A 4URTA 2ERFA 1FPN3 3ZFEA 1ZZBA 3V0AB 4RR3B 3VBSB 3W9AA 1GANA 3KCCA 1NA1A 3WW1A 2ZZJA 4GKXA 4IERA 2JENA 2D7FA 2A6YA 3HBZA 2PHDA 2VUAA 3FBMA 1U0AA 4RD7A 4AI0A 3MICA 2YGLA 5KBFA 1NQDA 1V00A 5IK8A 3LB9A 2NLRA 1XYOA 2PN5A 3IDBB 4YVSB 4AHYA 4YGBA 3V0BB 4WM7B 4CDQB 1PO11 1A3KA 1Q8PA 2GALA 3MPBA 2WZR3 4BMBA 2AYHA 1MVQA 3N36A 1VBC1 1AYM1 1HKDA 4HBNA 5KHIA 2VVFA 1FNZA 1REFA 1W6NA 2R1BA 4R9CA 3KB5A 4Y24A 4MGIE 2CYFA 2DU0A 2DUPA 3FUOA 4OHYA 1SLBA 2AENA 1ZNPA 3KQRA 2R041 1LTEA 1A6CA 4OLLA 1RUE1 1H8TB 1ZBE1 3RPQA 2DCTA 5E16A 4N9HA 3MPPG 1OOPC 1IQAA 1RL3A 5DXDA 1RINA 2XPJA 4XDQA 5I93A 4K6BA 1DQ6A 3AM2A 4QHBA 1O3QA 4FXKB 4RHV3 4D94A 1COV3 3GYDA 1JYIA 1NG0A 1QJX1 2PHWA 4AQ6A 4YG0A 5EWSA 2C9AA 1PVC3 4HN0A 1AYN2 1MZ6A 3H7JA 4XFGA 4B4PA 2WWSA 3VBRA 1W6PB 2PELA 2VPVA 3NV1A 1N1SA 4QD2A 1RMU2 4Z82A 2XBO2 4LO4B 3JD71 5KHKA 1OSGA 1MEC1 3VBUA 1RUD2 3JQWA 4XJ9A 3V56A 5ABJA 2WNVB 4Y22B 3ZYJB 2NQYA 5A33A 2VOKA