2I4KA

Solution structure of the px domain of sorting nexin 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
128
structure length
128
Chain Sequence
QFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-1
publication title Determinants of the Endosomal Localization of Sorting Nexin 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 18
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2i4kA00
2WWEA 3P0CA 1KQ6A 4IKDA 3DYTA 1OCSA 3FOGA 4PZGA 2CSKA 3IQ2A 1O7KA 4P2JA 2DYBA 2V14A 1GD5A 2IWLX 4IKBB 2AR5A 1XTNA 3LUIA 2I4KA 3HPCX 2RAIA 3HPBA 4PQPA 1OCUA 2CZOA 2RAKA 4IKBA 1H6HA 2REDA 2YPSA 1XTEA 4ON3A 4OXWA 4P2IA 2V6VA 4HASA 2RAJA 2ETTA 4AZ9A 2REAA 4BGJA 4PQOA 2L73A 1KMDA 4AKVA
chains in the Genus database with same CATH superfamily
2WWEA 3P0CA 1KQ6A 4IKDA 3DYTA 1OCSA 3FOGA 4PZGA 2CSKA 3IQ2A 1O7KA 4P2JA 2DYBA 2V14A 1GD5A 2IWLX 4IKBB 2AR5A 1XTNA 3LUIA 2I4KA 3HPCX 2RAIA 3HPBA 4PQPA 1OCUA 2CZOA 2RAKA 4IKBA 1H6HA 2REDA 2YPSA 1XTEA 4ON3A 4OXWA 4P2IA 2V6VA 4HASA 2RAJA 2ETTA 4AZ9A 2REAA 4BGJA 4PQOA 2L73A 1KMDA 4AKVA
chains in the Genus database with same CATH topology
2WWEA 3P0CA 1KQ6A 4IKDA 3DYTA 1OCSA 3FOGA 4PZGA 2CSKA 3IQ2A 1O7KA 4P2JA 2DYBA 2V14A 1GD5A 2IWLX 4IKBB 2AR5A 1XTNA 3LUIA 2I4KA 3HPCX 2RAIA 3HPBA 4PQPA 1OCUA 2CZOA 2RAKA 4IKBA 1H6HA 2REDA 2YPSA 1XTEA 4ON3A 4OXWA 4P2IA 2V6VA 4HASA 2RAJA 2ETTA 4AZ9A 2REAA 4BGJA 4PQOA 2L73A 1KMDA 4AKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWE A;  3P0C A;  1KQ6 A;  4IKD A;  3DYT A;  1OCS A;  3FOG A;  4PZG A;  2CSK A;  3IQ2 A;  1O7K A;  4P2J A;  2DYB A;  2V14 A;  1GD5 A;  2IWL X;  4IKB B;  2AR5 A;  1XTN A;  3LUI A;  2I4K A;  3HPC X;  2RAI A;  3HPB A;  4PQP A;  1OCU A;  2CZO A;  2RAK A;  4IKB A;  1H6H A;  2RED A;  2YPS A;  1XTE A;  4ON3 A;  4OXW A;  4P2I A;  2V6V A;  4HAS A;  2RAJ A;  2ETT A;  4AZ9 A;  2REA A;  4BGJ A;  4PQO A;  2L73 A;  1KMD A;  4AKV A; 
#chains in the Genus database with same CATH topology
 2WWE A;  3P0C A;  1KQ6 A;  4IKD A;  3DYT A;  1OCS A;  3FOG A;  4PZG A;  2CSK A;  3IQ2 A;  1O7K A;  4P2J A;  2DYB A;  2V14 A;  1GD5 A;  2IWL X;  4IKB B;  2AR5 A;  1XTN A;  3LUI A;  2I4K A;  3HPC X;  2RAI A;  3HPB A;  4PQP A;  1OCU A;  2CZO A;  2RAK A;  4IKB A;  1H6H A;  2RED A;  2YPS A;  1XTE A;  4ON3 A;  4OXW A;  4P2I A;  2V6V A;  4HAS A;  2RAJ A;  2ETT A;  4AZ9 A;  2REA A;  4BGJ A;  4PQO A;  2L73 A;  1KMD A;  4AKV A; 
#chains in the Genus database with same CATH homology
 2WWE A;  3P0C A;  1KQ6 A;  4IKD A;  3DYT A;  1OCS A;  3FOG A;  4PZG A;  2CSK A;  3IQ2 A;  1O7K A;  4P2J A;  2DYB A;  2V14 A;  1GD5 A;  2IWL X;  4IKB B;  2AR5 A;  1XTN A;  3LUI A;  2I4K A;  3HPC X;  2RAI A;  3HPB A;  4PQP A;  1OCU A;  2CZO A;  2RAK A;  4IKB A;  1H6H A;  2RED A;  2YPS A;  1XTE A;  4ON3 A;  4OXW A;  4P2I A;  2V6V A;  4HAS A;  2RAJ A;  2ETT A;  4AZ9 A;  2REA A;  4BGJ A;  4PQO A;  2L73 A;  1KMD A;  4AKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...