2I4RA

Crystal structure of the v-type atp synthase subunit f from archaeoglobus fulgidus. nesg target gr52a.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
b'SHMLAVVGDPDFTIGFMLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIMKQEYLKKLPPVLRREIDEKVEPTFVSVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type ATP synthase subunit F
molecule tags Hydrolase
source organism Archaeoglobus fulgidus
publication title Crystal structure of the V-type ATP synthase subunit F from Archaeoglobus fulgidus
rcsb
total genus 14
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 2i4rA00
3VR5H 5KNBH 2I4RA 2D00A 3W3AH 2OV6A 3AONB 3VR6H 2QAIA 4IX9A 4RNDB 5KNCH 3VR4H 5KNDH
chains in the Genus database with same CATH superfamily
2ZB3A 3ER6A 3EQ7A 2NM0A 5K6AA 1DNPA 2CZQA 2VRNA 3I6MA 4DCGA 4I08A 4EVSA 4ID3A 3WK8A 3A2KA 1SPBS 1XTVA 1V8BA 4BXOB 4ENRA 3PKJA 1J0CA 4L5CA 4M1QA 4N3NA 5D84A 1MDBA 2FWAA 2WJ6A 3ZR4B 4BGUA 2XB8A 2JFYA 5TJHA 4YMSA 5A4AA 1XDUA 4LJKA 4R1TA 2EDCA 4NENA 2FZVA 2WSIA 2YXDA 1KI3A 1TKAA 4QLAA 3WKCA 1I7DA 1FPMA 1YCGA 4Q1BA 3FJYA 1FQWA 3CSSA 3KK0A 4NEQA 3AJEA 4C20A 2FWBA 2BI4A 5CCEA 3NHJA 3RB8A 1QHFA 3N0RA 5JXJA 3MMNA 4L75A 4ZA2A 1E8NA 2O3SA 4OQFA 4KK3A 2IQIA 5AUNB 3V4RA 2G8LA 3L0PA 4BVAA 1HQCA 2V0NA 3K5PA 3TQHA 1KWGA 2ZS8A 2C8VA 2A67A 2WDZA 3EBOA 4Z0NA 1OD6A 3RFUA 2PD4A 3WRWA 3OETA 2J09A 1T4CA 3QF4B 2MSCB 1ISRA 2RH5A 1F0YA 2YNMD 2CNBA 4OO3A 3MHTA 2HZBA 3L0CA 5DYWA 5CG1A 2VDWA 4UOQA 1G1AA 1PFKA 2A4MA 3PGKA 4J07A 4MWSA 2JFBA 3W4IA 4CEHB 2HTFA 2ECQA 4WLUA 2P5YA 4D2IA 2RAVA 5KYUA 4IWYA 5A5GA 3FROA 5IVIA 1LBTA 4HEHA 3RVPA 5B36A 1J5EB 2WMOB 3I28A 1U31A 2JH3A 4LDAA 4M54A 3DA8A 4MVJG 4RF2A 2Q3CA 4G5RA 3EWSA 1JKXA 4E3WA 3CB2A 1E4EA 2TMDA 4P4SB 1DUVG 4MDYA 2DFVA 4XDGA 1ZITA 2JFWA 5FTWA 4BKUA 5EZYA 1E3IA 2V7PA 4GI1A 1G98A 4M21A 1G5RA 2FJ0A 1CUAA 1Q0RA 2AJLI 2FR0A 1YHZA 1YHYA 4UPEA 3CH4B 1SCUA 1CNMA 1CUCA 2G80A 1IZ7A 2ZPAA 5FLKA 4B46A 1Q0QA 3MPUA 4NOLA 1X7GA 2DBRA 3IERA 4KZKA 2Q3HA 4KDCA 2ILTA 4KFRA 2GHRA 1EFTA 4QJIA 4AKEA 4IFIA 4KRYA 4B6QA 5AW3A 3TCKA 1GSOA 3THOA 1JU4A 3HCWA 4AMBA 1JDBB 4GI7A 1GPJA 3LP5A 4IJWA 4DYVA 3NBMA 1UBSB 1WKBA 4JSTA 3UV3A 3W9BA 3HCAA 4US0R 1K5HA 3ZQ6A 1QTIA 3SJBA 2QUKA 4JUFA 4WOKA 3NHSA 3ESXA 4OMFG 1LPOA 4OXQA 4HPWA 4HUQA 3GRZA 4QARA 4UTZA 2NO9A 1MORA 1YC5A 2OYCA 4IRXA 4K1XA 3U17A 1YDEA 1ZUNA 5CB4F 2QR5A 5IARA 1WUJS 3IT1A 4YJFB 1QHHB 5FR2A 1CT9A 3CH5A 4TUYB 4X8OA 4B3HA 3E6AA 2ORWA 3MJHA 3WYCA 4X7MA 4YAWA 3S29A 5KPDA 4KE6A 5KQRA 4RNDB 1N0VC 2NSJA 3HCPA 3IBTA 4QUIA 3VR5H 5FTLA 3I5YA 2EZ4A 4UCFA 1TM2A 2N3ZA 1SQFA 2AC2A 2NPIA 1JXQA 1AB5A 4ZVVA 3EX7C 3RU7A 4BNMA 4QM7A 2H2DA 1KQNA 4BXOA 4FFWA 4M1OA 3AESA 2AJDA 5FDFA 4P3XA 3KBOA 3KJIA 1ZGCA 2GJKA 3KZ1E 4HTFB 4U7HA 4WI1A 3L0OA 3LHKA 2O50A 3LRXA 5GOZA 3PTZA 4QDTA 5AVKA 1E7QA 2J6HA 2OCPA 1GPMA 1RXCA 1EVJA 1Z45A 3MIZA 4E13A 3IULA 3A9TA 4MO9A 4UDXX 2DR0A 4BRWA 1CDDA 5KNBH 2CDCA 1UP7A 3ORQA 3F5QA 2IVFA 4R83A 4UW9A 4NP6A 4BMXA 3AB7A 2WTBA 1FDSA 3QNMA 4EZIA 2BEKA 2ZAOA 6ADHA 4TQUS 1BXGB 5CCDA 5J58A 3TZKA 1N5JA 2HK6A 1GPAA 4TX1A 2GI4A 4BNNA 4C7OB 3NJRA 1I36A 4XXHA 1TEXA 2Q2OA 3IQZA 3A04A 2XYQA 5HTKA 2EEPA 1MZVA 3WWDA 3UPDA 2O8FA 1CNFA 4YCAA 3V1LA 4IVRA 4LYYA 3SVZA 3S5JA 4MV8A 4DC0A 4R01A 3AEQA 2BFWA 3ESYA 5CFPA 4OQDA 2R60A 2ZXUA 3IJPA 4DXDA 3RDPA 3QLEA 1MF7A 2GO1A 4YAJA 5EKDA 3Q7IA 4YRIA 2AW5A 3K8QA 1K6XA 4J7UA 1E58A 3DPSA 4AJ9A 3G9XA 4JD5A 4CODB 5ADWA 1T6YA 2PBLA 2BVNA 2G9NA 5L3QB 1IY0A 2NLOA 1G3MA 4CUKA 3QFTA 4WOCA 2Z56A 3ICEA 3OESA 1TVMA 4ILKA 5FBWB 1EGAA 1I5EA 2B0CA 2HHCA 4MEAA 4LYEA 1U0SY 1KYIA 3CX7A 2H9AA 3G5AA 4HJXA 5BVGA 2HJSA 4LC9A 4JVSB 3JASA 2BEWB 1X7DA 3FPJA 3AR2A 1LSJA 2JZCA 3GPLA 1P77A 1N5MA 2IEAA 3BXOA 5CDYA 4RXTA 4KUEA 3BUSA 1SUBA 1FQOA 3B6MA 1JSXA 2O0KA 3WOVA 5AJHA 2JFNA 3E8SA 4B6RA 1AA9A 1WCV1 4MR9B 4UCWA 3QX3A 3V80A 1CERA 4E22A 5JADA 1L7EA 3ASUA 3BFJA 1VCHA 2IZ0A 2K2QB 3MTBA 5TARA 1S1MA 2YZKA 1J07A 3I1YA 3KRTA 2OB2A 2ZJZA 3A7DA 1FYEA 3PRJA 3A3PA 3CTPA 2FUNB 4Q4HA 4B84A 3BJIC 1GSAA 3LP6A 3V2GA 1NYLA 5LOVA 3TW0A 3PV0A 5DP2A 2J30A 2X0IA 5IDYA 3MN1A 3GFTA 1XSEA 3A1SA 1D2CA 4ZTUB 1RWVA 2QSUA 4PWYA 2A92A 4K6GA 4CN9A 2W6MA 5SYAA 2ZM6B 3FTPA 1J8MF 3WFZA 2QJTA 4H7EA 4JB8A 4YJ3A 1ZR4A 1QUFA 1KOGA 1BMTA 2DU8A 3E03A 4LE0A 3KOMA 1WO8A 3ZEIA 1GZ7A 3G8AA 2VNJA 5I4IA 3PCTA 4G6ZA 3CW9A 1BEUB 2KB0A 4D9EA 1DLJA 1XZDA 1UODA 1G3IA 2BPOA 2PX5A 1CZOA 3C5HA 4XOUA 2Y93A 3WMWA 4FZ3A 1QHNA 3R5TA 5DI3A 1GKLA 3F1KA 1YASA 2NQ8A 3TGLA 1BJKA 3ASYA 4O1IA 3SS9X 4LDRA 3S8YA 5LU9A 3LCVB 3M9XA 4M9ZA 2RAPA 1LBIA 5B7QA 5LLDA 2VSQA 3Q5DA 1WMAA 3BKXA 2CLKB 2HMSA 3I4LA 1GM5A 3OQPA 3PE6A 4JP3A 5KTPA 4REQA 2J8ZA 3UJ3X 2G5TA 2QN6A 1A2KC 3LP8A 2NXCA 3UK7A 1M2HA 3KD3A 3L7MA 2OBBA 3PFFA 4BLRA 1SG0A 3QNWA 4GOMD 2I4MA 1FOEB 3BC1A 1V3UA 3NM4A 1ENYA 3DDOA 1NF3A 3PZRA 1JH8A 1XNGA 5K45A 4CIDA 1YACA 3LBNA 1GA4A 3JQ9A 4IOMA 1UDRA 1GT91 1MFPA 2QX7A 2X22A 5CIWA 4B6SA 1Q2XA 3DB1A 3JQ7B 3LQFA 3AOGA 5I7FA 3TG2A 1GAQA 1JV2B 1TA0A 2B3TA 2Q6OA 3M9WA 3TOVA 3THXB 3MMSA 4NONA 2QL7A 3DH0A 4MDHA 3UT0A 4TM7A 4C6SA 2H4JA 3KQKA 3AJRA 1QAQA 5GONA 3QXJA 2AZ4A 4JLAA 1RAEA 1IPEA 3DMDA 2P4SA 4BP9A 3PQ5A 4C6HA 3WRXA 2FPUA 1BS2A 3FI0A 4BBJA 4HNHA 4B48A 1WXWA 1VGVA 2PLRA 3HJFA 2X5NA 1EDDA 1Z3IX 2R1UA 2QDKA 4GM4A 2IP4A 2EQ5A 4R9UC 3PFNA 4RFVA 2XUIA 5ALYA 3SBOA 4K88A 4OHOA 1NP7A 1X15A 2JGRA 2Y9PB 4JVOA 2UV8A 5TGTA 5BV1A 3K2EA 4Y1RA 3GLTA 4OBWA 5FEUA 4K2HA 5H9WA 3OCWA 1IDOA 3BWEA 4EYQA 5ALPA 1A50B 1XOIA 2H52A 2O2SA 2YMPA 5FOSA 3HPRA 4FFOA 3FB1A 1Q6ZA 1ZU5A 3BRWD 4G4SO 2NUPB 1EKXA 1QRRA 3U3MA 2ZRBA 2ZYRA 1R8QA 5F76A 2NU8A 1PV2A 1Z8NA 4NATA 1X1AA 4EABA 4DRXA 1CUFA 1EGVB 3WY9A 4KU4A 3AVYA 2JD1A 4M88A 3FB4A 3B6EA 1J24A 3LKBA 4MAMA 1KZGB 1GRRA 4HC4A 3WKEA 2ZJAA 2PCLA 1G0OA 3E15A 3QUTA 4U4AA 3RK4A 4GNRA 3WDKA 2N75A 4ZEVA 2AUMA 5JJBA 2HMTA 2BKVA 3OHSX 3ECAA 4XX1A 1XMQB 4JP8A 3UMRA 4PNHA 2VCHA 4ROTA 5CXQA 1A9OA 3OQ6A 1AKWA 1NQWA 2OAQ1 3BQMB 2H48A 3NRJA 3L8EA 4YH1A 5DU2A 5AW9A 4BFVA 4E6PA 2NO7A 5IP5A 1Y3AA 1GQOA 5BT8A 3UMMA 4OI0A 4QJBA 2GJ9A 1Z0FA 1XWIA 4P58A 4YI5A 4ARZA 5JBQA 1G8GA 3A9VA 3LY8A 4I2VA 1Z12A 3AKZA 3KTDA 1ZIPA 2EIHA 2MJLA 2P1ZA 4MVCA 4QYSA 1C9NA 4RDHA 4BECA 3B85A 4GMGA 1JHAA 1DCFA 3FOAA 4UUPA 4XD7A 4YMIA 4Z4QA 2JKVA 4DQDA 1H4SA 2QRVB 1KQGA 4MR8A 5JMTA 2QRZA 1NMSA 2W48A 4Q4JB 5H70A 1E64A 2YXPX 3LL4A 2KMLA 3PSHA 3AWIA 3BGDA 1NIJA 4WLOA 4B73A 4RVDA 4AB1A 4QJ4A 5E9WA 1DB3A 3CKKA 5EIFA 2ZSAA 4GI2A 4F9TA 2HRRA 3O8BA 4JGGA 1JG3A 1LW6E 1Y63A 1P19A 1UPTA 3WIUA 2VHWA 2FLVA 3QKIA 4BJ3A 3PDIB 5K0SA 2GZ3A 3ONWA 1OB2A 5FAXA 3EK2A 2XKKA 3K6SB 2NUPA 5AKYA 1UQRA 4CG0A 5MDHA 3HA3A 1GO2A 4GKKB 2YWJA 1HG1A 1WJGA 3IP7A 4GL2A 3D0QA 3EXAA 2CL5A 1F20A 4J29A 3MMZA 1I7NA 3LVBA 4GOOD 1Q50A 4U63A 2G71A 4DPLA 1DXQA 1U1DA 2LP4Y 4PIMA 4W8OA 3C3DA 3PC4A 3WGZA 1L3CA 2Z95A 3B1VA 4LJ9A 1NE7A 1LV8A 1P9OA 1VXRA 1CW2B 2IDJA 1IHDA 2P11A 3VR4A 3IAS6 1L7QA 3HMQA 1ZK4A 2Z1MA 3QQ5A 5ENVA 2QLBA 2C29D 2JFUA 3GP3A 3PFKA 5EE1A 4CI9A 3UBTA 4CDRA 3PIRA 4ZVMA 1OWPA 4R1QA 3K5WA 2X8JA 1NXWA 2QJWA 1C29B 4V24A 3DE6X 3INRA 1HQKA 5IUJC 4TV9A 3LLCA 2G1PA 1QTNA 4D3YA 4DA0A 1DQYA 2J6IA 1MJNA 3EXEA 2KBEA 1PQUA 4UM7A 2FHPA 2YC4C 4W7SA 5FHRA 3G1TA 3GLHA 4BO5A 3CNEA 4EY5A 3TLXA 1W4CA 5ELXA 4GF5A 1PUJA 3PLNA 4GMXA 1QX4A 1B0ZA 1DKQA 1Q83A 1ZXLA 3CUYA 4V0LA 4BWFB 1P1RA 2HWXA 1T9ZA 3I23A 3E7FA 4QDOA 3ADKA 3SSNA 1TTPB 4F9EA 2QMQA 3USCS 5CVUA 2PJRA 5DWDA 4WLFA 1JN0A 5BYBA 3KQVA 3ZJ5A 1H2XA 3SXUA 4U7DA 2HX1A 1CB7A 3CLHA 1CQIB 2CB9A 4FK8A 2FG5A 3AM4A 5A6SB 4PZ0A 5A4FS 3LXXA 4RD4A 4FEYA 5KREA 1XRSB 1ZOLA 4BQRA 5KQMA 1E1QA 1XK6A 5EUMA 4O2BB 3WA6A 2NX2A 2IYPA 2JI8A 1NI3A 3HI6A 5LBIA 3C24A 4M8IA 4Z54A 3C4JA 4ZYYA 3B38A 4UVEA 5IJ0A 5FF9A 4NZ9A 1QO7A 3ZXIA 1J2JA 1NBME 2QGNA 2C2HA 3AEYA 4GPTA 5F7ZA 3DFFA 2OGTA 4WPGA 1W1WA 4AG3A 4DV4B 2WLSA 4MICA 2GF2A 4AULA 1M2GA 1XEWY 4K03A 4LYGA 1LXCA 1FXWF 2P9BA 3KO8A 2VT3A 4DCJA 1AKMA 4MYUA 4EECA 1M2EA 1IUOA 4ZODA 2Q5JA 4HQ0A 1PJZA 4PYRA 1M1YA 3EF3A 3WMEA 3WXBA 2QX8A 2X6TA 2JD0A 1ZUNB 1KU6A 3NTUA 2BKAA 2IYQA 3S2SA 3L7YA 4C76A 2Y71A 3U1VA 3WB9A 2HSWA 4UHKA 5AQ1A 7ADHA 4G0VA 4RQTA 4XVRA 2RONA 3TLYA 3QHAA 4QTZA 4WLNA 1RTKA 2GEVA 3TW6A 5BNZA 2IF2A 4AMVA 3LSTA 1JMYA 1R0XA 2JASA 3H97A 3GWGA 3C7AA 4RXMA 2O8EB 1QH9A 2I7DA 2AJTA 4BZWA 3N2GB 3IO3A 3SR3A 1IWBB 2H1IA 2PIAA 4D4LA 4D97A 3CEPB 3SBEA 4DDKA 5JFOA 3IL2A 3CX6A 2MSDB 4B33A 1LPMA 1TAQA 3V1MA 3Q2KA 2IEYA 4FSDA 1VJ5A 2FSFA 1MN6A 2XNJA 1ICEA 2VF4X 2VO1A 4JP1A 3N07A 1GZHB 2QPAA 3G5TA 4LMRA 3FCEA 1F1JA 4UM9D 2GVDC 3ZHQA 2UUOA 4J2OA 1L5QA 3LHDA 3CLUD 5TJ9A 1R1DA 5JNWA 2OBMA 1RRPA 3MS7A 1QYIA 1QJ4A 2PUAA 3L4BC 1HL7A 2QPTA 2DLDA 1HDCA 2P5TB 4C4ZA 3RS2A 3CMMA 1WB9A 4O2AB 3UT5A 5A0TA 1E20A 2X1MA 3HWWA 4GWLA 2EJWA 4M0LA 2WDPA 3LLUA 3CPHA 3UWKA 6REQA 1NW8A 5K3BA 2CV0A 2UZ1A 4NESA 2VZ8A 3WLIA 4CNBA 3DWEX 1QOQB 2WSSA 1MABA 3QTLA 4PHHA 1U3CA 2BMVA 5BW8A 4EMUA 2IHKA 3EDRA 4EW2A 2VK8A 3L2OB 4M1MA 1XLTC 2NO5A 4R05A 1K4KA 3OIWA 4G1CA 1N8NA 4QYIA 5EP3A 1F3OA 4GYYA 1N4AA 2RK3A 2RKBA 3DE4X 1YVPA 3OTOB 3H2HA 4NBNA 4UFOA 3HNRA 3N6VA 1G8HA 3EZGA 1MA0A 4MUMA 2CVZA 1Q6YA 4RPKA 3GQBB 1DO0A 3ZC3A 4B6EA 3ZJVA 2AG6A 1U0OC 2XWJI 5L3RA 3GI1A 4GMHA 3VV2A 1CR4A 4YIKA 4UMFA 3Q41A 1DQNA 3LOQA 2HPAA 3CKMA 4A92A 1A4XA 3SKVA 3FLAA 4MV4A 5KEIA 4Z8XA 4C2TA 1G63A 1NM5A 2BFMA 4WMLA 1NOIA 3DMPA 3O8OB 5A03A 4FONA 3CRMA 4FT4A 1KEKA 1WW3A 1IHUA 3K0KA 1O4WA 3EGDB 1BJRE 4R9VA 1TUEA 2WICA 1FNSA 4LXYA 4KPYA 2BHLA 4CL0A 4J3JA 3AUAA 2ZBUA 3MXTA 3HA5A 1FW8A 4M1KA 1QZTA 1ESNA 3ITKA 3WL5A 3FF4A 1R6AA 1W2HA 2H92A 3LO8A 3OUTA 4NOJA 4AIRA 2Q8QA 1NQAO 2CLMB 3WGKA 3DGEC 1KHTA 1MXHA 2FZGA 4C4PA 2HJ9A 3G17A 2JK1A 2AIRA 2WMYA 3FA2A 5CVEA 4Y2SA 2HLDA 2HA4A 5JSQA 4YMGA 2MDTA 4DZRA 3T7RA 1JLRA 5AVOA 4EPYA 3EJWA 3R3HA 1JSLA 3VNRA 1J8QA 1I0IA 2ID8A 2XD9A 5LP6A 3L4JA 2L19A 1XRPA 3AI1A 1NDHA 4I1PA 1S3GA 1FP2A 2DSTA 2RARA 4DBLC 1E61A 3Q8WA 4A2CA 5HIAA 1O97C 5BOVA 3C3YA 3F6BX 3MJRA 3I2JA 5HKLA 4B9EA 2OENG 1R6BX 4HUTA 1SUFA 1RI3A 1VJCA 4IYJA 1X7ZA 3L5KA 5TE9A 2WIKA 4P54A 5I8ZA 3ZE6A 8AT1A 2Q07A 1XZGA 3CLRD 1YCDA 5L45A 5EVJA 4HATA 2DFTA 1N7GA 1TZCA 2X8WA 4BN5A 2HPZA 1E9EA 2HB6A 2GEUA 3Q3CA 3OEHD 2W4IA 3T61A 2IEZA 3GBSA 4L6CA 1IBSA 4Q15A 4HDRA 3CX4A 1EUDA 4PQRA 5FTKA 3ZEAA 1X7YA 1N6PA 3OMLA 1OFUA 1OC4A 1Y8QB 4EI2A 3VHXB 1XTTA 1U2DC 5B55A 3M5DA 1KP2A 4MVJM 1H5UA 1EFAA 3R9XA 5HF8A 2EW2A 1EESA 3UAWA 1C1XB 5D8DA 3A4IA 1JR3A 2OXEA 3QU5A 2UYCA 2C7RA 2XLBA 1SQ0A 4Q00A 3PT5A 3FZGA 4TN1A 2CXSA 1E5XA 2CZCA 4B0PA 2V5AA 1IHPA 3Q0EA 4EIWA 1E98A 1I7SB 3LT1A 3M3HA 4BFTA 1IBMB 3IQGX 3NB0A 3HJTA 4AWBA 3KSAC 2ZSJA 3G8BA 3RTGA 2CFIA 4YRSA 2YYZA 3DTVB 2QTTA 4WXYB 4IDCA 1OLXA 1SBHA 2BOVA 2DGDA 3A6EA 3GUVA 3HN2A 3OOHA 3QPBA 4R8LA 3FCAA 4O4IA 1W87A 3VQTA 2ORVA 4GC9A 4DBZA 4F3CA 1FCJA 3PTAA 2IYUA 2R86A 4KO8A 2XE8A 4LSGA 3PHHA 1BN7A 1PL8A 1DT5A 2BLLA 1XDDA 5FO0A 2C77A 2YOGA 4IO0A 3FNBA 4QOJA 3OQHA 3T5TA 1PRYA 3B1JA 4WV3A 2QM7A 5LR6A 3MJCA 4D9MA 4Z5XA 4GVPA 1BGWA 1XVAA 3ETNA 3GXBA 2A0XA 4GICA 1ZONA 2E89A 2IEIA 4Y67A 4EATA 4JLNA 1E59A 5K0BA 4ITRC 5JQWA 5FLEX 2C20A 4TROA 4E2WA 3M1IA 1OXBB 3R5KA 1GZ5A 3IQDB 1UDXA 4KQ2A 1XVUA 5EUQB 3QKUA 2IOYA 4GMFA 4L2IB 1PJSA 2PUHA 3MRXA 1QOPB 1P4AA 3OJXA 3H1EA 3PVZA 2VUHB 5D2CA 1KTIA 1TPZA 2CLOB 4QOGA 5I7EA 3RRMA 4PG7A 3AFIA 5AOAA 4FD2A 5FOVA 5DIZA 1IN1A 1TGVA 3LXUX 4Z3OA 2HSDA 3LUKA 2CLDX 3BMCA 4WEOA 5U9CA 4M4SA 4XGQA 2ZVQX 1G4UR 4F5DA 5LOVF 1ZU4A 5MN6A 5DHUA 5FH9A 4AJOA 1LJLA 4RKFA 1HYQA 3CRVA 3U9LA 3RSZA 3ZYZA 3KHSA 3ZHZA 1VIAA 1W4RA 3O8LA 1RQNA 1UAGA 2EZUA 2OBYA 1RYDA 3MGBA 3WLTA 5AIBA 3INNA 3B2EA 3MM4A 3KJQA 1VI6A 5DKFA 1E4VA 2X58A 3GEGA 3KZVA 4XFKA 3UENA 2ZR7A 4C21A 1LJUA 1HLGA 2IDMA 3IIEA 4UARA 1JKJA 1YULA 2JIQA 3EIHA 4BX8A 2B7CA 1PWXA 4YGXB 2I62A 1KQOA 3C3PA 3PNYA 4B80A 1PNRA 3ZDZB 3BCSA 4UUAA 1XJCA 3EDCA 5TY0A 2UU9B 1QP8A 1RJGA 1H2FA 1GVNB 1E1DA 1JEQB 3CBQA 3L01A 3UJ6A 3WJ2A 1W1UA 5HW0A 2Q7DA 1P39A 2Y76A 2IS6A 4YAIA 5E4TA 2FMTA 1F51E 1JP7A 1THMA 2I1LA 3IALA 4O08A 4RSMA 4UEJA 4DHWA 4Q19A 3KXIA 4BO9A 1MCZA 5I4KA 2ZYAA 2C3YA 1R6UA 3KJXA 1FUUA 2W2OA 2BC9A 1LD3A 1MG5A 4DIDA 2C9BA 2HJGA 4H27A 2M6SA 5LYJF 1ZCBA 3CVVA 3O26A 1WXFA 1EVYA 2XT9A 3W5JA 2O59A 3N2KA 2G4LA 3HDQA 3I6YA 4LKOA 1W6UA 2PMDA 5FFFA 2BH9A 4IDAA 3SX2A 4JYAB 4PBSA 2MSWA 1NSYA 1BXZA 4L76A 4PYLA 1P3DA 5CPBA 2F4NA 3QJGA 3IVXA 1WZUA 5FCDA 3O6VA 3SVLA 2ZXEA 5DYIA 2IYVA 3D6MA 1OBOA 1SKMA 2YZNA 4J1NA 1I4EB 5BT9A 2V7QD 1Z88A 2WM3A 4BMNA 2P41A 3WGUA 5TT1A 4S04A 1I6KA 1VLVA 2VH1A 3KTOA 3P9QA 4QRIA 3F2IA 3FHOA 5SZIA 4TS3A 2W2PA 3LC1O 3ONVA 5KBYA 2Z9DA 5JTUA 3AF0A 2ZRJA 3IHLA 4ZYTA 4F3RA 3NWBA 3HYCA 2PZEA 4HEQA 4WVLA 3HSYA 3WGLA 2IA5A 2B4TO 4IPTA 4ZI3A 5ABPA 2IW1A 1QGZA 2ZROA 1MX5A 1T3LA 2AG8A 2VP6A 3HXPA 3QXXA 5KCMA 3ZWPA 2E7ZA 1FJHA 2QRMA 2XQJA 3HU5A 2QUAA 2BTQB 2JFVA 3GIWA 4XQ0A 5JALA 1N7JA 2WABA 5K0NA 4HBGA 1TIPA 2EFHB 4Q18A 3DC7A 4ZQEA 4DDUA 3RANA 1KBQA 3V4LA 5IHXA 4XQCA 2ZUWA 3IAFA 1RVV1 4GP6A 4LWZA 5DYTA 3VKFA 5CFRA 2B98A 4G5YA 1NW4A 5AVYA 4HB2A 4LMPA 2TMGA 4N0EA 4R4JA 5MGNA 2VK4A 3EMDA 3LQYA 4JBXA 3UWMA 2YX1A 1R7RA 2DF8A 1KA9H 2GPJA 4XWOA 5AVWA 1CETA 4OB8A 3L7CA 2O20A 4KKVA 5JNSA 5JNRA 3AEKB 4XPIA 3DAHA 1IXYA 4LOKA 3VZSA 4DJ5X 3RUIA 3W1EA 4O4IF 2ZRCA 5AI5A 4RX1A 2AK3A 2Y4OA 3TL3A 1JQLB 2W2XA 1YRLA 1GNVA 1JG1A 1T29A 2KLHA 3NNDA 2Q4OA 4Y6QA 4PSKA 4TKLA 1QV9A 4G0YA 5JCJD 3U61B 2HO4A 2CUNA 4V3CA 1GIAA 4HEA1 3SQWA 4G2NA 3UJ9A 5FAKA 5A4JA 5JYCA 1Z8HA 4ALLA 4Y1GA 4Z3DA 3UC5A 3VU9B 1SEPA 4W99A 5COBA 2PGDA 3GJ8A 1BOFA 2JJ8A 5EPUA 5B30A 4AJ1A 4W82A 1WZNA 2F1RA 3ESRA 3YASA 4Y9SA 2OCYC 4S24A 4AWAA 4F9FA 4PO8A 3VVMA 1GUBA 5IJZA 3ZWBA 5KVSA 5AXAA 3PFGA 1NQVA 2CF5A 5HIIA 2D1YA 3WQBA 1C3OA 1FRVA 1PTKA 4D8VA 3RVSA 2YY5A 4PC1A 4UEOA 3P2YA 4D0RA 2ZJ0A 4G5HA 1UXKA 1VE5A 3ZWQA 2FWNA 3D2LA 4PR3A 1ONOA 3K3PA 2PX0A 3UW1A 1C0KA 3DPUA 3PNVA 1YGPA 1D04A 2ZBEA 4JASB 1U7DA 4M55A 5F1YA 2P75A 1SU7A 1RHJA 4M9RA 4YMWA 4AT1A 1EK6A 2P8SA 4B6FA 2IPAB 5GY7A 1U9JA 3ABZA 3R0IA 1ITZA 1HT2E 4L28A 4XWGA 3QELA 5GJCA 3A27A 1R18A 2JBAB 2FF7A 4BMVA 2Z2JA 5TNXA 4B9AA 4ABTA 2D0OB 3GRUA 4LXXA 4MKXA 3ZTTA 1IOVA 2Z09A 2MYNA 2IX9A 4QUDA 3D4LA 2XDYA 3IQIX 4XIJA 2PWPA 5HDQA 3R7DA 4BP8A 2IZ7A 4L4YA 1P0QA 2X1HA 1GNQA 3SJUA 1ID8A 4JVLA 2EKQA 4WZAE 5KS2A 1E1RD 2FEOA 3ROTA 1Z08A 4U0KA 3OQIB 2G36A 3S28A 4AUNA 4FWIB 3FKSA 3VR2D 5KTNA 1G8KA 2AFHB 2EC5A 4CG3A 2PKQP 1V3VA 4ZGWA 1QFJA 3ROKA 1GDTA 4Y2UA 1SEVA 5TB5A 3BTUA 1T1IA 2OCKA 3CRW1 3RTEA 2Y92A 5CYFA 1TQDA 4G65A 1J8DA 5L4LA 5TIIA 621PA 3OCYA 1VJRA 3NYRA 3RJTA 1UMDA 3PP8A 4YJ3F 3RYIA 1KJ8A 1P80A 1O03A 2AJ8A 3RCBA 2GYYA 3SEZA 2ETVA 1UWKA 2J3IA 5IWCA 1ID1A 2X5JO 3E9RA 3UM9A 4QBHA 1DUIA 4H7FA 2C00A 2PTHA 4L07A 4C4TA 4E21A 3P9KA 1UC5B 3HU2A 3NGMA 4ZPJA 5BSEA 1X6VA 2DHCA 1E79D 3FW1A 3HDGA 2DFDA 4LVOA 2GCEA 4WWHA 5AICA 4MVJP 3RBXA 3F3YA 2G5GX 2BONA 3PX2A 4OAOA 2MTBA 1M3SA 2P30A 4EO9A 2OLJA 5KO2A 1MQ9A 5KYYA 1EHYA 4EENA 1FTNA 1D2NA 5DT2A 5DV9A 1F1BA 1FRZA 1YQWA 3BH7A 3G8CA 3FUVA 2RHBA 3GDFA 5JD3A 4B71A 1OB5A 3T7AA 3UPUA 1LUAA 4KKXB 4E5UA 1RWXA 4TKVA 4JGIA 2X8JB 5DIFA 1RM4A 2FPMA 4RENA 1V4NA 2AFIA 1H42A 1Z35A 1KORA 2VYND 2P1RA 2PE5A 3AEUA 4TLMB 1W88B 3KQQA 2GILA 4D8UA 2P77A 1E0KA 2PLFA 4JI7B 3A3OA 5D7NA 3VV3A 2C95A 5IABA 1N75A 1J5PA 3HFSA 3MBIA 2ACVA 3TTVA 3RAFC 3U48A 2OHGA 4XVCA 1FXSA 4DDVA 2R47A 5ECGC 4AY4A 3BWCA 4NZOA 4DM4A 4J90A 1BKSB 1WF6A 2HV9A 4ZANA 3DOEA 1L5GB 2O06A 3PC8A 2Y66A 1E3JA 1E9FA 4R0VA 4JBHA 1PG2A 2PSHA 3A6KA 4M0EA 3V6MA 1XYGA 4HAZA 3T38A 3RSGA 1L7NA 3PNLA 2QM0A 4UPDA 2Q28A 1T3GA 4BQQA 3BGVA 4JBLA 3IA7A 4L95C 4PFKA 3QELB 4YGYA 2IH2A 3L4KA 3ZBUA 1T2UA 2QE6A 3UB4A 1T1GA 3DFUA 4C4SA 1E2NA 1ACMA 2OO5A 4GFDA 2WEKA 1DXOA 2F64A 1KU0A 4URYR 1ONBA 2CB0A 3DFKA 3EHEA 4E5MA 2R8ZA 3RG2A 3L4SO 5DT9A 3BORA 5E8JA 3UWPA 4BNTA 1JE1A 4BV9A 4ZGGA 1V7QA 3CCBA 4A8PA 2OT3B 3BN3A 1KI6A 4H0CA 4MW1A 3TW8A 2ECPA 1PVOA 1AKUA 1MH1A 2HPVA 3MJTA 1MAVA 2JGJA 4TWAA 3BAZA 3MCVA 4TYQA 4FFBA 3BEOA 4DLAA 2HEGA 5G1OA 2EZ8A 4LKRA 5KYGA 5CTJA 4J91A 3V8PA 1Y5MA 4FOOA 4R8SA 3M82A 1V41E 2JLBA 1P1JA 2BFEB 4OMCA 2WWXA 3RBZA 3AJ8A 3U37A 3DHWC 1MIOB 1GPNA 2V55B 3FHLA 1BVUA 2GD2A 3G9ZA 5DM2A 1YS7A 2IHYA 2MYTA 2QPLA 3HDVA 2DQSA 4JLMA 5E3JA 2APJA 2XYRA 3UMJA 2ZTUA 1E6CA 1U90A 1EJ6A 1C9MA 2X6QA 4FGSA 4TTPA 2M9MA 4AMYA 2PG3A 1NWCA 1E5TA 5ALXA 1EEHA 2I71A 4KGZA 4Y2GA 3SHVA 4GI3A 3H6HA 2C5AA 3N9IA 3VTFA 4WBNF 1QLWA 1PJTA 3M34A 2CNNA 1HK7A 3CX8A 4J6EA 2QD1A 3QNUA 4PCVA 2RHCA 3R41A 5BW6B 1RJ9A 1MB3A 2G67A 4KQIA 4U6SA 3FOZA 1QQ6A 3RUHA 1R12A 3CR3C 4Y2HA 2W58A 5C1BA 2FW6A 2C78A 3E5RA 3GNTA 3T4XA 3ZGNA 3D02A 2GUGA 2YXEA 1JKIA 1YVRA 1IB6A 6NULA 3V4ZA 1BFDA 1UDCA 2QG9A 3B9BA 4JN6B 3VO2A 5F7JA 5JQGA 3V9PA 4NCAA 1VECA 4G97A 2JLZA 3HHEA 3KTAA 2XIJA 3I9V6 4HFNA 1W76A 5ELMA 3NJ4A 1XMIA 1JBKA 4LQ4A 4LOAA 1NVAA 1DJMA 2I4NA 4IXMA 4ROSA 5CJ2A 1XRLA 3JRWA 5FI1B 4LE2A 1UMCA 1GKUB 4KMOA 1W52X 4TV9B 3PZBA 3T99A 4U2KA 4MVJD 3H4VA 1Q3TA 3HDTA 3QVOA 4O4IB 3K9GA 4LQLA 4RQUA 5I45A 3B7GA 5JJCA 4FINA 2PX4A 2HADA 1L7DA 2HF9A 2OXFA 4FYJA 1X3SA 4MS3B 4NWIA 4RMGA 4TYPA 4KR9A 2RGWA 3U13A 3I62A 4OX9B 4WCFC 2JCYA 5TVGA 1S2OA 1Z2EA 4GDMA 4R2XA 6YASA 3P9PA 5BSWA 4QKQA 3BT7A 3PWTA 3SZOA 4B83A 2Z57A 3PK0A 5LKAA 3IBSA 1JECA 3AUFA 4X1KB 5IN5A 3ZLJA 3LKDA 1FYXA 1P7PA 3UWSA 2C4MA 1L7OA 1B76A 4HDMA 3QFFA 3N05A 2PZLA 3BOSA 3BXXA 1EUZA 1JNYA 5KNDH 3QE2A 1ZW1A 1ZGAA 1RZUA 1SOMA 3VNBA 4E3ZA 5JH7A 2YBDA 5D5PA 1O08A 3CLSD 4PYMA 1TVCA 3EZ7A 5I7WA 2GB4A 2RCYA 5KMGB 3WE7A 1ODLA 4RFLA 1XKTA 1JZSA 2FWPA 2HK9A 3FNRA 3UCEA 3JTMA 2DPGA 2GCOA 2HUNA 4L8VA 1GG9A 1UEJA 2VP0A 2XUDA 2C4UA 2DH5A 3PJDA 4WXPA 4AO7A 3RKRA 4YAGA 5F7XA 3DG9A 3ZDXB 4IIJB 4DY4A 1NJ1A 1R8SA 4TYNA 2WTUA 2IDZA 2IYLD 3ORRA 3I92A 5A5DA 5AJYA 1E69A 1C30A 1LTHR 3G6WA 3GRPA 2W6NA 1U7OA 3KSMA 1E77A 4NHEA 3PNMA 3LYAA 1UJ4A 4G4JA 4HGYA 2D3WA 2ZBPA 4NYJQ 3CZRA 4FD3A 1JS1X 1I3MA 1JBQA 3ECCA 4Q4DA 5JPCA 8ABPA 2F48A 3CX3A 5CT8A 3TQTA 3NTLA 5KQGA 1NJSA 1EE2A 1JG6A 5HXAA 1TO1E 3KR2A 1H3FA 5CFNA 9GPBA 4FHEA 1YFZA 2XD4A 1D1PA 1OTXA 2H63A 2RHMA 2ZIGA 3EGCA 3GH3A 3H8SA 4GOJA 3TL2A 1O1YA 3IELA 3W3AH 4RTLA 1BA3A 3GXOA 4D4HA 1OH8A 1RQLA 3WG9A 2RG1A 1U98A 5CMLA 2W37A 3AKCA 1K7FB 1IIRA 5F5LA 2EKLA 1VFNA 3IESA 2OA0A 4ZYLA 4Z0PA 2BFDA 5F2NA 3TXYA 4U2FA 4OLJA 1TUBA 1UOPA 4TOIA 4H7DA 4XLTA 4C7BA 1FMTA 1Q3KA 4IDFA 4NBTA 3C3JA 1RYEA 3RIHA 1TEHA 1KYQA 2DX7A 6CHYA 2X13A 2PS9A 3B5IA 1Y6QA 1NBEA 4IJKA 1JAXA 1HMYA 4C88A 5FTNA 2E4ZA 4DPKA 4KFTA 3G85A 5DGXA 3EF0A 1J21A 1YKFA 3FCYA 5GIOE 4YT5A 3FX2A 4FMBB 2LCIA 4IDOA 2CJWB 4MS3A 3UXYA 3K1AA 3CVWA 5A4DA 2YJTD 2YXNA 3QFHA 4QPJC 4BN4A 3OZUA 5JISA 4L74A 2DWUA 3DJYA 4M9SA 1NVWQ 3WJ1A 2CEAA 1G6Q1 1WHSA 4XJTA 2NG1A 3UQYS 3WFJA 4AXBA 1P17A 3MUEA 4X1IA 2QRLA 1ZVVA 1M7HA 2YZMA 3U56A 1QM5A 1UKBA 1OBHA 5HGXA 3EHDA 4H59A 2BJVA 3THXA 3E1KA 1WPQA 2R7NA 1SKYE 3DZFA 1S8OA 4ATNA 2VNHA 2FXVA 1K7CA 1HL3A 1O94A 1XCJA 4JJGA 1J06A 1VFPA 3WAGA 2AVNA 3EXHA 2KQUA 4EFLA 3HVJA 2DY0A 1JSZA 2FMFA 2MWMA 2GN1A 3CGGA 2G1UA 3NGLA 3K71B 4FOTA 5K6TA 3AR9A 1TM4E 1KMIY 4WOPA 3VNVA 3GLGE 1U1GA 2FYTA 3LX5A 3BWYA 1T35A 3O4HA 5A5FA 4REQB 2IZ5A 1SCJA 4Q3EA 3Q6NA 2I8CA 3P9NA 4I4IA 3FPAA 4A8JC 5EJ5A 2R6CA 3V8RA 3KLMX 1DC4A 4EB3A 4ZEMA 1NGSA 3VNQA 4EAQA 3QPVA 3GOQA 2UAGA 2CMGA 3NHPA 4RNCA 2J59A 4LE1A 2WZBA 2FFQA 1UBLS 1YBMA 4JWTA 4KAJA 5BQXA 3R7BA 3E3OA 5L3SA 2Z4TA 5AHRA 1ISIA 1HDIA 3AF5A 3PCXA 1XD8A 4TLAA 4JJIA 4ZCSA 3VNAA 4J0CA 1P3Y1 4KC0A 4ETIA 2EAUA 4CQMD 3PVCA 1V16A 2ACWA 3RGGA 4CKCA 4X6XA 1H2BA 4CNQA 1NC1A 1ZSNA 1CR2A 2NQTA 3BWMA 1UZAA 1EB9A 3KAPA 3KYBA 1KI2A 4IBOA 1E3SA 3CZQA 1QTRA 4XCXA 5JARA 1RQ2A 4WK2B 4ZU6X 4BC1A 5B64A 1QE3A 1AF4A 2FPIB 2PMKA 3F97A 4GOKA 5IKOA 3OTQA 4C07A 5A4IS 3H1FA 5DGDA 3FOBA 1EHCA 2OP0A 1KY3A 1MJGM 1WZCA 3AQIA 2XOXA 4N3GA 5IJ0B 1OWMA 3PQ3A 2J3LA 5JI2E 3EWNA 4LGYA 3CUVA 3DKVA 3WB0A 1T1RA 5HX7A 1LDEA 1A82A 1RKXA 4KGVA 3TLCA 1PZHA 5I48A 1ILWA 1KIMA 4RULA 5HFJA 2AS0A 2Q29A 1SG6A 2WOOA 3CINA 4DIFA 5JDIA 2B8TA 2WINI 2NU8B 1WKVA 2BSXA 3JWGA 3WNZA 5BQFA 2VP9A 3S2FA 4Q0MA 2FSGA 2P68A 4DJAA 1DQRA 3NIFB 3MCUA 4NDAA 1I24A 4MUNA 1ZCAA 2OAEA 2R7MA 3HU1A 4HAOA 2ZWVA 4R5HA 1FX0B 3ZD7A 1F8FA 1LY1A 2H3HA 1SCUB 1RWWA 1Z5ZA 3AG5A 1M5RA 1XCGB 1N25A 2JH8A 4WKPA 1CRWG 1I2MA 3I76A 3ZHCA 3D8UA 3EOAI 4AO8A 4IGKA 4B3GA 4GZ3A 2V9PA 4YV1A 3CVXA 1BH2A 4NPCA 1RRMA 5I8WA 2J08A 1HRDA 4BNVA 3F0TA 4JOSA 4LF8B 3D31A 2PAAA 1OI3A 2OWDA 5CM9C 2K6GA 2LZ0A 4A6XA 4BV8A 1AZWA 1H8ED 1F4LA 4ZIRB 3EFHA 5ESXA 1ZX1A 3H6KA 1Z7GA 3H9EO 4UDYX 3LY9A 4NBLA 1ZI6A 5EZQA 1QF6A 4HKTA 4WN3A 1BAPA 3NKFA 1OXSC 1T4CB 3QF4A 1XA4A 4PZPA 2CDAA 1YQUA 2IYRA 2XYGA 3PUHA 2XCUA 4UXHA 2GN8A 3ESAA 2DTDA 3N5KA 1W4ZA 1MQSA 2C7GA 2KS6A 4PYQA 3AUKA 1EBUA 1FDWA 3Q7EA 1ANKA 1V7ZA 4OHKA 3T1YB 3VYWA 1VLLA 3JY6A 1T6NA 4KO1S 5EJ8A 1DINA 1N3LA 3DUWA 3RAEC 4KQMA 4Q16A 3SK0A 2Y27A 4OKNA 1KSJA 1VCOA 3JWHA 4TQAA 2YZ7A 2O3UA 3PCRB 4U7WA 1HY3A 3PPIA 1FFXA 1YB7A 3HUTA 1HT0A 4JB0A 2H06A 2ZR0A 3L7DA 2F43A 4ZREA 4JYZA 1SVOA 3AYZB 4BQOA 2D59A 3DTYA 1CK4A 3KV1A 4RD3A 3WV4A 1J0AA 2HF7A 5DI3B 5EE9A 3AUSA 1B42A 2I6QA 2EW8A 1F8XA 2XKBA 2I8LA 5D3KA 2O5CA 3L8FA 5GQSA 2JAXA 2FPKA 4IIGA 3AGQA 3EVZA 3DZJA 3EULA 5BO5A 1L1RA 1ZMOA 3DVAB 4L16A 2ZRHA 1G38A 4NMLA 1YZQA 2AFHA 2X2OA 4XIYA 1X9HA 3SQXA 3C85A 2WUWE 1NL3A 5DSXA 1Z8DA 3KLPX 2G0AA 3JWEA 3JAKB 1WCIA 4Q3NA 4YCBA 5HS4A 2F9LA 1Z4NA 3ZZ1A 4D0LB 3L0ZA 1ULHA 3PHIA 4DUGD 5C8VA 2JI6A 4EGAA 1PNVA 1F17A 1EH5A 2AOXA 2BM1A 3OAAA 3RVKA 1C41A 1H4VB 1M1XB 1QHHA 3FRIA 1GZ6A 1UXGA 2FN4A 2PWBA 5TVKA 1U5AA 4EHBA 3VJRA 1NN0A 3L7BA 2PKYX 4O3FA 4GKJB 4P83A 1V5GA 2IZZA 1ZNXA 1JYSA 2DHEA 2WZDA 3R2JA 4RZHA 5FBRB 5KYVA 4MUIA 1KDZA 3LNCA 4RM3A 1NF9A 3SYKA 2KHZA 5LDDC 4I0WB 4KXMA 3UOWA 1VG9B 4JXZA 2M6LA 3OZSA 4W7IA 3EXG2 1TUIA 1NASA 2HIGA 3EXHB 4UHHA 2R44A 5BN5B 1BROA 3GFFA 4JLPA 4XSHA 2XA2A 3QVGB 2REOA 4K9OA 3D7NA 3ZH2A 4LW8A 1U0FA 5SY9A 5C7OO 1Y8ZA 3R3XA 5BSMA 4AJEA 1Z5OA 3WHPA 2Z6QA 4LDZA 2R8EA 3NJ8A 4FBMA 4DWWA 1AN9A 3H4MA 4Q1CA 1U2TA 5DHPA 4JLJA 3GCZA 4RL4A 4GLFA 3O5AA 4P7JA 1PUXA 2GPTA 4O25A 4O4HA 4UAVA 3PPWA 4QXRA 2QSJA 3QE3A 1B6TA 3DT6A 7GPBA 4KDFA 4XD2A 4D9CA 5KSOA 2BT4A 2WVGA 4CEJA 3PPXA 2X8AA 4ND8B 1PJQA 4K6KA 3DV2A 3S5UA 4RGVA 2BFPA 3VOBA 4QBGB 3R9KA 1FC0A 2WA1A 3GRCA 1W2WB 1KC1A 3DBVO 1JI3A 1KETA 2WFLA 2UZIR 2Y1GA 2FSVC 2ZDGA 2Z8YM 4HZUB 3GEMA 4KOEC 2R1ZA 1CE8B 3MJVA 4ERXA 4QUHA 3OD1A 4IUDS 4Y30A 4EFDA 3OKFA 2Y3IA 1M33A 2IYZA 5E7QA 3SQNA 1C9EA 3ZQKA 2FP4A 1JEYA 1ESCA 4MV9A 2F55A 1WP9A 3MWEB 1BWQA 1SUPA 3O1IC 3QP9A 4FFDA 2D1FA 5JO9A 3VPDA 4B82A 4EBBA 1ZXXA 4A73A 2XMPA 5KSZA 3C3WA 5G0SA 1Q7EA 3KLOA 1D8AA 1BFKA 1FQKA 2I9PA 4NFHA 3T9FA 5I9NA 3S7TA 1HYBA 5DHQA 1ZG3A 1NVBA 4O59O 5DGIA 3ZBQA 1G5QA 1Z6ZA 1KJJA 3USES 5E0OA 3Q3VA 4DSZA 3LECA 4JOBA 1U8UA 4OSOA 2ASVA 4J9UE 4UMDA 1TCUA 4C7XA 4Z49A 5B1EA 1LVHA 1C9YA 4NYIR 2PQMA 4ZJYA 4DLWA 3VM6A 5BR8B 3OE7A 1XEAA 3QPAA 2WWVD 3MINA 5KDLA 2VNSA 1ADYA 3F9RA 1I9GA 2Z04A 4H4EA 2FN7A 3IV9A 3OKCA 1MB2A 4RVNA 1MUUA 2N1BA 2RGCA 1R0KA 4Y2YA 1ZH8A 4DV2B 2QW0X 2FOXA 4PS1A 4UJ3A 1G5FA 1KYWA 3LBFA 4LZAA 1C7FA 1ZQ9A 2JDID 1DE0A 4V0ME 4B74A 1NLZA 1YTLA 2OGZA 2XODA 4RYDA 4B2IA 1IRXA 3IODA 1ZOOA 3WMXA 3CR8A 4NDNE 5ALSA 1W48A 3GLGB 4ICIA 8OHMA 2W9XA 1Q11A 2O5EA 2OY0A 1ND6A 3QVXA 4CMGA 1JMKC 5KVAA 1AHPA 2EZ9A 1DBSA 1YK0A 4X60A 4OQPA 4XIIA 4HX9A 2JIPA 1P9RA 3DVSX 4W1QA 4EFKA 1PJLA 1A9YA 4H0NA 1GLVA 4ZJZA 2W7TA 1XR3A 1SHZA 4KQ1A 4UTPA 3DBHA 2WTAA 1AJEA 2PN1A 2C94A 4R1OA 5F21A 3L9XA 5FLYA 1R8JA 5EP1A 4GZMA 1IN4A 3VZRA 2PKEA 2QGFA 2H2HA 2GR9A 2IHTA 1OJLA 2X14A 3OLWA 2QZSA 4MUKA 4FXOA 2B8WA 1BE1A 2EJBA 3X1XA 1WXIA 2WHEA 2QPOA 3C74A 2GSDA 5C34B 2O54A 4CMEA 1AQ6A 1ONNA 4BASA 1UBEA 5ESWA 2JGEA 1KEWA 1LDYA 1BE0A 2CGEA 3K05A 1AO0A 1A3CA 2H29A 4JLWA 1M5UA 1PT5A 3QYFA 4TVSA 3V8VA 4MYDA 3AK4A 4F7WA 3NP7A 1H0RA 4LXTA 3DXYA 3L93A 4N8SA 1C8BA 1BMFD 3CLRC 3I5UA 5JPDA 1IONA 3L40A 5BURA 2WG0A 1JHDA 1I0LA 1SXJD 5AVUA 4MDFA 1LC3A 2P35A 2ZRQA 1P5FA 3RUEA 2VJKA 3BJEA 4FYWA 1JH9A 1VL8A 3RHTA 3SKYA 4DVJA 4U3JA 2C4WA 2J6BA 2ZUTA 2YXBA 3I6QA 3GLFB 4B8WA 1NMZA 2F90A 4NYMR 4F11A 3I42A 5AR1A 5EHZA 1WDKA 2DCMA 3O95A 2V97A 1IG0A 1VJTA 2HQSA 1V35A 2AD1A 3EXG1 4K26A 1XQWA 1HEYA 4RZUA 4ZARA 3D7LA 3R3UA 3VPSA 4QPZA 5DBFA 3ZV4A 5IEJA 3NQ41 5JMOA 2DFPA 2Y0BA 4X9XA 1DQSA 2FV8A 4LHWA 5JSYA 4CQLA 3ESDA 3M89A 1W88A 4MKGA 5H1YA 3QVKA 1S2MA 1DTWB 1RIFA 2W5UA 2NWQA 1LTKA 3S68A 4OFZA 4BX0A 3CR7A 3U7IA 2Y1OA 4KYUA 3T8YA 1H6AA 4FB4A 2D7DA 3RVJA 3LG2A 1D1SA 1C3LA 1GZDA 3L77A 4RF4A 4W1SA 1AK2A 5FWAA 3H5IA 1I14A 4XIFA 1NWHA 3HY6A 1GT6A 1C8VB 5FUQA 3FGZA 4KVZA 3PLRA 1YKSA 2PX8A 1RC1A 2JBHA 1CZUA 2VPTA 2J9ZB 4BGIA 1T5BA 5A9TA 1CS0A 4HS9A 2O7NA 2YDYA 5FPPA 1OIXA 3BCHA 5DX0A 5TPWB 1U8CB 3T54A 4LSWA 5B53A 3VX3A 5JS1A 3G23A 3ZDYB 3I5AA 2Z9BA 4QXOA 1DJOA 2FQ1A 4CM9A 3AY7A 1XD9A 3LCJA 1MHPA 4MUEA 1AHNA 3C6BA 4BCBA 2C9YA 5FEMA 5HQ3B 3PDIA 4RBNA 3KXDA 2PUTA 4BV2A 2VN8A 2X15A 2FDRA 4S05A 1XP8A 1Z82A 2GZDA 3ANLA 1XZJA 3HVHA 2YL2A 5C37A 5A6VA 4XLLA 2HV8A 1IJBA 2ASEA 3REOA 1VA5A 3GJRA 1WXXA 5G41A 3ZW9A 3A1EA 2GTIA 1Q91A 5CGQB 2QP9X 4RMIA 2QLLA 3EQ2A 1LVUA 3D7SA 5CVDA 3VZBA 2UYHA 3IAXA 3U5ZB 3FUCA 2PK3A 1N2EA 2UYQA 1AKVA 3OOWA 1K63A 1DCKA 3KYDB 1RYMA 1F0KA 4MQUA 4J4TA 2HHHB 4G23A 1BGXT 4JXXA 1OU0A 2H5LA 3OLVA 4MOWA 3TB4A 4C01A 3IVMA 2GPYA 1KI8A 3FVWA 5IEBA 1W4BA 3LC2O 1X70A 2QTHA 2WKSA 3JALA 4WT7A 3RSFA 4JR0A 1D6JA 3IXMA 4GVLA 4H7IA 4GDFA 2X2PA 4DRYA 1MD9A 3ZZTA 2HWKA 4HQFA 5HILA 3KOOA 4CMIA 1B3RA 2IBMA 2CNKA 4G5QA 4GLLA 4EMTA 3QUSA 3FCXA 1YZFA 5B3JC 1NZJA 1M73E 4D8TA 2V9CA 5DWQA 1OAOA 1BVYF 3KDAA 2XXAB 2REBA 3FWHA 3UZUA 5LQDA 4LHZA 4UXJA 1C0EA 1ODCA 3TNFA 1V1MA 1U7TA 2AR0A 5G3ZA 4BMSA 4HB3A 7YASA 3T3IA 4NBSA 4LHYA 4QWMA 1ST3A 1EVLA 2HI0A 1TW3A 4KNVA 2PV0A 4F4CA 3AHEA 5CIYA 4TT8A 3RVRA 5IT4A 1ACLA 1SXJB 4GSYA 4KN9S 5J63A 2C5HA 1YQXA 3IMCA 3GRAA 4P3OA 3KCQA 1HFEL 2JFOA 3GFPA 3HJUA 2ZVJA 1XXLA 3IEIA 3JQQA 2IL1A 3R5HA 3GEDA 4D3DA 1LZLA 4KQXA 1JQBA 1XP5A 4MA5A 2CD9A 1W36C 1DARA 2RMKA 2I9KA 4MV0A 2FP3A 1JXAA 3Q72A 3JZIA 3W1VA 2ROQA 2PVPA 3TIFA 1JW9B 1DEKA 1E2DA 2BBWA 3GGSA 4US2R 3DT9A 1OASA 2ZXFA 2Y0PA 2C9MA 2D8AA 4PQEA 1I4WA 4H7PA 4ESHA 4HNQA 1WXGA 1Z33A 4OQ4A 4UEQA 1NVMB 3KS9A 1O57A 1LX7A 2PUBA 5E7JA 2WUFA 2QRKA 3R44A 4RETA 2P4UA 1WVMA 2I03A 3KDSE 5K05A 4RFSB 2IOFK 1R6VA 1Z47A 1JKFA 3RAPR 1QDEA 3NT2A 3TZQA 5JBIA 1FIUA 2W8ZA 4QSHA 1SHKA 3KJHA 3F5DA 1N6OA 5JZOA 4DMRA 1U04A 2VP2A 4L3VA 4YRRA 1QE0A 3GG9A 4PO9A 3ABSB 4JA0A 4YPFA 2IE0A 2B8NA 4JJFA 5D86A 5B4UA 3DEZA 4LGCA 3JZDA 3OH8A 1BEEA 3VFDA 1HZJA 2IYWA 1Y7TA 4M87A 4ZZ2A 1EBFA 1Y9EA 2IZ6A 3BB4A 2X0KA 1T5TA 3IB6A 3MJEA 4RTJA 2FPRA 2E4XA 2GAOA 2HY7A 1SMKA 5JG7A 2E4AA 1LVGA 2OK7A 4QFBA 2R48A 4EM6A 4F5WA 5SICE 4IQGA 2ENUA 3WL8A 4D0NA 3KL4A 1SELA 4G0NA 4HUQB 3TRHA 2GXSA 2WF7A 1S2IA 5B3JA 4YR9A 4WNAB 5CD1A 5FR1A 1HFJA 4ZO8A 1NIPA 5HA5A 3VMMA 2QTBA 1HXHA 4FYHA 5CVJA 3QVTA 1RJEA 1H3NA 3DCNA 1J2EA 2W43A 3EG9B 4G1VA 3JYOA 3PXDA 1E63A 1TQ6A 1G5PA 2Y77A 1UADA 2AZTA 2YYSA 5C51B 3TS1A 3G49A 4K05A 5ITVA 4MW7A 4MP3A 3COZA 2HFKA 3ZWXA 4XB6B 1JT2A 3ONDA 1DP4A 4WFKA 4FCTA 1UXIA 4DLYA 1UMKA 3P2IA 4HK4A 4B3BA 3H13A 1YMVA 1WG8A 4JHLA 2WOJA 3IPAA 3W78A 1YZHA 1WDLA 3BSSA 4OB6A 1CDOA 4HV4A 2Y1LA 4I1IA 2OC9A 1NJGA 4L8FA 3STUA 4I7EA 1T4BA 1G64A 5JATA 4JC5A 4YP9A 4LY6A 3Q10A 1F2TA 2QMEA 2VJLA 4TTTS 3THRA 1HE8B 5KTOA 2B30A 1H8HA 1Q12A 1SIBE 2WE8A 2OFWA 1EFRD 3A10A 3EMVA 3OZ7A 2UUCB 4I5DA 4I8DA 2VRWA 4S1TA 3V1NA 2IDKA 3FDFA 5KDOA 1MEOA 3ULKA 1H8EA 2QXTA 3F4BA 3C5VA 2XADA 1IN6A 2ECOA 4PAOA 3AWDA 5TMDA 3CPJB 4IIDA 4BO0A 4M7PA 1C7RA 3L7OA 1A8QA 2PGOA 2W98A 2VYCA 3BPSA 3MWEA 4D9JA 2GCPA 3L1UA 1DKLA 2BCGY 4FLFA 4ETMA 4WBNB 3AB3A 3LHIA 2CFSA 4KO2S 8ADHA 4FQ8A 5FYQA 1YFLA 1JLKA 2CE7A 1LLCA 1DBVO 3GZ4A 1KMCA 1QIGA 4I6GA 4NG5A 3HKEA 4WCFB 5CYOA 2J5BA 2BFAA 5SZKB 1Q0TA 4P3NA 4MLPA 1ZS9A 2WFLB 2OK8A 1OVGA 2FX3A 1VL6A 5AVVA 1WHSB 2CKMA 2HQBA 1E6UA 4UUOA 1IOLA 3VXKA 4D7AA 4RTQA 5AKGA 3KYCB 3QE0A 4B7CA 5M04A 1DFGA 3U26A 2QRJA 3OE1A 3UPTA 3RFXA 2XPCA 4H6XA 4BMYA 1M1NA 4MW5A 4DSAA 4CM8B 4WSOA 2IU0A 5EWMB 3ICVA 2HBYA 1Y1QA 2X86A 3ENNA 3EARA 4NMXB 3BXZA 1G6OA 2C42A 4IX9A 3RFTA 4FEGA 1G8YA 1GG2A 4NQRA 1IB0A 4UZEA 3ZIUA 2I8AA 3JVEA 4W6QA 2OR3A 1L4EA 1SXPA 3CVYA 3D0RA 1KK2A 1GL6A 4LHVA 4G4IA 4CTNA 2Y2VA 2XBLA 1NI4B 3JZAA 3KQYA 5EOVA 2J07A 3GJ7A 4IJUA 1URPA 1Z8FA 5DLEA 4ZT4A 3H9UA 4CFSA 5ENZA 4ZOQI 5JCPA 1U0GA 1D8TA 3PGVA 5LP6F 4J43A 3PC8C 1SXHA 5IJ9A 1B6RA 3P2KA 3WIOA 2RHWA 1V5WA 1QORA 3CH7A 5F9FA 5LYJA 2CHFA 2NYVA 2OESA 4JFAA 3EAGA 4FUQA 3Q3JB 3OTHA 3T5GA 4KHZA 1BX0A 1HDXA 1HO3A 1R10A 1RQGA 2PXAA 2Q45A 2ZJ8A 3G2OA 3ODPA 4Q7LA 3GGPA 3PFHA 3ONFA 1MNQA 4MARA 4CMEC 2PEYA 2E49A 1Y5IA 3OJFA 4P3PA 4TMXA 4OHCA 1COWA 1AH2A 3MSXA 3A6HA 4Q9KA 3PU6A 5FI0B 5CM2Z 2ZB7A 4RA6B 5TC4A 3BMXA 3EZ6A 4GRIA 5A1TA 2PFKA 2PNJA 3A26A 4HGZA 1EU1A 4NS4A 4ENWA 1BHO1 1IWOA 2D1QA 2NZXA 4NBUA 1XPUA 4WJKB 5LLSA 1VMEA 1X13A 4MYSA 4QNRA 4YLYA 1EVIA 3BXFA 5KU1A 3U7JA 1E1NA 3RYFB 3D6VA 3OZFA 1QFZA 4QD3A 1VYHA 1STOA 4FOPA 2VJCA 3UJDA 3UMFA 5HQ3A 1CG6A 5CJPA 3DHYA 4PNPA 3NTRA 2YJZA 1ZMBA 1IXZA 3TTYA 4BNLA 1K8XB 1K6IA 2VP4A 4OF4A 4X63A 3S6JA 1KPIA 4CEHA 1TRKA 2CLHB 4ZOLA 1A4UA 4YFYA 5CLHA 4KBGA 1OXTA 4DUYB 4R2MA 1M2NA 4G2TA 4HDOB 3OECA 4MUAA 2Y1XA 4X1KA 1WUIS 3PLAE 2BFNA 4TZTA 4CI0B 5BVHA 3DW3X 4WKBA 4ZCRA 1P61B 4BC0A 4Z0TA 3O82A 4KFSA 4O5AA 1TZKA 1ZY2A 1G21B 4FR5A 1M2WA 1JU3A 1U3VA 1V95A 2ZPUA 1O77A 3F1LA 3FE2A 3PEEA 4CLXA 1RT9A 4BB5A 4EUHA 4NFYA 5IYZB 2AR7A 2AHOA 4GX0A 4MQBA 1U94A 5F3DA 5JCZA 1XYYA 4H17A 2A0KA 4KEAA 5HKKA 1P29A 1R9JA 4L5BA 2I7XA 3GRKA 2QT0A 2J9FA 1TJ3A 1RRKA 4N82A 4BVBA 3TTTA 2C5GA 5DFAA 2AN1A 3VVCA 1WE2A 2CJXA 1GCOA 3D6AA 2AQKA 2PL5A 4HN2A 4MTCA 1RI5A 3EW9A 3GEIA 3KB2A 3N58A 1C7IA 5CYPA 4ZP1A 1RXWA 4HTAA 1PR5A 5JLAA 3ZZNA 1Y81A 3BG5A 5CXXA 1EMDA 1KYXA 2HHAA 2Y67A 4Q5IA 3VMFA 1M76A 4IV8A 3WBJA 4D44A 2IHNA 1H2AS 1JPNA 2RAUA 2CZGA 1BXRB 2KJQA 4B3IA 2EOAA 3ESBA 4G01B 2LKCA 2PZGA 5C1IA 3W8EA 1ZGHA 1G21E 1ST2A 2VF8A 1S5PA 5BSHA 1OGIA 1XTSA 3D3QA 1KE2A 4GXRA 3CPSA 3MOGA 1VMAA 1CU1A 1KJYA 4GNKA 3IR5A 4HSEA 1KE1A 5DWVA 1YOBA 2A5JA 1N2OA 3TFOA 4IUYA 4A0SA 2C04A 4CF5A 1FMJA 1X2EA 2H4HA 1VL1A 1XDGA 2GKOA 1WOMA 3CZAA 3IIMA 4LF5B 5KHLB 2V4ZA 1ZNYA 3GX1A 4PSUA 5ALJA 5JS8A 5F9HA 4L15A 1TJNA 1Y1SA 2WM8A 3GRRA 2J9RA 2JFFA 3BIFA 4X84A 2C82A 5LZ9A 4EARA 1NN3A 1ESEA 2HYDA 3G0BA 2JGFA 3ABOB 2PNFA 3AUJB 2RSLA 3U3ZA 1TU0A 4CN8A 3ROZA 5C8DA 3PD0A 1SA0B 4GT1A 1E3LA 1OI2A 3ANYB 3M6WA 1JLHA 4WBXC 1WMSA 5DPMA 3H3JA 3RR2A 3W34A 3WKDA 3ZNNA 1E2UA 3VPHA 4MGYR 4HDNA 1X8KA 5CTAA 1NBAA 3Q11A 1V6AA 1YZVA 4RJLA 1I7QB 4RV5A 3RUAA 1DEXA 3F5MA 1TC1A 1EA5A 4FXPA 4W9MC 4UNSA 3QPUA 4FGLA 1TU4A 3RW9A 2XSZA 4S2EA 3ZE9A 4B3CA 4BEVA 4LJRA 2JFXA 2ODAA 1WSDA 3N0WA 3N39C 1FNDA 2GBCA 2NU6A 4KN5A 5EHGA 5CM8B 4AICA 4A8TA 3MNFA 4P86A 2YFYA 4PXAA 5G4KA 3TFQA 4JLVA 4JEIA 2QSYA 2OVBA 4WZBE 1ZPDA 1TJ5A 3PB3A 1W34A 1DRKA 3GNLA 3RD5A 1GPKA 1PGPA 1ZIDA 1NG1A 3EE6A 4IF6A 4E46A 1JB9A 4QUEA 3TW4A 4DIUA 1M2OA 3QEKA 3ZBTA 5JSZA 1N78A 1CY4A 2GJ4A 1EFLA 5AHXA 4XQ9A 4IY1A 5DLDA 1TA4A 1ULZA 2X9NA 2QRGA 3CJRA 2C2ZA 4YUVA 4ES6A 2JKZA 3K9CA 4MVJA 3CLVA 2A8YA 2G17A 4XDYA 3LS2A 5H82A 3FMIA 5JC8A 1TCVA 1PWZA 2WJZB 1FMCA 3JQGB 4QQFA 3ERCA 1AQNA 1LPAB 4EEKA 2QA5A 1MRNA 2ZT7A 3Q7TA 3V6LA 2XUOA 5EJFA 3AFNA 4RZ2A 4V0SA 4YAOA 4CM9D 3R8XA 2GCGA 4PTLA 3WLNA 4KTTE 3AEZA 1ZVJA 3HBAA 5A9RA 3OPYA 3K0SA 4R0NA 3O8CA 3CVOA 2Q6LA 3RC2A 2A1TS 2ZWOA 4JXKA 5FL7A 1ARZA 3OC6A 2IVZA 1N34B 1DG1G 3BGIA 4MKRA 4KQGA 3QMPA 2FR8A 3LQKA 2HXYA 2IYEA 1O58A 5LDHA 3EY4A 4CIXA 2QAJA 2V58A 2FZKA 4BX3A 1JHYA 2YC2C 3DEJA 1KVQA 3ZD6A 2BFCB 3I1IA 1UDWA 5JAIA 4ZZIA 2E6UX 4IRUB 4YRJA 1L1FA 1TADA 5DVZA 4P3KA 4DCSA 3WGJA 3HADA 2I65A 3G7NA 2LE0A 1VSTA 4P82A 5HGJA 3RHFA 1SUSA 2B0JA 2VJNA 3ZH9B 4BB0A 4DR6B 4I5EA 1O9HA 2PJDA 3M6AA 4JVMA 3F6PA 4YTEA 1LFAA 1X7YB 1VL5A 1GGJA 3DE0X 4HH3C 3UFBA 4AG5A 1BYUA 2IELA 1CZKA 2OPBA 1D6MA 2HHLA 4BMCA 4ARVA 2Y99A 3GVXA 4CF7A 2CLLB 2L42A 4RY8A 2OXTA 4D0GA 2WTEA 3KJEA 4WE3A 3MJSA 3UCXA 4Z7NB 1JUDA 4JGBA 4HGPA 3C6ZA 3LRTA 3ELBA 2VPWA 1E3MA 3H2ZA 1R5NA 5E3IA 1GPUA 5TT0A 1LV7A 5LMNB 3E53A 4UVGA 1KAEA 2GWHA 4Q7KA 2BFDB 3CZPA 4PCUA 2ZDQA 1BMFA 2XJ4A 4A9AA 2Z98A 1K7YA 3OJOA 4DUPA 3BMOB 3MBOA 1PT7A 1UJBA 1P4HA 4ARZB 4L9AA 1HA3A 3I01M 4REOA 4JJ4A 1V39A 2IV3A 4MYCA 3ZOKA 4EEZA 5A62A 1HF3A 5DGHA 3CXUA 4HX2A 1VE6A 3FG9A 4DOMA 2VTDA 5ANRB 2Q1SA 2Z9CA 3U9SA 4QJ3A 4BGDA 5CVVA 3ZW8A 2QN1A 2BGIA 4RTNA 2CHGA 1NBOA 2BTOA 2JBAA 2O0HA 2Q4TA 3D81A 4PPGA 5IANA 1BO6A 4RYLA 1RHQA 1QU2A 3FVTA 3CRZA 3LUCA 4Q3CA 3OC0A 1COZA 2VDOB 4N0DA 1USVA 4DE5A 5CB4A 5IT5A 5LYJB 2CFOA 1GU1A 1V3QE 3DMFA 3HC7A 1KZHA 3KSRA 3M6VA 4JC8A 3JWPA 5REQA 1CDZA 5ADVA 5HYVA 1IVYA 1CY7A 2AE2A 1MAUA 1SWWA 2G28A 3BX1A 2QM3A 3U7RA 4ND2A 1K5PA 2PLNA 1SKAA 3DQPA 2V0GA 2O1EA 4DA8A 3TG8A 2C2KA 1EK0A 1FP4A 3BM5A 1RADA 3ADBA 3IE1A 3AW9A 1JDSA 2VYNA 4KFUA 4QBIA 4DCMA 1VRWA 1M8PA 4P8RA 2GFIA 3B3QA 721PA 3K0EA 4MQ6A 4B8ZA 5D5HA 5EXEA 3TSWA 5A04A 1BKYA 4K87A 3GLIB 1IBRA 2JDIA 1JVNA 2P2LA 3SDSA 1HE2A 1L5SA 1TT5B 2FU5C 2ODPA 4PIPA 3WL6A 4DC9A 3L0BA 4G5XA 1PEAA 2COUA 4G09A 5E9AA 1SD5A 2JAQA 1IZ0A 2Q99A 3FETA 1FYDA 3HP4A 1KDTA 1YMUA 2YMMA 1VZ2A 3P9CA 4QODA 1VMKA 3AHDA 4CV3A 3VNSA 1AQJA 1A04A 4LV6A 3OE7D 1SBCA 3VKVA 5F3WB 4DNFA 4I55F 1E2IA 4FW9A 5FTMA 1AE1A 2BDUA 3DOOA 3QGMA 3TD9A 4RZXA 2BHRA 2JAPA 1M54A 2PIDA 4N3BA 5KU7A 3SIRA 2Q3DA 1IFXA 2O6LA 4Z8YA 3FBTA 2ZE5A 1QRAA 1M1NB 1Z0JA 5B5SA 1RKQA 4IIEA 1ZISA 3W1WA 4XH9B 3STXA 2AF4C 5HCIA 4PIVA 3ZLVA 1CR0A 4BCDA 1MO5A 1U0BB 4ER6A 4KXUA 3SIWA 1HLFA 3EJ6A 1G2IA 1OR8A 2EFGA 3KFLA 3ORYA 4OHBA 3FKSD 5EIOA 3VR2A 5EI5A 1JEYB 2ZB8A 5AP9A 2GK7A 4DR3B 2Y4NA 4IDQA 1BS9A 2PS1A 1F2TB 4M9UA 3WQHA 1WULS 1PHRA 4J0JA 2E5FA 5F7OA 1FX0A 1Q7CA 4ADSG 5BYKA 1Z6QA 1Y3IA 2LBPA 2CXNA 3FPHA 3M7IA 5DBIA 4YWJA 3GAAA 3H8VA 4ENQA 5E38A 5FT9A 1BH6A 4NBKA 3UK0A 1S9DA 5IKPA 1GGMA 5IRCD 1QIFA 5ALKA 3W7BA 3GCXA 2ESRA 3VNUA 4N4AA 4OLFA 4W5HA 2XQIA 3NCTA 1KOJA 5IC6A 3S8MA 5KMGA 3HB9A 4OB7A 4RMNA 4HH1A 5HIMA 2O8DB 2GEFA 4I66A 2NSDA 4KQ6A 2P69A 7MHTA 3KHUA 5GV7A 2YV3A 3DE5X 2HUPA 4L8LA 4ML3A 2BZ0A 2R1TA 3KEQA 3ONNA 3QTTA 1GD1O 3KU4A 1YB6A 1QFYA 4KIWA 5LWQA 3KUXA 1ECLA 1Z2NX 1MG0A 3EG5A 3R5SA 4PZEA 4U2CA 2G0TA 2NVBA 3OCZA 5GJWC 3UA4A 1HMPA 1NDUA 3L7LA 5H83A 3WJ7A 3WX0A 4DV7B 3LYHA 1P73A 3B9PA 3N2IA 3SJAA 4RTPA 4BS9A 2W6OA 2V1XA 2B69A 1IL0A 3BQNB 3TJZA 2HQRA 4LVUA 4B4OA 4ME6A 3TW8B 3BDAA 2JG3A 2PL9A 4DSUA 1EQUA 3KZOA 3FKQA 4EX6A 3AP2A 5KDDA 2R7KA 1Q0HA 3Q87B 1T5LA 1NQTA 3VDQA 2Q4DA 3NETA 3MAJA 2IHZA 4HQKA 1PZFA 1Z22A 1WD5A 1IHXA 2VUTA 3IRUA 3PJEA 2JLYA 2C8LA 3AHJA 3WRVA 3C3AA 1JRLA 3NYIA 4FDUA 1EVEA 1U7XA 4MLDA 4TM8A 5F2EA 2QUIA 1CJKC 2KE5A 4QYXA 1YRBA 3H86A 1FX1A 4R51A 2VQSA 2REQA 4U6NA 2G06A 4F6CA 3EXEB 1ZUD1 3PA8A 3QKSB 2PFSA 5EVCA 2NSYA 2Q5QA 3ISTA 4DJFC 1VM6A 3OJCA 3LC7O 1R66A 1K75A 4GG1A 1TF7A 4KWEA 2XGJA 1NATA 2OM2A 3ET4A 3F98A 4F12A 2MR5A 3BZUA 2XEDA 2A9PA 3WHKA 2WSLA 4J6FA 2R6JA 4AL4A 2VSOA 3B3FA 1WWKA 1NOKA 4G8BA 3E70C 1EUCB 4MWDA 3WRYC 4CMAA 2C1XA 4HLUA 3NHWA 4INPA 2K7FA 2EU8A 4BNKA 4RK7A 3SYLA 3NTXA 2I7CA 2WTXA 4LFCB 4X3CA 4MQ4A 3EF1A 5AMXA 5IYZF 3RABA 1XAHA 4QUGA 1G1MA 2DC1A 2H4FA 1GTZA 1NXOA 3PEUA 4YWHA 4HN4B 1YNSA 4AQDA 4YMLA 1EFPA 1F8UA 4AY2A 3DOHA 1OAOC 1UAYA 3A3KA 1ESDA 4KN8A 2DBVO 4TQ9A 5HFAA 2LNDA 5KYWA 3DOUA 4MI6A 4BB9A 1ZD8A 2GO7A 3AEUB 2J31A 1KZ9A 4R2HA 4YROA 4ND6A 4ON9A 5BPHA 1GCIA 1FZQA 4QUBA 1Q7TA 2JAOA 2R3SA 2YOFA 4ZT6A 5CDFA 3UTCA 1RKUA 2HA3A 4NU6A 3I01A 4JLUA 3UUWA 2CT8A 3B1FA 1R4ZA 2AQIA 1I7PA 2CXRA 2OORC 2RB5A 3FF1A 4DLUA 4P2GA 4Z4FA 2V0CA 2X3FA 4RH1A 5C7YA 2PUGA 2OCGA 2V6JA 1P45A 1ECCA 1MU0A 2BWJA 5CLQA 3K09A 5LQCA 2O2GA 3RROA 3WLMA 3EIWA 1AGYA 1VGQA 4JDPA 1LEHA 3OLYA 4CKZA 5LD2C 4OTZA 3TINA 3X43A 3KUKA 3QPCA 3DFMA 5JH7B 3AF6A 5ES3A 4YT8A 1OU4A 4LRSB 4PAMA 1IN8A 2QI9F 3QG5A 1FTSA 2DUMA 3L6CA 4GBGA 3CZCA 4GZ5A 4MCIA 1RRFA 3FTDA 2Y0EA 5EKUA 4QAQA 2A9KA 4BKMA 3DUFB 3QRWA 1NKSA 2W22A 3LGSA 4X61A 4BNDB 1S8NA 5DCYA 4OUDB 4AO6A 1W93A 1J2YA 4LNUB 1XN4A 1KK3A 4TZKA 3UMCA 1EGHA 1QHIA 3HP1A 5G0TA 2YWHA 4D4IA 5EKTA 3PE3A 3L6DA 3I05A 2IYSA 3V8EA 2J32A 2XNKA 4RY9A 1Z4PX 5EWLB 4IJMA 1KJ9A 5CGZA 2J6CA 4XFJA 5CK5A 3VSAA 3WGVA 3EMBA 5B58T 1J9ZA 1QYWA 3TZLA 4MIKA 4MQEA 1ZEJA 3SZRA 3U9TA 4RIGA 3JQEA 2VDRB 3NBZC 4L5AA 3HYTA 1DJPA 1BWRA 3ICPA 3ANXA 1RHMA 1GLGA 1AOXA 3NAMA 2H2IA 3R3ZA 3FPFA 1V6CA 1JAHA 4TUYA 2IBTA 3RC9A 2WHPB 5DTQA 5JXIA 4AS1A 4YXFA 3HU3A 1OFUX 2HA7A 2PH5A 3A9WA 4BL5A 1PL7A 3ZS9A 5BV7A 4JWKA 2JD2A 2GT1A 2JLAA 2W83A 2IP1A 3T7JA 3LDFA 1KI7A 5I01A 5EZ5A 1BRTA 2H5EA 3QX9A 2FR1A 2NXEA 4FWTA 5C2JB 1Z5PA 4LTDA 2XY4A 3ZHUA 3N2YA 3UFXB 4PW0A 4R1SA 2P4QA 1RI1A 2YRFA 1ZAKA 4CM5A 2O2CA 4EJSA 1QE5A 2Q3EA 1PWYE 3S2ZA 2XECA 4RD1A 4X90A 4G89A 2MSKA 4B8YA 2A86A 1LZKA 1Y3FE 2WJIA 1JDTA 1THZA 3BCUA 1K66A 3EQZA 1R6DA 3PWZA 2I29A 2C2YA 4IW3B 5FV7A 4LJ5A 1LRKA 4Y6GB 1KP9A 4P35A 2YUTA 1OLUA 3D2CA 1KPGA 3B6KA 1LK0A 2P9EA 4PINA 2PMBA 3DULA 3KXKA 1WB4A 2IHVA 4QGBA 2Q1WA 3WWOA 7ABPA 3U7FB 5EZYB 2I2WA 4OVKA 4DM3A 5HHTA 3UMYA 4JT9A 3LZDA 2VPYA 4DLRA 4HEA6 4Y1RB 1DGQA 4AMZA 2OV2A 4OSEA 4PX3A 4MGZR 5IM5A 5CD9A 5AJTA 4WVFA 1PDOA 2QTLA 5DXAA 1VIVA 3URKA 4NJMA 3FGNA 3PXUA 4HYTA 5DCWA 4Q6WA 4AKSA 2PUWA 2W4QA 3BHMA 2WK1A 3DDUA 3QXSA 3TSCA 1F9AA 3T9AA 4F6LA 4OFXA 1EP2B 1VI5A 1CX9B 1EINA 4Q7JB 1A9SA 4Z4HA 4DSTA 1AHHA 4IXNA 2VCEA 3U40A 1S0UA 3HWSA 1JQAA 4ZRNA 2Q1TA 2C07A 1ZVMA 4U1RA 1AS3A 1R5BA 1RPTA 3AESB 4QT4A 5JXWA 1BC5A 1DWUA 2D3TA 3OEHA 2XF8A 4E88A 3RLFA 2JL1A 4EZEA 2BIFA 1RMYA 1N2CA 4Y1FA 5KTYA 5EQFA 2J45A 2WD7B 1V0JA 3F3KA 4LRYA 3PUKA 1P2FA 1P0MA 1PD0A 3LPMA 1L7VC 5TQ2B 2IV7A 3D6HA 3WGIA 2GHTA 3H7AA 5HQTA 5HSGA 1WRBA 1ZJYA 4EA9A 2WYWA 4LJ7A 2BBTA 3GGGA 2FPPB 3O47A 3KX2A 4OP1A 1IN5A 5CT9A 3AVQA 3WO1A 3CNHA 2FLWA 3BVPA 4B4VA 2ID4A 2A2ZA 3D8HA 3ILHA 3KELA 4PGAA 4COKA 1KXZA 4MUXA 1WSWA 1DKUA 5EXTA 1T5SA 4H3KB 3WNVA 4MWBA 3RIEA 1E2PA 1MC5A 3QA9A 3W2EA 2ODEA 5C3MA 3AW8A 2HA0A 5JR3A 2QS9A 4TMTA 5T8KA 1Z13A 3IBFA 4IIJF 1V16B 4CKCB 4HZIA 2DE0X 4B81A 4NCIA 1FZTA 3HVKA 3N2KB 3P9YA 2ZT6A 5CLJA 3BCRA 3MUOA 1JKJB 3O92A 4XARA 4AY3A 1YRAA 2X42A 4OIFA 4DIOA 3QEMB 4YRMA 5C7IO 1U8FO 1ISSA 4GE0A 3BD7A 3LWZA 3K1TA 2FUEA 2FW1A 1TF2A 4PC6A 4C1NA 1F5SA 2VSNA 3ICOA 3TVTA 4UHEA 3WK4A 4XIGS 3M6XA 3VHLB 1V45E 1RXVA 2GBIA 1VHWA 3JVUA 2RGNC 3QU9A 1W0KA 1WP4A 1M5TA 1FDUA 1YJQA 2VAWA 2X5XA 3LCCA 3EODA 3MRVA 1IE3A 2OHFA 4CLOA 4L8GA 2GN0A 4O2BA 2QZJA 2YIDA 4IV5A 1Z75A 2HDHA 3LVQE 3ES9A 3QHPA 5LSAA 2R6R1 4E51A 1W75A 4HVAA 4Z9XA 2GTPA 5EYPA 4EL5A 2FAXA 1ODTC 1Y9DA 2F2TA 1UBOS 4J1TA 1YDMA 1LKZA 1SB9A 1CHDA 2C7OA 1A5SB 3FFAA 4S35A 1N2BA 4EG0A 4HVCA 3K9FC 1FVFA 1J7KA 4MPJA 5TS3A 2ZUBA 5EQDA 1DG9A 1K9SA 4LX8A 2AN4A 1VKHA 1Z6PA 3MMXA 3WKAA 3M1AA 1SULA 2Q5OA 4HZUA 4OL9A 2JZOA 5AVJA 5B58C 3QXHA 4X6UA 5DBOA 1Z7EA 3PNKA 1SURA 3R3WA 5IHPA 3H5VA 1P2TA 2MIIA 3IBGA 3DLCA 3IHTA 3MWGA 3T7KA 1WNTA 1GAWA 2J9FB 2EF0A 2YHSA 3GLHB 4NPAA 4ANFA 5MFZA 1I1HA 1FTQA 2WTNA 5LBUA 1OWNA 2ERYA 3C8ZA 4W8GA 2ONKA 1O2DA 3IUBA 3VJMA 4LGMA 4N12A 1HKHA 4D99A 2ZUFA 3MCZA 3EGEA 1C5KA 4KBYA 4Q05A 2UZ4A 4O2RA 3X0DA 1XHLA 5K0JA 3L8ZA 4TKUA 5L3ZA 4EJMA 1G20E 2BSQA 1UC8A 3MB5A 4MQFB 4N39A 3TE6A 3UKJA 1WV0A 2PKXA 1LC0A 5B1DA 1P74A 5IKMA 4IIFA 2BFFA 3C1OA 1QGUA 1WOYA 3G3EA 4EB6B 1S3SA 1QK3A 2WQ7A 5JXGA 5IJAA 1E9CA 3RT1A 1KDYA 1JT9A 2XMDA 1GV1A 1T1JA 2YDXA 2ABWA 1KY4A 1JQ5A 1KRHA 4POAA 2EDAA 4BLQA 3N2ZB 1MR3F 1RXYA 2HK7A 1DOZA 2ZYIA 3E9QA 3I34X 4JC4A 1EUCA 2H18A 2HRZA 4GMKA 3E7DA 3ROEA 2LD4A 1YMQA 5H59A 3P96A 1E1MA 3TBFA 4LC1A 5LA6F 3KZKA 4DLLA 4N76A 3R5XA 4XDHA 3WDSA 4Z7OB 10MHA 5F4BA 3GLIA 1Y1PA 4Q7QA 1WBDA 1YIOA 2E2WA 3D2AA 3K9NA 4LV8B 3C14C 1HQYE 2LIPA 3E2PA 3T4UA 3UA3A 4ASUA 1P7WA 3TQCA 2IGBA 4FKMA 1P0IA 3MYYA 3A4VA 4PLTA 1A2BA 2H1RA 1TTQB 1B1AA 3AHCA 1YUMA 3DZKA 3SEFA 3ZU2A 4A23A 2HIAA 3INYA 2HAEA 1FDRA 3TB6A 2XDAA 4CLRA 3ELDA 1G8SA 4K9PA 3FY4A 2Q7OE 4HWKA 2I33A 1A5TA 1HTWA 1R2QA 2J7KA 1P1IA 3QU7A 5FI3A 5BNWA 2QR3A 1N6RA 1K89A 3S0JA 3K9QO 4PTZA 3P7MA 5K7SA 3Q8KA 2R6AA 2L18A 3GBVA 3MQFA 2OGSA 3AXSA 1BJTA 4ZV7A 2G77B 1JQJC 2ATCA 1JDBC 2ZRFA 4FBGA 4ZVRA 5C32A 4AC9A 2AKEA 1Z7YA 2PRIA 4K5QA 3LJKA 3QY9A 1IZ9A 1L4BA 3CLTD 4MIEA 1EG2A 3SSOA 4Q4CA 4MINA 5K8IA 3R0QA 2WJ3A 1HR0B 4MW9A 3OI7A 4LZPA 2LPMA 3HSSA 2FGKA 3NUZA 3OF2A 3WBFA 1QRTA 1M6HA 5IJ9B 1S7CA 2CDBA 3PL5A 1TB4A 4IDPA 4C0LA 1VPDA 2XTJA 1U2SA 2HRCA 2NT3A 2ZI9A 3V1YA 2QLJA 1QKIA 1CCWA 1PEDA 3AO0B 1TLLA 4JB2A 1NUAA 3RJZA 4CMHA 1VC2A 2H5JA 3FHJA 3VC1A 1PK9A 4GWGA 4N5NA 4MROA 3STVA 3ANMA 1OTHA 3K0CA 2H1VA 2H2GA 3M1YA 1WIWA 2YWBA 4F2GA 4DZTA 4R2LA 4R2WA 3OSUA 2GAIA 1QO0A 3T5MA 4DWOA 1ZNZA 2ZRIA 2IEDA 4BAZA 2P0YA 4P4NA 4JMPA 2AGVA 3GG2A 3W05A 3N1UA 4K9SA 3U62A 4DQKA 1F48A 4FJ1A 4EHFA 4IIHA 2O4CA 4BFXA 4NRDA 3O3CA 3KYCA 4U5XA 1QYVA 5AI9A 1XPRA 3O9MA 2PU5A 2ADMA 1CVLA 4J2HA 1G19A 1BCSA 5C8YA 4BE9A 3STWA 3HYLA 3VYSB 4JJZA 1AU9A 5ALUA 3V32A 2B92A 2O07A