2I4RA

Crystal structure of the v-type atp synthase subunit f from archaeoglobus fulgidus. nesg target gr52a.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
SHMLAVVGDPDFTIGFMLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIMKQEYLKKLPPVLRREIDEKVEPTFVSVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the V-type ATP synthase subunit F from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords V-type ATP synthase subunit F
total genus 14
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 2i4rA00
3VR5H 3VR4H 2OV6A 5KNBH 4IX9A 5KNDH 5KNCH 3W3AH 3VR6H 2QAIA 2D00A 3AONB 4RNDB 2I4RA
chains in the Genus database with same CATH superfamily
4RV5A 2QVGA 2ACVA 1BU5A 2WJ6A 1B74A 3BOSA 3JQBA 5HR5A 5KDDA 1CJUC 2PZLA 3O75A 4L22A 4CEIB 2A58A 4PLWA 4UU1A 3VAZA 2BEJA 4WOKA 3NC0C 1EB8A 3UV6A 3VOSA 4OO3A 4Q7LA 4BO1A 4XD2A 3E3AA 3ECAA 3BMCB 4PRKA 1USUA 4R8KA 5H82A 5CCEA 1CEEA 3CKYA 3INYA 3LSTA 2NW6A 1G5PA 4E3ZA 5J4HA 1WKVA 5JNSA 3NTOA 1SRQA 1BJKA 1J8VA 2YDXA 3GELA 3QEMA 1VDMA 2HUPA 2FE1A 1QG6A 2IHKA 5A5EA 3EPHA 4LYGA 4C01A 2G08A 1BE6A 2VZ8A 1XKLA 2M6RA 3HVHA 2JF0A 1ICIA 1BWPA 1R9GA 2RK4A 2N3ZA 1JDTA 3TRKA 4F6LA 5C4MA 1NVUQ 3IE0A 4QU5A 1S7CA 1VECA 2NVOA 3DAPA 3ZDRA 3ASUA 4CCYB 2PIDA 2HF8A 4M0PA 1P0PA 4X54A 4DLXA 3BRSA 2M1XA 1L6IA 4G6ZA 1EPUA 2JZNA 5B2EA 4G86A 3GIWA 1Z4KA 1J0XO 3ZYZA 1KYVA 2BKVA 4ZO9A 1E92A 3BH7A 1VMIA 4D3XA 1KVQA 1MEJA 1RBYA 5A1JA 2WF5A 4H7PA 1E3WA 4A27A 5DHQA 4F4CA 4RXUA 1XBTA 4U5QA 1SVMA 4ZI7A 1Y5MA 3UMFA 3BCSA 3HB0A 4YRAA 4KPUA 2Y9MB 4DGQA 3M4JA 5IZCA 2JW5A 2DQ4A 1MAUA 2EJUA 2ZYAA 3H2KA 1BGWA 1XVUA 4KYUA 3ZXSA 4QTZA 5CURA 4A73A 3CLUD 3L8YA 4PO3X 2XYPA 2O59A 3HYSA 3R9KA 1TUIA 3KYJB 4S1PA 2FP4B 1IYZA 1Z73A 2C2ZA 5DI9A 4KN8A 5DDIP 5HJ2A 4RV4A 5HVNA 4XH9B 3DE0X 1WOYA 5JPIA 1FDUA 5HQ3A 4NI5A 3JQAD 4PCVA 1I8TA 2JJ8A 4XR9A 2Y1CA 1U5BA 2FPIA 4XJXA 3HFSA 1L7MA 3HTXA 1I01A 2Y6VA 4K05A 3L8GA 2GBFA 4JI7B 1QG0A 4LI0A 4RCZA 1K92A 3QMWA 1Z75A 2D1SA 3CX8A 3UIEA 4JAVC 2QMHA 4D4IA 4OSEA 1KQOA 2VF7A 4RLQA 3CLTD 2QG6A 1KFKB 1QFXA 2GZSA 2C3YA 4CKEB 3LJKA 3U1VA 3L8HA 4FNMA 4JS0A 1XCMA 1J33A 4ACBA 4KO4S 1G7SA 1FFWA 1V25A 4C4RA 4YRGA 4GEKA 2XQVA 1XTIA 4NSNA 1NXWA 4RK7A 4C7OA 2ECKA 1WULS 2PR2A 2IPXA 2B3DA 1FNCA 1MXHA 2C96A 5FPSA 3S0JA 3SYLA 3A11A 4O4IB 4MVJH 3AJ8A 1BDJA 3GT3A 1AV6A 2DYKA 1N2IA 1WPGA 4ZQEA 2HF2A 3OJLA 2FG5A 2ZI3A 3NBMA 1JI0A 1R8YA 1V8OA 1IN6A 1NY6A 1W73A 2LR0A 1Q1QA 2QRJA 3EQ9A 3L7DA 4WOJA 1RI3A 5KVQA 3RRZA 4BX0A 2QLJA 4LXHA 4XJSA 5K8VA 4Q47A 1PTJA 2YNMD 1JZQA 3BB1A 3E5HA 2IEDA 3V55A 3S40A 4U7FA 2UZ1A 4RDXA 5LYJF 2J9RA 3GPLA 1DZIA 1UPFA 1KMNA 5FPQA 4HVCA 2XWQA 2CZCA 3JVDA 2IHBA 3QKRA 4QDTA 5ALOA 4QDUA 1Y82A 3MOSA 1EK5A 2YIJA 2XIJA 1UWLA 3BQMB 1GRCA 1R12A 2GYVA 4DIBA 1XK7A 4KACA 2WIDA 3RTEA 4TUYF 4W1QA 1DWOA 2WBLC 1XXHE 3MCTA 3ZE7A 3KWMA 4RVNA 1TADA 2X2OA 3IAHA 3T9BA 3OOYA 1MIHA 1UL1X 3FCAA 2O8DB 1XRPA 4HN2A 1KXJA 1L5ZA 1S3GA 1U9YA 1R5JA 5A5FA 5BXQC 1RZRD 1Z08A 1UIRA 1WDKA 3PJDA 3V1MA 1NQVA 5DGDA 3ZZMA 1SA0B 1BVUA 1O94A 2Q1WA 2VRCA 3GJ4A 3M3PA 4P22A 4RKFA 1WB5A 3EK2A 3NO4A 3LFHA 1Y8AA 5FI1B 2PBLA 3RU7A 3IH5A 3LKVA 3IBTA 3ZZUA 2P0YA 4PYNA 3L1KA 1MZVA 3GFFA 1QTRA 1DIOB 2RONA 3JVIA 4HV4A 3KETA 1YDHA 1FDOA 2O48X 4ND8A 4B0OA 4R40A 4GPBA 1QBGA 3BULA 3GVIA 2HSWA 4FD2A 1Z7GA 2R1VA 4RVDA 5J40A 5KB3A 1YRYE 2FDCA 2VJYA 3FPEA 1Z7WA 4R2KA 1F8FA 1P81A 3ZC3A 2Q3DA 2R7KA 2V7UA 4HDSA 3U17A 1ZH0A 3A9RA 3DL2A 5BR4A 1N34B 2EQBA 2H7VA 2A9KA 5JY6A 3GLGB 1BS2A 1YE3A 2E2WA 2C04A 2HYDA 5JECA 1AUQA 2YIMA 2GN1A 1DARA 1PR6A 1J1IA 2JGNA 4N9WA 1GZ6A 5I47A 3JALA 4MUJA 1GEEA 4I2NA 1DSSG 2CVHA 1SXGA 3DYIA 1VPLA 2VOJA 1H65A 1TYZA 1VLHA 3GUCA 2TECE 2C8VA 4AJKA 3E15A 3L7AA 4CV3A 4X6UA 1ENZA 2VZEA 1VPEA 3IVGA 3QNMA 3U0BA 3TBFA 1IIRA 1PV2A 2YCLA 4BY9E 3F7MA 2JI9A 4UBLA 3KV1A 1VHDA 1Y3IA 2OL4A 2O9JA 4I6EA 2BMJA 4JYMA 1WJGA 5FFFA 1RRCA 4RX1A 4B79A 1P9OA 2YY6A 2A3RA 1C0IA 3OTHA 1T6NA 3DPUA 2PL9A 3TG8A 4R7ZA 4XR4A 3UT6A 1UODA 4BGEA 1SIWA 4UDYX 1QONA 2J6CA 3DOUA 5THQA 1CRZA 1U8AA 1XFAA 3PNBA 1DO2A 4W8OA 3W8NA 3PUVA 3DMNA 4WVFA 5CLHA 3SLRA 2D2XA 3H17A 2IXDA 5KOYA 4FEGA 3C6ZA 1MV8A 1T43A 1KYIA 1JILA 3FPLA 4YCJA 1AHPA 2OXFA 4E4TA 4D9JA 3LIPA 4B82A 3HQ4O 1LDNA 5KYUB 3AVXA 1DAEA 1PSWA 2PLWA 3U4AA 1KYXA 2ZJ6A 3EISA 4PX5A 5ILQA 4MWZA 3RYFA 4WESB 5LQAA 2O5CA 1C4KA 1G41A 1VMDA 3H5AA 3NWPA 2WNHA 4DNQA 2AFRA 3L8ZA 3WFJA 1D4OA 3CSDA 4OREX 4NJOA 1V9CA 4PO9A 2W6PA 4HAOA 1VBNA 4A0HA 2PQ2A 1ZAKA 4QOEA 2QTNA 2N1BA 1YRWA 4U9HS 1JFVA 2G7MC 4AZSA 2IDKA 2ZJBA 3EW7A 2A8YA 4JLWA 1ZXLA 2PGDA 3L6RA 1FJHA 2XNJA 3EZYA 4PBTA 1EM6A 3VHXB 5AVTA 1Z4NA 1NQAO 1ZXBA 1S96A 4YRQA 4P4UA 4DMFA 3AF6A 1IMJA 3QEBZ 4BVGA 3FOFC 4M1OA 2QAIA 3ZH9B 4QL3A 1F51E 2CMGA 2OECA 5LR6A 2ODTX 1MC5A 1Z68A 1S8OA 3PXGA 1HFKA 1EFVB 5FTWA 3NWEA 1AMUA 4CM6A 1I14A 1T35A 3FVVA 5U4QA 5C8XA 1VIVA 2DKOA 2G25A 3CLSD 1J90A 3TOCA 4PXAA 3VV2A 3ZCSA 3W6UA 3A1NA 3H4IA 1NFFA 1XVLA 3HR4A 3AB7A 4V0ME 3TNLA 1E2QA 2C4HA 1S2NA 2W2TA 4GGOA 5D00A 3SY8A 2WOOA 3W7BA 3HXOA 1X80A 2VRCD 3CZ5A 3WL3A 1KEUA 2PBZA 1UOEA 5CDFE 4DABA 1IY2A 5DIFA 3Q9SA 3QBVA 3SNHA 5E4JA 1ZMXA 3UBTA 3I9NA 5E1OA 3TLYA 3N39C 3TNYA 4JUAA 5AM0A 4B6QA 4N9QA 5ALIA 1UOQA 2BUBA 4GMFA 1A9XA 1A8HA 4AZTA 4A16A 3J7AC 1VE1A 2D2IA 1UDWA 2HB6A 2PXHA 4MSUA 4RIIA 4MPPA 3Q40A 1GNPA 2B5OA 1TRKA 1J8MF 2VP3A 1DRJA 1FLVA 1XMXA 4L8LA 5TY0A 3ZHZA 3TTTA 4EA9A 4EW1A 3BFPA 2Y1FA 3T1QA 3WLSA 4C6HA 1E1YA 2VZ0A 1KDYA 5AW2A 3W06A 1XZCA 3D54D 3JU3A 3SR0A 5JT1A 5LDHA 3ZJUA 2FLVA 2ZDGA 1OGJA 1U2SA 4LF9B 3M9LA 1EJ0A 1JQEA 2C2KA 4L4SA 3KQNA 2B5VA 1PDVA 2P2SA 3KBBA 3TLCA 4J0IA 2XMDA 1EDZA 2VNSA 2ZITA 5TF4A 3T6KA 4B43A 1ZUIA 4HX5A 4F46A 3EH2A 5IUNC 1QFZA 1VJRA 3G5UA 2EP5A 4ZOLF 3AETA 3ESQA 1J8YF 2B4RO 1F4PA 2JLBA 2MINB 1CR4A 3DSRA 3U1TA 2X0FA 1Y4DE 3C6MA 4WZAE 1DDOA 1FIUA 1O97D 3O91A 2GILA 1DBRA 1CQJB 3OP1A 1G8AA 3BMQA 4MIEA 4BGVA 3A1TA 4EWLA 4QM6A 5FNVA 5EPUA 2CVQA 4EHFA 1QVRA 2LE0A 2HJWA 4PWYA 3R3SA 4KGDA 3BWDD 4N03A 4NJMA 4Q6BA 5LD2C 1QHEA 5DHUA 1FFBA 3DLIA 1JHVA 2WYVA 3FR7A 3CEHA 4H4EA 4IJKA 1MNQA 4R9UC 4X3OA 1WG8A 5DZSA 4QPNA 4B7CA 2Z1MA 4I1UA 2BUAA 1XMQB 4A03A 2L0XA 1E5LA 1IM5A 4UD6A 1RRVA 1XXHA 4HC4A 4K9MA 3GDWA 2Q3LA 4JL5A 1JDUA 1TQ6A 2DWUA 3ZZTA 2PK3A 3AFIA 5AJZA 1D4FA 1YQXA 2ROQA 3BZWA 1M7GA 4ODIA 3LVBA 2IW1A 1JIUA 1W88A 3BE4A 3MPOA 4J1SA 2SKCA 2ZB3A 2FTKE 3R0VA 4TN1A 1NUPA 3SHQA 1O2DA 4ZVUA 2YV3A 4BC0A 4DA4A 5J1TB 1A5BB 5HJ5A 2RDMA 5F2EA 1RHRA 2I1LA 3FYTA 4YGYA 1AKTA 1Y37A 1XOIA 3G9XA 5IMBA 4IKPA 4YUAA 1PT7A 5FBHA 4Q19A 2ON6A 2GK7A 2D3WA 1K5HA 3T5DA 3JQGB 4TWRA 3CWQA 5ALUA 3RADC 2IYSA 1FW8A 1N5JA 2ZUWA 3O9MA 4W5TA 1I2ZA 2GYYA 4F5EA 2RIPA 3DDHA 3DEHA 4OKSA 2ZBGA 3RUPA 2W2MA 3MA0A 4D79A 1RIIA 5BWLA 1SBIA 4PQEA 1NUQA 3KHKA 5GY7A 4LWOA 2QD2A 1XD2A 2B69A 2ORVA 1FFEA 3NHUA 2PA3A 3R20A 3ME5A 4LKRA 3IAUA 4IIBA 2GHQA 1RLJA 3BF8A 4KOAA 4ZCMA 2C4TA 5DYGA 1EUDA 3DYVA 3KSBC 1IJFA 4OFZA 3GD7A 5D84A 4OQZA 1ANKA 4HGNA 4LSGA 3WKDA 1TT5B 1T4MA 2OOSA 4GPEA 4P35A 4Q7JB 1JAYA 4RZQA 1XTPA 3VH3A 1JGTA 1PJ8A 4Z4CA 5JDCA 5LD2B 4N41A 4PINA 3DHYA 4B5LA 2NTJA 2W4IA 3ND9A 3NHBA 4RIFA 3U5ZB 2OBYA 4ZVNA 3WNQA 3ISJA 4AJOA 4DM7A 1T5LA 2GD6A 3EMDA 4A6DA 5HWSA 4NLLA 1DXOA 2EF0A 3K0EA 2DHDA 1R9MA 2F9LA 4W5NA 4P38A 4HQRA 1D5CA 4O1HA 5ER6A 2EHDA 3A9WA 2PVSA 3TZHA 1NIJA 3AT1A 3QXJA 4AG5A 1PNOA 2J5XA 2WQ6A 1JKJA 4PFSA 3EH1A 4PLFA 2ZRGA 1TZMA 3H4TA 5G0WA 1E2HA 3C8HA 2OXTA 3N2KB 1Y6GA 4OHFA 3O4JA 4V1CA 3D7KA 2QK4A 4R8LA 1GUFA 3KJNA 4II7A 4N7MA 4ZDWA 5BMVB 2UUPA 3RSGA 5T3UA 1VKHA 4L9WA 2RFLA 4NABA 4GZ3A 2QSJA 4S1NA 1VA4A 3W1EA 4BNYA 2JGDB 1ZAYA 1C7IA 1HDRA 1QH1B 4KYVA 3GLHE 3QITA 3UQZA 2EJTA 4OYRA 3HBNA 1Q84A 2Q5OA 3M4XA 3RC1A 5F7OA 1NR7A 2OUIA 5DLYA 2V0GA 1VE7A 4OCZA 1NBAA 3PE6A 1R9NA 4IRUB 4EP1A 4DB2A 1QDLB 4MQLA 5KJCA 4HXEB 4EUNA 2X3YA 4EEZA 3WL5A 3P4XA 3U7JA 1GZUA 5BVGA 1XZEA 1VYHA 2VXOA 4ISCA 3VPFA 2WG2A 3KT0A 6YASA 2VFAA 2WZCA 4K26A 3JR7A 4I99A 4OFBA 3Q3GE 4AYTA 4EAQA 3FPCA 2KSQA 3SYMA 3P9ZA 5JMWA 5AVKA 3E3MA 1BS1A 3D6VA 2GHIA 1B3RA 2FPSA 2FOXA 2IHTA 4KDEA 5GJCA 4PGHA 4RD0A 5D3MA 3SOZA 3ZE6A 1E98A 5FNZA 2DLNA 3DZ8A 3NVMB 5DYTA 5AVSA 2FSVA 3O31A 1LBIA 3QYJA 3SMVA 3L4KA 2JKZA 4S0ZA 5EMKA 3RK1A 1E6KA 2A94A 1ZINA 3E5RA 3IIIA 1XJQA 4PAQA 4WJKB 3FYSA 3W3AD 4DM4A 4D80A 3A32A 3FWPA 2CXUA 4Q37A 2AN9A 1Z6ZA 2ZTLA 1E8DA 4XWWA 3MFQA 3DD5A 1DIAA 3HWWA 3PNOA 4WHMA 1JWAB 4TUYA 1GZ3A 3DFMA 4N8SA 3AOGA 5JCPA 4GKKB 4OBBA 5EIFA 4CIYA 2GSDA 1DV1A 3HKBA 3AM4A 1L5QA 1U3CA 3ED5A 1NVWQ 5GV7A 1BHQ1 1NBME 2XSZA 2BW0A 3C41J 1R37A 2FPLA 2GHTA 3L0SA 3P94A 2C2WA 4ZRNA 1ZKMA 4WZBB 3MXOA 3GP8A 1PVDA 2OPBA 4HUQB 4LJ7A 2J5QA 1KZ4A 2UYYA 2ZR8A 2VL7A 1BFDA 2HQ1A 4ISBA 3HO6A 1U0RA 3HL4A 3FPKA 5KJEA 1OAKA 4GVLA 4CKEA 1HK7A 1DFHA 5BRAA 4AKHA 4F3YA 4UVIA 4M1KA 1JEQB 4X60A 2ZUFA 3AUUA 3FGOA 4PICA 2OCLA 4KE6A 3CZMA 2BFEB 2BM0A 4QBHA 5JJCA 4QLAA 3GCXA 1F60A 1KL7A 2IUSA 2HDWA 1UWCA 2MSWA 4G8DA 3LWBA 3IPYA 1G60A 3RVOA 1FS6A 3BD8A 5BR8B 1UJMA 1HF3A 1N7JA 4M83A 1V43A 2M2IA 4HYQA 2V9PA 4Z9FA 3DEAA 3HCNA 3ZNQA 2PT6A 3RS2A 4JBLA 1E5DA 2MJLA 2Q4RA 5HCUA 4DJTA 1N1GA 3EEQA 1UPTA 1OTHA 4F9TA 3CO5A 2GLXA 1O6FA 4E4RA 1U8XX 3QMVA 3JYHA 3QHAA 4YAIA 4YJ3B 4FYJA 2OFWA 4UE6A 4OHYA 3EFEA 3KPJA 1CR1A 4GYJA 4TOIA 3PLAE 3C85A 4ED9A 4HDCA 3T35A 3RRMA 4GZLA 5BPFA 2ZUSA 4PAGA 1C81A 3LVQE 2VRNA 1A4XA 4MWEA 1USIA 1SJ9A 3PUJA 4FMBB 4WFQA 2LCFA 5EUBA 3AOEC 3VBCA 3WR5A 4C78A 2CMDA 4ZQIA 2GJSA 1ZD2P 3OZTA 1SOUA 2OA0A 1HDGO 2K6GA 4M46A 2ZJFA 3NNSA 1ABBA 2ZULA 4FTWA 1P61B 2GZAA 1KJNA 2J5RA 3IPAA 2PYZA 2ZQZA 2OY0A 1P72A 1UDXA 1M9NA 3KUXA 3L0PA 3HJNA 4RACA 3CRMA 4OH1A 5EWJB 4V0MA 2FMFA 3VNUA 2AZ4A 3WIDA 3MMXA 4BTLA 3FDZB 4BHTA 2ES4A 2XT6A 2R2GA 3HJAA 2H1WA 1TTHA 1Z8HA 1VJ0A 2P79A 1V7QA 2ZROA 3AZQA 5A1TA 1E1CB 1DBIA 1TGVA 2KE5A 5LPNA 5J23A 1AKUA 1DC6A 2QNBA 1K06A 2CBGA 4ZDJA 1PZXA 5D86A 4UPEA 2NV6A 3K72B 2HM7A 2CJPA 2BGNA 3L8FA 5LM3A 1PJ4A 3KCQA 4L9RA 2B4QA 1TAHA 3G7NA 3N53A 4V24A 1Q0PA 2AE2A 1MAHA 3D6UA 3FFTA 5CFLA 2PFGA 3PQCA 2QMUA 1KSFX 4MW4A 4DLPA 5KNDH 1G98A 3EA5A 5AKIA 5E1DA 4JJIA 3RROA 1BYIA 4IEEA 3DFIA 4C7BA 2VK8A 5ECGC 1C41A 3DBOB 4HLUC 3NTQA 3BWBA 4UUOA 1RI5A 2XUPA 1C3LA 3ZBUA 1N0IA 3KU4A 2JLXA 4EHBA 3R1IA 4J4TA 3ORHA 2Q7XA 4P31A 1MVOA 2GAIA 3O2NA 4DGSA 4DQKA 3A14A 3HI6A 1KY5A 4M54A 1GPH1 1P45A 2APJA 3EEYA 1I4WA 1TLTA 4TLDA 4Y1EA 4CFYA 2YWBA 1L8AA 4I4CA 2ZZMA 4Z1OA 3FHLA 3FE2A 1GTJ1 3SEFA 4DA0A 3COSA 3E8MA 4IILA 2C5BA 1P4JA 3N8NA 4BKOA 2JFUA 2X5OA 3JWJA 3N07A 3R5XA 5AKHA 4QULA 1XLTC 3WY9A 4C89A 1HE4A 2G83A 3E9ZA 4ZI2A 4OQMA 1NKVA 1PHPA 2OXCA 3BE8A 4URZR 5HHTA 5CEJA 2NQTA 2XADA 3I9OA 4YTEA 2OYRA 1NNI1 1YZGA 1PR5A 1QIMA 1Z5VA 2J7PD 2YZ7A 5KKNB 2ZS8A 3KT6A 4OJTA 1L1EA 4P7FA 3OPNA 1XYVA 4AYXA 5TB5A 4YMHA 1NOIA 3PBKA 1T6ZA 2GCOB 3DMRA 2RGEA 4NONA 3ROEA 2G77B 3CGGA 4JFAA 5IARA 4AU1A 1OWOA 2BD0A 5AJYA 1NNEA 2X2PA 3HB1A 2PSHA 3E0QA 2YVKA 4MQUA 4WX2B 3VNBA 4AXBA 3H1FA 4DY6A 4H2DA 3TE7A 3B6JA 1UPBA 4QUAA 4ZZ3A 3AZOA 4JUBA 5LA6B 2IT1A 1OA1A 3W2HA 3PXBA 2GN6A 3B1WA 1S9HA 4BRUA 2RBKA 1W76A 3IJEB 4Y7CA 5JEDA 2GEUA 4KXVA 1RQXA 1CNMA 2ZJZA 3T3PB 1KEZA 3L9WA 5FPKA 4OG2A 4D8XA 1S2IA 5TJHA 5TPWB 5F2KA 1D04A 4KRYA 1L9KA 2QJTA 1VG0B 2DZDA 3UHFA 3WJ7A 4LRTB 2IYVA 4NHEA 2CHQA 4ZEXA 2BJHA 5HS6A 4GC9A 4BO5A 2IP1A 2F1RA 1A69A 2IYPA 2Q6LA 3F6CA 1SKYB 4J3JA 4LXIA 4GP9A 1G21B 4FW9A 5EJ9A 3A1WA 1JA0A 1PJTA 3FFXA 2PCJA 2V03A 3GX1A 4TKUB 1UQTA 4EVRA 1VGQA 3ANMA 3H2YA 1T2CA 1UPAA 1OFUX 2WKRA 4IRMA 2HLNA 4JR2A 4P7KA 1Y9AA 5E6UA 3W34A 4KRXA 2Z8YA 4Y2YA 3EXHA 3MG9A 1RHMA 3LPNA 1KPIA 4LRSB 3K0CC 3EQ2A 4X41A 3UJNA 4B2LA 5ADWA 3HY4A 2AG5A 1OFUA 2W2LA 3OJFA 1G2PA 3K6KA 3VH1A 4B1FA 4B4WA 3AF5A 4O1MA 1KIMA 3VQTA 5JY1A 2YWGA 4LYDA 1VKJA 2YVUA 5IASA 2WD7B 5REQB 4M1TA 5GVRA 1VTKA 1KJ9A 3VR6H 4CMGA 3UOGA 1WEKA 1LLFA 4KW7A 5DK6A 3C98A 4DCMA 3D5TA 3CPHA 1IWBB 4IXTA 1D1QA 3P20A 4D5GA 2I80A 2DFKB 4DSUA 3FJYA 2R5NA 3VR0A 4B7XA 1K1EA 4X90A 3ZHYA 2PMFA 2QW1A 3HR7A 1ODJA 3HU3A 5EHGA 2Y1DA 2X8JB 4Q24A 3N0TA 3VZCA 1R3UA 4NULA 5CYOA 4H7FA 2K5UA 2YC2C 4B45A 3SPXA 3GLGA 1K89A 2QBYA 2R47A 1WZCA 2XB4A 3JW8A 4YO7A 4TMVA 3A10A 1A72A 3LVFO 5CDGA 4NMHA 4JEIA 1WVMA 1OXXK 1MA0A 1OF1A 3R0JA 4LCJA 1VLZA 2HLDA 2MSNA 4JASB 4OXRA 2EBUA 3ILYA 3IKLA 3R5JA 5DNWA 3UMJA 1I5RA 2CK3D 2J3QA 4NPHA 5BYJA 5TVGA 2PKRA 3WWDA 3RAEC 1J1UA 4RETA 4E11A 1EHIA 1BTOA 2NU6B 1YFJA 3P9NA 1Z2EA 4PSKA 1NMYA 5HFNA 1G3MA 3PQ5A 4UAGA 5CK5A 3HPRA 5IVHA 4I50A 4Y2QA 1T2NA 5CM9C 1JQLB 1M6VA 3WMGA 1GPYA 1V47A 2DB3A 4QE3A 1KI2A 3OD5A 4P53A 3NAGA 4KWHA 4QAJA 5I7WA 4LF4B 4WLUA 1O08A 2C57A 4L2IA 4GT1A 2GPBA 4LCEA 5KKCA 1J9GA 4UZFA 4LVCA 2DH5A 4UZEA 4D8WA 5DM4A 3FKQA 3H04A 3SLGA 4X1YB 3N86A 5HUQA 4AY3A 1FU4A 2QMQA 3V6LA 1YIDA 4MW0A 2BZSA 3ECSA 1U02A 3A1VA 3LO8A 5KOHA 1JYEA 2IHZA 2WA1A 2PLNA 2YWRA 1MABB 1U6JA 2QN3A 3KV3O 3GWGA 3IOBA 3M9XA 5ILOA 1XP8A 5DSZA 3FMFA 4B3BA 4GOLD 1QMGA 4J75A 5EE0A 4BIIA 2OCAA 4BNTA 4DDTA 3ES9A 4RFSA 4WMLA 5CEEA 5TEWA 1TCUA 3QU2A 2BLNA 3KJZA 2P4HX 3AILA 2JS7A 5HBGA 4M7OA 1DG9A 3WGNA 4QNNA 2J1LA 1D6NA 3CINA 4V0KA 3OAAA 5I9TA 4BMCA 3QOFA 3HXPA 1GPNA 1E7WA 2GPYA 3EA0A 3AR4A 5DWDA 4C2BA 4AUEA 2PGOA 4MPDA 4PN7A 1M8KA 2VTBA 2G8NA 4MW7A 4D42A 5BR1A 3AWDA 1UFKA 2XUDA 3B7WA 1XA0A 3GA7A 4XZ3A 2FQXA 3STHA 4DMMA 2QLFA 5GWXA 1ZGHA 1QK5A 3M6UA 1W36D 1FUUA 1XF9A 5CB4B 4YNBA 2SECE 4HSGA 4MUFA 1QIEA 1BROA 3NFYA 1DI0A 2NUPB 3RYHB 3H3JA 4C08A 1LQ2A 2FEOA 4GSKA 1T36B 2PX4A 4RPIA 5K3DA 1FVHA 2PSEA 4LF6B 2HPVA 3W8EA 3HCOA 2M6LA 1A9YA 3Q2IA 5KAMA 3V4OA 1UC8A 1C8KA 2IEBA 4P0PB 3V34A 5EOVA 5EXXA 3JR3A 5GMOA 4UHDA 4FKMA 4OXQA 3DZGA 4X97A 1G2QA 4C0SA 1AS3A 4YR7A 5B12A 2WJGA 1W34A 1YDFA 2HZ7A 2XTZA 2XXAA 3GNLA 4K0RA 4NDNE 4NNPA 1ORRA 2WKPA 3HXKA 4TROA 4GXTA 2YOHA 1SXJE 3JD4A 4BFUA 2VYQA 4YAGA 2OCKA 1MNAA 2PO5A 3GPCA 4NDAA 4GGMX 1NXPA 1FOEB 5CT6A 3T3OA 3EUWA 4ATNA 2AMLA 1UT6A 4UHJA 5F4BA 2ODAA 4IV0A 4AW9A 4CQNA 3WFIA 4WLNA 4TXNA 2WAAA 3GPBA 3TKYA 1EVYA 3MQFA 1IMOA 3NT5A 4ZQFA 3P2IA 3SC2B 3MILA 5K3FB 5GADl 1MENA 3T38A 4EKYA 1N2BA 1POXA 2NQ2C 1E3EA 3LWNA 3EDOA 5CHEA 2ZJ8A 3IHTA 1F2UA 1YS6A 4FEYA 1RXYA 1E6WA 3EOZA 4I3FA 4LGVA 4QQNA 5G53C 3SQDA 4TPKA 3W1WA 4AF6A 2KYRA 3ZDFA 5IHPA 1EUYA 1DJLA 2PKQP 1T5OA 1YULA 2VT2A 4IJQA 4GLJA 4G84A 1B26A 1TZCA 3ILHA 4O4LF 1S3FA 5AKZA 2IFTA 4JB0A 5AUQA 5IWAB 3R24A 1N5IA 2UAGA 3K0SA 3NIBA 3L9XA 3T7EA 4EG1A 4NJEB 4Q9KA 1X7WB 4C2TA 1DWQA 2V7QD 2YR0A 3QE4A 2QXYA 1LQTA 3AERB 3O73A 2IU3A 3KWLA 3N59A 1CDOA 2X22A 1Q0TA 4M0LA 4NDZA 4BKQA 4G0XA 2FFBA 1GLGA 3PCXA 1CV2A 1Z4OA 2J59A 4YI3A 4JEUA 5MHTA 2PGIA 3PIRA 4O08A 4FDUA 1Q7GA 4HX9A 3U61B 1U0NA 1NSFA 3KKMA 3ASZA 1BRMA 4IIVA 1TM3E 2H2AA 2I65A 2OXRA 3D6HA 4Q3CA 3IAM1 2E89A 4JT4A 5CT4A 1Y3FE 4BFZA 2B1IA 3D1JA 1Y1KE 4HBGA 1LVHA 2WFZA 1H9CA 1F5SA 2NTNA 2CLHB 4TWAA 3ZHXA 3ZWCA 5K3FA 1HA3A 5A9SB 1Z39A 2C9OA 5C1BA 3T5BA 3DFKA 1NJ6A 1G9XA 4Z4QA 3ZIAA 3C8MA 3G8DA 5JXHA 3AUXA 3R7SA 4BAGA 3H13A 6ADHA 2JCGA 3BGDA 1G20A 2YS7A 1HFJA 4MJXA 4PTLA 3ZU5A 3K0CA 4KG7A 4B3JA 4DBLC 2GEJA 5M04A 3V8EA 1QCCA 2FW7A 3DPSA 4ZV9A 4YREA 4AMYA 3Q9UA 2ZCJA 1MB0A 2CXQA 3ICQB 4U2EA 1M2VB 4YPFA 1MB2A 1NXOA 1SN7A 2P4EA 5TIIA 2W0MA 1JVBA 3LOUA 4EI8A 5KUTA 3FG9A 1H9BA 3VM6A 2DCMA 2NXCA 3U2QA 5KWVA 1ZPDA 1TCVA 3VH4A 1A8PA 2CJWB 3O4FA 4YHBA 3D8NA 4BFTA 1C7JA 3QP9A 1J49A 2NAPA 5HYVA 3B2QA 1T5IA 3P5BA 2AOWA 4DJEC 4YCLA 5IKEA 3ZDXB 5IXYA 3FZQA 3OMLA 4M38A 4CF3A 1KZ1A 2IGTA 2IOQA 1DBPA 3IMFA 1USGA 2IF0A 2JFQA 5E7JA 4DG9A 1K6EA 3ND6A 3IESA 4RZ3A 4C0WA 3PL1A 3GP5A 2QYSA 3GJ0A 3O8QA 4HMQA 3SFTA 4C88A 1GPKA 4LXYA 5BURA 4HEA1 2IZ6A 5CFMA 4RTNA 3HXQA 3QE9Y 2QHXA 1E62A 1MC4A 5ED0A 2REXB 5KTPA 5CR9A 1NI5A 4WXYB 5TQ0B 2O8NA 4N8DA 1ESCA 3DT9A 4FYXA 3A9TA 1ATIA 1UKBA 3IAAA 3TZQA 3THYB 2RHHA 4NCNA 4TKVA 2P6MA 3FYUC 1QF9A 1GKLA 5EERA 5A6SB 5HPYB 1ZJWA 1J2RA 4KV7A 1QC5B 1BYUA 4B6RA 2RHJA 3NHMA 1X42A 2Q9BA 4B47A 1A1VA 4Q9NA 4EYEA 1JHYA 3IL2A 4Q3NA 2AS0A 4C22A 3B1KA 3IPXA 4DJ5X 1U2EA 1TIKA 2JLAA 1GNSA 4N6GA 1M7HA 3S5JA 4DWVA 5LMUB 1KEWA 5K5EA 1ENOA 3WLNA 1KNQA 5IZCC 2XIQA 1MR3F 3GZ4A 1T5HX 3LUKA 2WWFA 1V11A 3F9CA 4M99A 1TNDA 4XIIA 5DO9A 4CLOA 4LJKA 3TB6A 3O6VA 1YAHA 4D2IA 4YV7A 1BVRA 1MG5A 1UKVY 3R40A 5KVCA 2QUZA 4LOKA 2F00A 1W0KD 4GDMA 1AHHA 2C2XA 3UT5B 3QK7A 3NHPA 1RJWA 3GGGA 4NATA 4BMDA 5AK4A 2QENA 3GAMA 3K2IA 3KKPA 1MOQA 3C8ZA 3OUZA 4HMOA 3OP4A 4RUKA 4XIFA 3RVBA 3VTKA 3C43A 1U80A 2WVHA 1AB6A 4Q1VA 1K7YA 4HRYA 5JVDB 1PFYA 4EBFA 4H15A 1U5BB 2FPIB 2EAUA 2PQ6A 4NCBA 2WVAA 1S6YA 3CX3A 4ZU6X 4AECA 2UUCB 3R7DA 1WDTA 3QOXA 3HGTA 4FIZA 4MUYA 5BNIA 2YWFA 1GYPA 1HI9A 3VNQA 2VKQA 4ZODA 4CKCB 3HPQA 4UE3S 4Y1FA 3IEUA 5CA0B 4WCFA 1EH5A 1VB5A 1HMYA 1VYVA 3N05A 3HE3A 2NIPA 4YAWA 3G0IA 1N9ZA 1NPDA 3BWXA 3NHFA 3NKVA 5I8ZA 5L7TA 3ROPA 5K0FA 1CRPA 3IALA 2BN4A 4D5EA 1L4FA 2PUWA 2BTEA 4AUNA 1B6RA 1Z2CA 3EFHA 4KIFA 5EYPA 2N42A 1FCJA 3NYIA 1TMGE 2FUNB 5JAHA 4MS3A 3OY2A 1LW6E 3UJAA 1JXMA 1UAGA 4BOYA 5KNBD 4LMPA 3MMZA 3UMMA 4LF8B 2FQYA 3DDWA 4FUQA 3DLPX 1H23A 3PGLA 4RY2A 3OLCX 3VZDA 5A4JA 2K87A 1A2KC 4ZC1A 3VYUB 1YR2A 4X8OA 4QJ3A 3M1YA 1JDJA 1FTSA 1H8HD 4EF5A 1KQGA 3KDSE 3RRBA 2XGSA 2BKLA 2ZIUB 4FSXA 4E5DA 1AQJA 1QLWA 1TEXA 2FVXA 1THTA 3T3IA 1J4AA 1YBMA 1YJBA 3CW8X 1PNTA 1IHOA 1G3QA 2OR3A 1ORVA 5HKAA 4BFSA 1LLQA 1C7EA 2BFDA 3AK4A 3MUNA 4G1FA 3GHHA 3LCCA 4PGMA 4JNCA 3STYA 5ABPA 1KQFA 4DPKA 2IVZA 3Q6NA 4FBLA 4JJ8A 2UZ4A 4BLPA 2G36A 3RHSA 4ZHSA 2QT9A 3UAYA 4DV6B 1RAAA 4ZA2A 1P1KA 3HCPA 5IVPA 3UMYA 3WA6A 2XNHA 3SJCA 5THKA 1EFHA 3BDAA 1I1QB 1HC7A 4KQFA 2BZ1A 3DCJA 1PJRA 4QVIA 3EAFA 2IEZA 3AI7A 4HAXA 2QR2A 3MOIA 5ED4A 5K7SA 3QEJA 2JCVA 4LHXA 4UC0A 4MP6A 3COPA 5K8IA 3LD9A 1AIPA 1M8GA 2HIAA 2OBLA 1FDTA 3GJ5A 1O7JA 1V3TA 4WESA 3HDGA 5EPOA 1C30A 2Q6KA 2WF9A 4FX2A 4UPVA 3THYA 1M2EA 1U3FA 3M2TA 2V97A 3H1GA 5JQGF 3G2NA 1AKYA 3TLXA 4ENQA 4XOUA 1NLUA 3VO1A 5I5EA 4K6GA 4KNVA 4PBRA 4AZ3B 4OB6A 4FPXA 4BNWA 3HDHA 5K6RA 1KJQA 1Y98A 3S99A 2QMEA 1P2DA 3DMTC 1FF9A 3GLRA 1QO0D 1SBTA 3K9WA 2ZSHA 4WGGA 2I66A 1M33A 1IC6A 2GCNA 3Q8WA 1X7ZA 2CHUA 4HXFB 3K8YA 2O5RA 2L42A 2AI2A 2YUTA 4M0FA 5IULC 4KMOA 4LY0A 4M89A 4GL2A 3QVKA 4BAZA 1XAGA 2L18A 3DE7X 3JX9A 1PD1A 4GKBA 4KXLA 4EDFA 5CDTA 1JE1A 3EG9B 3TB4A 1LY1A 4CMCA 1PQ4A 2J31A 3A2MA 2JFOA 4IHKA 4H3HB 2H65A 4GI5A 2QJWA 2H1HA 2JPDA 1T9BA 2WD8A 2GASA 1WU7A 1FXSA 4LOJA 2HYIC 4E5SA 3LGAA 2XMZA 3LQ2A 3U7EB 4M55A 1Z0SA 2RGGA 2VF5X 3THXB 4FEEA 4NYIQ 4WLFA 4J0EA 3PSAA 2W5UA 5KSYA 4O5OA 2BYTA 1Y7IA 3WDMA 3DVSX 4M4SA 1GSHA 1RWMA 1Y1SA 2E5FA 1PW7A 5HTKA 1T9KA 2QU7A 4YQZA 4M9ZA 1UKZA 4G0YA 2WJJA 3DOEA 4LHYA 5DT9A 3ZGNA 1C8LA 1E7SA 3WISA 5C32A 1LPSA 3HI4A 4G9GA 3RSCA 5FDFA 1UDBA 5BT9A 3UMGA 1GADO 4JDPA 1Q0ZA 5CNIA 1SHUX 1Q20A 3CX4A 1NM5C 4W9NA 3S7ZA 3WO0A 2C97A 5C53B 3HM9A 4XUDA 3ILSA 3KX2A 4DADA 1QIGA 1SY7A 2UYCA 8ABPA 1DO8A 3H5LA 3IVAA 1NMQA 3W3ZB 1QAOA 3OX2A 2HW8A 2P2NA 5CDUA 4OJMX 1NSYA 1T91A 1U4SA 1NFQA 2QG9A 3A3NA 3IURA 1I2DA 2FUG1 5E95A 5DM70 1MJ5A 2AWNA 3L7LA 1Z8FA 4KSCA 5TJ9A 2R5WA 3RYTC 2I55A 5K20A 1U0OC 1EFRA 1FYWA 4OATA 2HIMA 4BP9A 3VOBA 4FFBB 5G41A 1THZA 2OO3A 3LHKA 2CXNA 3V00A 5C1PA 1WXHA 1ZWLA 3MWKA 4FUTA 1VFNA 4XRGA 4G0VA 5DSTA 4MEJA 3NALA 2HXYA 2ORWA 2O1XA 1V9SA 3CLKA 4IHJF 4PX9A 4UVEA 4EK9A 5JXGA 1F1JA 4BNDB 1IM2A 1VKZA 2BJVA 4FFOA 3G68A 1XYGA 3QFFA 4ZDKA 1DAHA 4NWIA 4CMAA 2HA2A 2ACWA 1TO1E 3DKVA 2QYHA 5C3MA 1JFFA 4L72A 1UF9A 2QPOA 2KPOA 3AEXA 2P5UA 3AY0A 2RH9B 1O89A 2GXSA 2JLCA 2P2YA 2W6JD 2X9GA 3AC0A 3KUDA 3M1LA 1RAGA 2P8SA 3N2GB 1I7LA 1RKQA 1WMFA 2IDJA 2JCXA 3P0EA 2HGSA 4BRZA 1MHTA 5BWCA 1J0EA 2MYUA 2QD1A 4QUGA 3D2CA 1SUIA 1TU0A 5CVJA 3KWJA 2VJOA 1SCDA 3TGPA 3KR2A 1JHAA 4L3OA 5LMCA 2B1GA 4IICA 4PG6A 1H8EA 1SZPA 4KIUA 5AKJA 4RNCA 4WBNA 1JE0A 1C0LA 5JFGA 4AN0A 4E2XA 4IQFA 3O38A 1XCLA 4CEJB 3HYCA 2OCIA 2XWSA 3A06A 4PLZA 4IPTA 3NH6A 3FWZA 2F9FA 2VTKA 4MR9B 1N9GA 3KB8A 3MHPA 1OYOA 3PF9A 2RD2A 3SEZA 2G9RA 5DHFA 5L3VA 1WMEA 4EPYA 4YJ2A 2AQKA 3GRCA 3CZAA 5KPJA 4AXXA 4IF6A 3C5EA 2W6NA 3GP3A 3DBRB 3CUSA 3EXIB 4OUKX 3U16A 4TLCA 4EO4A 4OXIA 3HCDA 4R05A 4G5SA 5JO0A 4ILEA 1TKAA 3KPVA 4PHTA 2C3MA 5BV7A 1CDZA 2YFHA 4BN0A 1VL1A 2IKQA 2X7XA 2BKUA 4L1KA 1PR4A 3HUUA 5B1HA 2V3VA 1PWYE 3EVEA 1CR2A 5H3CA 4DWOA 5AKEA 1X7ZB 1MP0A 2IUTA 2JH8A 3C3KA 2JFNA 2R68A 5J5CA 121PA 2V65A 1HLGA 4JVMA 4YMUA 1Y7LA 4Z3OA 2QJFA 4NF2A 4MKGA 5DNDA 2EL9A 4Q1DA 2P5TB 3VU8A 1V8ZA 1YR3A 2YXPX 3N3AC 2Y1GA 1KIAA 2PNFA 3NIFB 4CQMA 1MBZA 3UMCA 4F45A 4YXFA 1W5SA 2C9ZA 5J9FA 1QTQA 3OC0A 5KJ6A 4I4LA 4MRMB 3MTAA 1L3BA 3I73A 4ZP1A 4QFMA 1YQGA 4JVNA 2E4WA 3IDOA 4PLPA 4NMMA 1Z0ZA 3ACDA 4K6CA 4YECA 4REQA 3HR8A 1YUBA 3ZLJA 3DUWA 2Y0CA 1H69A 5EEGA 3W05A 1ZCBA 3AQIA 4QODA 1UPXA 1RQRA 3EZGA 3T1HB 4YCCA 4IRXA 5L7WA 4BO3A 4IMIB 4MUHA 4JR1A 1JHQA 1RT9A 2AG8A 4KO2S 4NC9A 4QYXA 2D0OB 1DU4A 3SSAA 3JWPA 3D2AA 2Q4OA 1OFGA 5KNDA 4N01A 3T54A 2VZLA 4ND8B 4QUJA 3X2EA 4UXIA 1RKVA 4D0SA 3LL4A 3KXLA 2QUJA 4NZMA 4XQ9A 4C7VA 1AQYA 1XV5A 4LI3X 4NH4A 3CUKA 5AWFC 3SC2A 3B8HA 4V2IA 3HXMA 1BO6A 4ALLA 2TYSB 1D2AA 2FRVA 5K45A 3P0FA 2YZNA 1WXQA 3HU1A 4TKMA 3TZKA 4CR7A 5I5GA 4RNDB 2CXHA 2IUFA 2KBEA 2R97A 2BFAA 1YHYA 5HIKA 1P8AA 1W0CA 4XX1A 4LWQA 3EGEA 3MWLA 3GR6A 3DAOA 1WCXA 2W43A 3N8IA 4NNOA 1QE5A 2UVPA 3O4IA 4MR7A 4BFXA 5K8UA 2Q5QA 3N76A 3B5JA 1OHHD 1HEIA 5EXDA 3U7QA 2H16A 2QNRA 3OBBA 3HVIA 1A88A 3OEYA 4R41A 3W6OA 1NZDA 2GXUA 3G1UA 6Q21A 3GDGA 1SKBA 1ZOIA 1NP6A 3RKRA 3SZ3A 1Z34A 3MVEA 2BPOA 4JWTA 1L6RA 1JIKA 2C1EA 2O3QA 3CZRA 2I3ZA 3L4SO 4YDQA 4WH0A 2W2PA 2GFHA 3KQUA 2O5EA 4X61A 3DMDA 4N5IX 4FEAA 1GT91 1K7XB 2V3WA 5IDYA 5JYDA 2TMYA 1JJAA 2V6MA 1QHHB 1SQFA 1YS7A 4ESHA 1U6IA 1E9BA 3EGVA 1R6TA 3GEEA 5CM8B 4PBSA 2C83A 2BGWA 1QQ6A 3FZNA 2IS4A 3MCWA 1MTZA 4GLFA 4A8PA 3NYWA 3CY6A 1Y3HA 4J49A 5LB2A 2CCKA 2R6CA 4QT0A 3AR7A 2XF8A 4TVSA 1KWGA 2G3YA 3H2IA 1YR8A 2EW2A 2VDJA 1B1AA 2XMQA 4DBVO 1XAIA 3RUDA 1TVMA 1RI1A 1XPOA 4D8UA 1BG6A 3K70B 5CXSA 4M1EA 3LV8A 3MGGA 4ARIA 1T8PA 1Z7YA 4WXHA 4LV8B 1BSVA 2DG2A 5KOJA 3ILXA 3RYHA 3BD9A 1NATA 2ZIGA 4R69A 2VATA 1DJPA 3V3TA 3M6LA 5JAMA 4D25A 3MK31 3NATA 3PI6A 1S3IA 1W5AA 3BFVA 3C4VA 2W6OA 3OZ7A 3R23A 4O59O 4NU0A 4P81A 1YQUA 2XYRA 3DV2A 4I8IA 2VEOA 5FBKA 1Z15A 4EGAA 1IB0A 5AVRA 2XNCA 1IZ7A 1E3IA 2E55A 3AUJB 1PLLA 2QRVB 2J85A 3FDXA 4URFA 1G4HA 2GF9A 3BS4A 3VPSA 3ZVRA 2WYWA 3OZEA 5KYKA 2Y1OA 4PAWA 2CYAA 3PXAA 1CUYA 2B36A 3BSFA 5F33A 4UKDA 2JB9A 2Y99A 2YWJA 4L2IB 5LKRA 4L4UA 3P97A 4XGIA 1J9EA 4ACAA 1ZNYA 1J21A 1ADJA 2C8KA 2FJ0A 2PJDA 3O1HB 3Q0IA 4OHOA 4QC2A 4YRSA 3MZ0A 1XZNA 4AG3A 4DWJA 5FQOA 4I1VA 4RU1A 3IR6A 2FJPA 1EINA 1ULZA 2E4AA 3DEYX 3UFBA 2CUKA 3ZI7A 4GLBA 4G56A 2IDZA 3N2LA 1W75A 2HCBA 2EFGA 4Y9RA 3OIYA 4CHGA 4FE3A 4CM9D 4DDUA 5A4AA 3GLGE 2W6MA 2WSIA 1BXRB 5IFKA 2VPXA 4JJGA 2W00A 4MS3B 4H7EA 2AFIA 4CT5A 3HNRA 4D4MA 5JNVA 4TMYA 3DLHA 3TZ6A 3LX4A 4V3BA 4HVLA 5KNLA 2XBLA 3I9KA 4AVYA 1WNFA 1OB5A 3KWFA 2KX7A 1E2LA 5SY4A 3ZK9A 3TTWA 1X7GA 2TMGA 1O57A 2WUWE 4PC2A 2JI6A 5GP1A 2ZS9A 1HOXA 4PC7A 1W49A 2YXNA 3P4YA 1E6MA 5EE3A 2B1QA 2CJXA 3IHKA 2CNWA 2OFOA 3IQDB 4QO7A 4KSYA 2GXQA 4B80A 3T5GA 2VHCA 4KZPA 1WQ1R 2VK2A 1M6NA 2X1HA 5KU1A 4KLRA 2C8JA 2ZWPA 3OOSA 1E3MA 1QP0A 1GRVA 4GUDA 1YBHA 3V4SA 1GCAA 3MWJA 4UATA 2RI1A 2SKEA 2WSSA 5FF9A 3NHZA 3C5VA 1WY5A 1CUWA 4EW2A 1GHTA 1GUAA 3WGYA 1MKYA 5TQVA 4RO0A 3BTSA 4TQAA 3D9QX 1ZOSA 2AVDA 3IPRA 2R4TA 3TPCA 4U0JA 3P5SA 2PBRA 4XFDA 1SVSA 4HVTA 2P1DA 1S7GA 3WL4A 3U3DA 3KRTA 2OGZA 3N5CA 4DAOA 5ALYA 4F86A 5JBNA 1SPXA 2QTHA 2A9QA 1Z9BA 2V96A 4CEHA 4B3GA 3FUTA 4BQEA 3NHAA 5IYZB 2J45A 2WU0A 3EWAA 5FX2A 1D2NA 1E63A 2EU8A 1NLFA 1WW2A 3B36A 1XA3A 3GOQA 5EZQA 5BV0A 3KZOA 4N5NA 5IJ0A 3GRVA 2GD1O 3H84A 1TK9A 5L95A 2AKAB 3OIFA 4RHYA 4YBZA 4DYHA 4E0BA 4GGPA 3VTAA 4DV3B 3AEZA 5L4NA 1KO1A 5FXMA 2XRMA 1W35A 4B8YA 2LKCA 2IE0A 3I4CA 3PQ8A 3KEGA 3RSZA 4BLQA 4Z4EA 3L8MA 3OLZA 2XHZA 5I51A 4UNRA 2PAFA 1G20E 4ZZ0A 1LZLA 1ZHHA 1U8TA 2PKQO 3RF7A 3K92A 3IJ5A 3KYCB 2P1RA 2IHJA 1DQNA 1ISSA 2XD4A 4BO7A 4RABA 3HCFA 3GJ7A 3AEQA 4TV8A 2Y93A 2JFBA 2ZJ3A 2PUTA 3IULA 4WIAA 4CIDA 3SM3A 1YZHA 3KSRA 2JGDA 3DV9A 2C03A 4FMDB 2BWJA 3DLCA 3U7RA 1YQEA 4IVPA 5CVTA 2ZJAA 1ISRA 2GN2A 3L0ZA 4LWZA 1SUWA 1H3NA 4E5VA 2VO1A 2LDXA 2VP0A 5HE8A 1ST3A 2BKXA 2NZ2A 2Z2YA 4YQYA 4UTZA 3UENA 2FW6A 2J6HA 2VSNA 4BWFB 1XHFA 3WK7A 3GO4A 1W19A 2UYOA 3LP8A 4FJ2A 1YDEA 2JVIA 2Y2VA 3TZEA 1PEYA 1DKLA 1L7NA 5KNBH 3SQWA 4L5IA 3OM0A 3SQOA 4E5NA 3C5WP 4K1XA 2NYAA 4C9BA 3PTAA 2ZJYA 2GH1A 2C9BA 2JK1A 4KN9S 2RK3A 4QTUB 1MAWA 5EC8A 2X6RA 1V8FA 4R1UA 5IUKC 1C3EA 1LFAA 1MQ9A 1EM8A 3NBQA 3T9CA 3EX7C 3VH2A 5FORA 1GRQA 2N46A 3E35A 2Y9PB 1G8PA 4TXHA 5A5GA 4B3RB 1Q0HA 1L5VA 1RQLA 2X3FA 1F9AA 2EKLA 1P4RA 3NIGB 1H2AS 5FULA 5BRJA 4QJIA 3NXKA 3G5AA 3EF1A 5KJ1A 3K09A 4INJA 3E70C 1TECE 3TXAA 1OBFO 4A2PA 1ZCAA 2V3CC 1TVKB 1SVNA 2WU8A 4AWAA 5HRAA 1HY3A 1B6SA 3CF2A 2AMFA 1S4MA 4G0WA 4PHCA 1YB5A 2R00A 4QGGA 2JLSA 4BYGA 1L9XA 1TM7E 1VG8A 3TRJA 4ZVRA 1GCOA 1PWEA 2PCLA 3RVJA 5CDSA 4LPSA 5AXCA 1SVOA 4G1UC 3T7SA 1WRBA 3JZMA 3R8CA 3VU0A 3T4UA 3KSZO 3GVPA 1NUAA 2BVNA 4URXR 1FTGA 4KGZA 4MUAA 3GIDA 1YI8A 3QE2A 1KYWA 2G9VA 3ZCRA 3Q7RA 3NVAA 1DWPA 1QYDA 2O3UA 1PR3A 1ZU5A 2H4WA 2XZPA 2BF7A 4DZRA 1K68A 4F04A 1P4AA 2ZKIA 1E99A 2QM3A 1O6ZA 3E81A 2W71A 1G4AE 4MJ7A 5B64A 1ORHA 2GM5A 4LNAA 4Q00A 2WP0A 4GWKA 1W30A 4C4AA 2AH5A 5D3QA 3DWFA 1ARZA 1ZLYA 5JWRA 4RTRA 3JRXA 2BSQA 2WTBA 3L79A 4GR5A 1P5RA 3SZLA 4F9GA 1U7WA 2J3DA 2WIGA 1BQEA 1C1YA 1FMLA 1K98A 4DIOA 1E9CA 2QU8A 4DE5A 3FHCB 4RF3A 5LLTA 1T9GR 3GJSA 1ZUHA 1M7BA 4X94A 3Q9LA 2XRYA 4BB6A 4QLOA 3ZVLA 1SNYA 4BVHA 1Z6AA 1GL6A 2ID7A 4X20A 3T7KA 1OI3A 5KQMA 5IYZF 3MOGA 4FI3C 3E2IA 3H8SA 2CDRA 4B6SA 2VF4X 4ESOA 1HX7A 1YS2X 1DKQA 3PTLA 4OFXA 2H8GA 5L3SA 1LC0A 5G0UA 1A50B 1IY8A 4LTMA 2XWBF 5DYIA 4EITA 4FZRA 1XQXA 3HYRA 4GQBA 4MROA 3CF4G 1XK6A 3TGWA 3INRA 3QXGA 3TIFA 2O19A 1VCHA 1M1XB 4WL0A 4YEDA 2A1UB 1TFUA 2JATA 3V6MA 1DAMA 2CL6X 4L8GA 2IUYA 1D0SA 2M6KA 2DTDA 4UMVA 3FFBA 2VSQA 1WZUA 4C7MA 1E66A 3F0TA 3JQQA 3S27A 4LNUB 1Y9DA 1V37A 3F5QA 1JG2A 3CLTC 1I6MA 5DTIA 1O95A 5DNVA 3WRWA 4YUZA 1UAYA 2PRSA 1ULUA 3O0DA 4RTSA 2O7SA 1NUSA 2B61A 2OVFA 3M6VA 1FNBA 4PG5A 4ZCSA 3AFMA 3MGCA 6NULA 5F52A 4XRRA 1ZYUA 1UK7A 1F06A 1US8A 4PZZA 3ACCA 3I9V1 1ISMA 4PC6A 5GOZA 3LSYA 3LY7A 3O03A 3VYSB 3OE5A 4TYQA 4LDPA 4F6CA 4DR1B 1D03A 1QYWA 2HWYA 4FWTA 1JHRA 3MRVA 4MA4A 1QCZA 2EATA 3TX6A 3JQFA 5M5BA 2NV2B 2G9QA 2OM2A 2YJ6A 4GNKA 4I6GA 4MI9A 3UWDA 4DA8A 4EY4A 4JGBA 1Y1TA 3UAOA 1ZHOA 1QIKA 1PSDA 4RV9A 3QOYA 3TEMA 5JZMA 1VZ2A 3MUFA 3IX7A 1FTYA 2I4TA 3ZDQA 3ZIAD 2AEFA 4GI7A 3F49S 1Q7RA 1TJ3A 3RRXA 1WNTA 4TTAA 4EH1A 4YASA 4XTCS 3ZE8A 1S0UA 1OLSA 2QX9A 4Q3DA 4RIHA 1K5DA 3L0CA 2GPJA 1TYDE 3EXIA 4KPFC 2EVWX 5AUNB 1EZ4A 1NM5A 2FG7C 2H6EA 2JBAA 2VSOA 4AMVA 4DXHA 1UM9A 3I4FA 3ZOZA 3HUDA 3A1SA 5A3RA 1K75A 4NZYA 4RPKA 5K4AA 2CHVA 3IVXA 4NXNB 2WTAA 3PQ2A 3FDJA 3DXZA 4K1LA 3AJ9A 4X6XA 3IQGX 1UEJA 2G9ZA 2JIPA 3DDSA 4MCAA 4HYYA 3WBFA 1TYCA 3QENA 2CXXA 3R8FA 1X15A 4PQYA 3D6FA 1CQIA 3NUGA 3OTIA 2PX5A 3KZMA 1SU6A 4N0DA 2PNJA 4CLDA 4DANA 3DKIA 2YN2A 3KL2A 3BG5A 3VR4A 3NT2A 5A04A 4GBMA 1V1MA 1KE2A 2IH5A 4J0GA 1YL6A 3AU8A 2H52A 3EN0A 4Y0VA 3KOXA 4EYOA 3C7KA 1JHOA 3H3XA 4GXNA 4YBRA 5DTJA 2BCJQ 5C4IA 1U0BB 3PYXA 2ZRQA 1PYGA 1JKXA 4UW9A 3GJ8A 3AXTA 3C7CB 4Y6OA 2NZWA 1C1DB 1UZMA 2OD9A 4RADA 1E9RA 2F1JA 2OAQ1 1X3LA 4OA5A 1I6KA 4NENA 1TVEA 5AI9A 3RSHA 3RSQA 2NYUA 3TWOA 3VSEA 4ESEA 5JANA 1BOFA 4D9EA 1R4AA 1Z0AA 1XDDA 2ZSFA 1ZGBA 3E8XA 3QSGA 2HBRA 2Y1WA 3CKKA 4C4PA 2RIRA 3G23A 5LZ9A 2W83A 3HNOA 1NAIA 2VNKA 3ZQ6A 4FCVA 2H3EA 1G8MA 2QTMA 3LUJA 4JH0A 5LSAA 2ZR9A 1AM4D 1B1CA 4YAUA 3JD3A 1DX4A 3I12A 3R5FA 3ZZ0A 1CQWA 1N2CE 1ZH6A 4EARA 5BV2P 3R0XA 1AUPA 4KBYA 4JYBA 1Z4LA 2HHAA 1DRWA 3JZFA 1PU2A 2R7MA 4HNQA 1CUIA 1L4EA 4R81A 1UT5A 2P2ZA 1W47A 3PEUA 3UAXA 5E9WA 4JLSA 3ROZA 2O2SA 2OSBA 4GWLA 1VM6A 3ZWMA 1PJSA 5ADVA 3ADCA 3UMRA 2UXCB 3ORFA 3P52A 1P31A 3BHJA 3KCNA 3LBIA 1T8WA 5HMLA 2VEDA 5A05A 1CEYA 1NUHA 4R7TA 3MTJA 3UBMA 5JE8A 3KKZA 1AVTA 5EGSA 1JEAA 2ZUEA 2R87A 1FVXA 3EZLA 4UM8B 1B15A 3I5UA 1MO4A 2V6JA 4AS1A 3THXA 4NY1A 2I4MA 4RJKA 1T1EA 2HCJB 4YAEA 5ESWA 2WG1A 2I8LA 1OUMA 4NBVA 2C61A 3W9UA 5JNLA 2C3OA 4XJTA 3IEMA 1EUCB 3NZEA 2LIVA 1WPQA 2OGTA 2ZBEA 3FPSA 2HBQA 7MDHA 3V8QA 2P67A 1HYBA 4MI6A 2W90A 1NXVA 5DASA 1TO2E 2YY5A 4D8YA 2LKDA 5BV1A 2ZRMA 3M7IA 2PZKA 1ISPA 3KVRA 3GG9A 4TZKA 1N5RA 2N75A 4H6PA 4M9UA 4YFVA 1LEHA 3SZMA 4EMTA 4Q7EA 2FG6C 2G5GX 4KBFA 4XARA 5KEIA 2BT4A 5B2FA 3GEHA 2FSGA 1OASA 4FFVA 1Y8QB 1W59A 1NZFA 3LXRA 4CFSA 1ZC3A 1M34B 1I6WA 2D1TA 3NDJA 1FS4A 2IUUA 4EHHA 2PLAA 1NJ1A 1KQ3A 2ZWVA 3OX4A 4QUKA 4I14A 5F7JA 3VHXA 3HA3A 2NTEA 3GZJA 4WERA 3W8RA 3TFQA 3DHVA 1H8HA 2Q6VA 4CL0A 2YJNA 1Z37A 2XUHA 3ZQ4A 1CNFA 4X7BA 5TGDA 2C1XA 2AJTA 1K8QA 2W9XA 4OLFA 3TJMA 4O2AF 1CNEA 2R5FA 1XZIA 4N7RA 3KVYA 1OXMA 2H2DA 1NF2A 2IHUA 1N6IA 1XRSB 2YWEA 2FSHA 2IYAA 3N8DA 3EW9A 3E9QA 1Y6FA 4M9XA 3PGKA 2QDXA 3IV7A 4PZPA 3D3KA 3TIIA 2WWWA 2ZDHA 3V33A 3WK8A 3K70D 2QLTA 2PUGA 4QYIB 3ZW9A 1NV8A 1XMOB 2PKEA 3TKAA 2IIQA 3NOQA 3S5UA 4J0QA 1ORWA 1IOZA 1QCDA 4QUBA 3WNCA 1M2OB 4D26A 1XC7A 1Q3KA 1U9IC 2GCEA 4JROA 3WZLA 2I78A 4HZUA 1SEVA 4COOA 3BHMA 1R5NA 5DGIA 4OJNA 2EJCA 4MA0A 2BKEA 2WJ3A 1Q5PA 3LQ1A 4ITVA 5FTJA 3D2LA 2Q45A 4F4HA 5LP6B 5IKXA 4H3SA 1JSCA 4YRFA 3VSBA 4D9FA 4GSYA 4PRLA 3SJ7A 4EVSA 1I3NA 1IG0A 2Z98A 1XU7A 1K4YA 4JXJA 1QIJA 1BWRA 3W4IA 2OO5A 5C34B 3U26A 4CLHA 1KP3A 3C6YA 4UNSA 4MS1A 4G9BA 3DM5A 2ZSKA 5TMEA 4KUEA 3SCZA 1QZ3A 2I1WA 5F51A 4CMBA 5LP6F 2G8LA 1YXMA 1HBJA 1FPMA 1I5EA 2HA3A 4KH0A 5EEHA 3U62A 3QMPA 3TX2A 4EATA 1W5BA 3P2KA 4FKZA 4RA9B 2CXOA 1H2EA 1MX1A 2I33A 3MLBA 1WUKS 1CVRA 3FSRA 3DZDA 4QHSA 5C7LO 1MEOA 2P9TA 1GFWA 1HE1C 2ZIVB 4RD1A 3WL6A 4B3IA 3KEFA 1FQOA 2C84A 4B6PA 2J0UB 4B76A 3IGFA 4DR2B 4NCAA 4TS4A 2CSXA 1MHPA 3SJAA 4HUQA 2YV5A 1FLNA 3S1LA 2ZAGA 3EIWA 3NORA 1BVYF 3BMQB 2CLKB 4WDRA 4ALMA 1JPJA 3KXPA 5IVIA 3SI7A 1XNJA 1A1SA 2XUZA 2Y1KA 3LXUX 4BV3A 2QVBA 5DX0A 1T2VA 3F6PA 3JQ7B 3O8BA 5L8VA 1FMFA 2G4LA 4EB6B 3VOAA 5JNUA 3LRTA 1BC5A 3DBLA 3CH7A 1YCHA 4HUJA 3PEFA 3PNVA 3ZWKA 2AJLI 4TGLA 3SMQA 3AFGA 1CY6A 3GLUA 4IH9A 1JA9A 1XG5A 2IV7A 4MR8B 4IGIA 1XXHB 1W4RA 4ZT3A 2IHYA 3ENNA 4NMXB 4CV0A 5IANA 1Q57A 2DPHA 2Z9DA 1FSSA 1QO7A 4PGFA 5F3RA 1AXRA 1SGWA 1WHTB 3EA4A 1X1QA 3FLBA 4RFSB 4RGYA 3C45A 3X3HA 5ITVA 1IN1A 3LDHA 4MAMA 2F7SA 4C1BA 4OM8A 5AT1A 3VYTB 3ZY3A 1DKUA 4MQFA 1U8FO 2A7QA 3B1JA 4G3XA 1SHJA 1NQXA 4IUDS 5JCOA 2YBEA 4C0JA 5BW5A 3H5WA 1UMCB 3UJ7A 1Z5PA 3D43A 2ODNA 5D3MB 4MULA 5KQRA 4BXOB 2JGMA 2CBZA 4ZOEA 4ENWA 2E6KA 2WHPA 3HDQA 1F4VA 4KUGA 3GT4A 4U2KA 1J2JA 1W5EA 4W1PA 1JG7A 4QXQA 2J3MA 2ZJOA 2Z4SA 4AMZA 1T9ZA 2R6JA 2XVZA 2QS9A 1EA5A 3QELB 2QN1A 1COWD 1XCGB 2C59A 1YOVB 2IZ7A 2PMBA 1NOJA 2PZMA 2FDXA 3DT6A 4J43A 1U3DA 5GONF 2YX1A 3LPMA 1F2TA 1YT5A 2H07A 4NPCA 4GPZA 1TJNA 3T9FA 3PUHA 3U3JA 1UJCA 3HKBB 1J0CA 3E84A 3H2GA 4C3VA 1AZTA 3WLJA 1FK8A 2FEWB 4KV9A 3TBHA 3LC7O 1BD3A 1L3IA 1WABA 2BI7A 5LN1A 1FLDA 1R0XA 3C0KA 3MJEA 4LZNA 1P3Y1 4WZBA 5K0LA 2IPAB 5JMOA 2FX5A 2EARA 3QH4A 1JAIA 1A82A 4G5FA 4KQ2A 4XM2A 1E1LA 3IIEA 2RKBA 3WBJA 4CKCA 2RGNA 4PG8A 4AP9A 2AVNA 3IO3A 2BHLA 4NU5A 1ZLXA 4PAMA 2YTZA 4JQCA 2FFRA 1FDVA 4TZ6A 4DV2B 2I29A 2I76A 1GA1A 4ZKDA 5C8DA 1OAAA 1QFJA 2F3PA 3DTVD 2OYCA 5IX8A 1DTWA 5T64A 1EHYA 1PQWA 1PT5A 1XMSA 3SAJA 1NJ2A 3AF0A 4OYLA 4YJ3F 1YQTA 4RPJA 4Y1GA 1DHRA 1Z4PX 2C5AA 4AIIA 1K8RA 1C8VB 3BIWA 2B8NA 4Q4CA 1VE6A 3X2SA 1V7CA 3QJ5A 4EG8A 3R9XA 2WZDA 5IXJA 4FGZA 3AKZA 2J9ZB 2ODEA 3QX3A 5AM1A 1WZNA 4H59A 2PS3A 3OTQA 1WXDA 1XEXB 2O7QA 2X0JA 3PPWA 3NH9A 1M6HA 3HFRA 1RADA 3T5CA 4Y6QA 1OTXA 4DQLA 2I7CA 5FLKA 3QEKA 3VDMA 3ZU4A 1R00A 4AX8A 4BLRA 3LUDA 5DW0A 1MH9A 2I7TA 1SWWA 1X7XA 3PEEA 3R7NA 3TZCA 4NCJA 2QM8A 3UGJA 5A06A 1E9SA 5EP1A 4TTVA 4JKOA 4GPTA 4RZSA 5AK5A 2VPQA 1ONNA 1AA6A 3OMXA 3KBOA 4MB0A 4E30A 1PFQA 1YB1A 3DE4X 5UKDA 4EKGA 3RVPA 3V7FA 2PD6A 3A0UA 4IKEA 3SC4A 3RG8A 1OH6A 2P4SA 5ENVA 5JXWA 2JEOA 3M6FA 3PDWA 4R0MA 3LQRA 3ML1A 4YV2A 1SZJG 3A31A 2XECA 1IK6A 1YASA 2C77A 2FUG6 2Z2JA 3BEDA 3GFQA 3GJRA 3H4VA 4GOKA 1GILA 5HMMA 4R1PA 4E2WA 4MO2A 3MJSA 4RSHA 4EB6A 3D4NA 3WP1B 4WKCA 1X2EA 3OE1A 2EOAA 2CNWD 4GBED 3OECA 5ALMA 3KTFA 3QXXA 1O0CA 3MYYA 3A36A 4HNAA 4KI0A 1LTQA 3TSWA 3EVDA 1DT5A 3ESYA 4FMCF 3MSXA 5BV8A 4H7HA 4DDVA 5JC1A 5J4VA 2F67A 2XEDA 3IIJA 1LF0A 1Z5WA 3G1WA 1VCIA 1EBFA 1IY0A 3REQA 3WBBA 2WWTA 1PL0A 4JSYA 1KR5A 1XL1A 1HDEA 4MKIA 3TOSA 4DTIA 4K6OA 1X39A 1JB1A 2HCFA 3DM9B 4FGKA 5LQKA 2JD2A 3PVCA 3ZHBA 1A77A 2IPLA 2X5XA 3KYDA 2RGYA 1N78A 3B5EA 3W5HA 1I7DA 3IQFA 1Q0UA 3FMPB 1FB5A 1SCAA 1CUGA 4JR0A 1M73E 1ZOLA 2WF7A 2TMDA 1ULSA 3S2YA 2XQGA 3ZXIA 2WRZA 4HDRB 1U2DA 2Y92A 4MMXB 5B55A 3FSGD 4DRYA 3RAGA 3CRNA 4UULA 3TSOA 4QYMA 1IOLA 3GJYA 3LTEA 4MYRA 1V5EA 2I6TA 4Q12A 5J5AA 2GVZC 1JTFA 3V8MA 1AO0A 1XJCA 3TLEA 4XVUA 4EYQA 3DTYA 2DE0X 1HDZA 1P3DA 3D0KA 4LK3A 5H7XA 4AULA 2G09A 3CUEF 3CUUA 3QW2A 1LD3A 1I32A 3G13A 1RJGA 4FJ0A 4MUKA 5K0CA 3NTUA 3ONEA 3G8CA 3DHWC 4CYMA 3EPKA 3K20A 1R2QA 2JFZA 2OMEA 3EB9A 3HXLA 3JWIA 4RKEA 5HF5A 4ZZIA 4K6KA 4TYNA 1OB2A 1L4UA 4MWGA 1S3SA 3JRWA 3P9YA 1QYCA 3QX7A 4GM1A 2AB0A 2EP7A 2HA7A 3BFJA 3F47A 4HQ6A 4HSEA 5D5QA 2WYIA 1I0IA 4V1CB 4UQPA 4JL6A 1PJZA 4DCGA 3RUCA 4OQLA 4AQ7A 3I9LA 3DBRA 3P9CA 4WN3A 4ZJYA 2W70A 4BMZA 2XZLA 3FBWA 2Q41A 1LU9A 3KYDB 2DPGA 2RGCA 2FK8A 3SBDA 3M6XA 3KYBA 1L7EA 2DUUA 3A0RB 4O2AB 3RU2A 4BX9A 5EUMA 4G09A 1OI7A 2JGFA 5LL6P 1BFUA 1KJZA 2GPAA 5HQTA 4I9FA 1P8JA 3NANA 3BMOA 4OHXA 4Z0PA 3KQLA 4JOQA 4RM2A 1I7PA 4U1RA 2O8FB 1N2EA 1TJYA 1ML3A 1NLZA 4IJMA 4QGFA 4JN6B 3CRZA 3RIXA 4QPZA 2IVFA 3VI3B 2VQDA 2BEVB 4JFRA 1A5ZA 2BRUC 2BEWA 2GVDC 4KKXB 4Z1MD 3TBKA 1P0CA 2GK3A 1I33A 4FKBA 4UVDA 3TIXB 1SR8A 5HX7A 2HK8A 2DR3A 1SVKA 3VR5A 4NYIR 1J5XA 2O7NA 3ZE0B 1U1CA 4G0MA 4IG4A 4UD2A 5TX7A 1XROA 2QPTA 2R6ZA 3CNNA 3LIIA 1MRNA 3B9QA 1XTVA 3P9XA 3UYKA 2JD1A 2NLOA 3MLAA 5DHAA 1P0IA 2J5KA 2OKCA 5K2OA 4IIDA 3KSUA 3CPJB 2YW2A 4R6WA 3MAAC 2DECA 5I7AA 4E3WA 1ZIXA 1T8UA 1RRFA 1CVIA 3G1TA 5HOQA 2DPXA 3WJ1A 1KAEA 1AF7A 2OSVA 2NTVA 4DLTA 1SHTX 1U98A 1JU9A 3LZDA 3CVWA 4LC1A 3PDJA 4QOGA 5LQRA 4Q9DA 5EJGA 3SS8A 4RCVA 2QV0A 1CK4A 3X1YA 3HLTA 2DBVO 4OV6B 1JDNA 2C0QA 5FUBA 3ZDBA 2PT5A 2ZLBA 1TO6A 1SHKA 2GNOA 1WCYA 4S2UA 3C7TA 1PF7E 4XVHA 5B6IA 5BSWA 1LW7A 1VHLA 2FR8C 2ZRPA 4IGEA 3FOWA 4ROSA 4AP5A 2Q3CA 2H4HA 4GX0A 4CJXA 4YRNA 1JUDA 3OTWA 2QXUA 3K1TA 1W48A 5C1DA 4KJZA 2V5UA 1NFRA 3L0IB 1NMSA 2GS9A 4Y2GA 3P26A 4DARA 4KU4A 3IDFA 2B99A 4E4YA 3DAFA 3ANLA 4H18A 4IVRA 4BC1A 1J2TA 1CUCA 2O6LA 4RHCA 1S2OA 4BGIA 3IQWA 3GJTA 4B6GA 2YWXA 1AQLA 1KMHB 1XCBA 1B16A 3K30A 1CQJA 5FD8A 4A1OA 1CY7A 2QVXX 1LRJA 5HFJA 2DQSA 3RFXA 5FYDA 1ORIA 3EGIA 5DJ5A 3PVZA 1UFOA 4WRRA 4J1TC 4Z51A 1AJEA 2P77A 4ENVA 3T4EA 1JT2A 3V7NA 1CJBA 4JHLA 3OAAD 3F4KA 3AM1A 4S2EA 4EHJA 4IS3A 4P7JA 2EWVA 2JCBA 2V7WA 3AL0C 4Q18A 1A8IA 1JDSA 2QVLA 1GL3A 3H0EA 3C1TA 5LOVB 2HLPA 3AR3A 1ZD9A 4EVIA 2NP6A 2V5VA 4DB4A 1HETA 2PKCA 2HJGA 3T5AA 2HHHB 2W6ID 1WHSB 1N6KA 2QRHA 1EWYA 2XKAA 3H9QA 3ZY2A 3MINB 1AMOA 4QOSA 3I45A 4HD8A 4I3GA 2HSGA 2GA8A 1G8SA 2J67A 3AMVA 4FYKA 1T8RA 1R10A 4ERNA 5K0JA 1M34E 4W5RA 3LUAA 3E4CA 3K9NA 1QYIA 3RPEA 2QTGA 1NX9A 1M1NA 1QB7A 1CUZA 4FFWA 3RKUA 4L76A 3WQRA 4EFDA 4MUEA 4F85A 2VHXA 2OCPA 5FTLA 3IBYA 1Z3CA 1Z33A 3AYZB 3BXOA 4G5GA 3OHSX 5DPMA 3CO0S 1HR0B 2XF2A 3WB2A 5AK0A 2BH9A 4JYPA 3GLIA 3ZD7A 4Q16A 2R0QC 4EG4A 4ER5A 5KNCH 5CLIA 1BKDR 3H9GA 3QKRB 2QLMA 2DBZA 2WV7A 3DDZX 3HZOA 4IP0A 1ZN9A 3V1UA 4RJTA 3UPTA 5CB4A 4CTJA 4MHOA 1JI3A 1VC2A 2O8FA 1JAZA 4POOA 5KVSA 2V58A 5JJLA 4RSRA 1H0KA 1OAOC 3AUFA 4MW9A 4NOKA 5BQXA 2VWQA 5BNZA 2A9FA 4EUSA 4G1MB 2MSEB 2CEKA 4P8RA 4PPGA 4Z7QB 1W8IA 3I2KA 2XBMA 2AZTA 3GNQA 5FKJA 3V7YA 4IXDA 1LDGA 1KFEB 1LPMA 2PGXA 3HYLA 2BONA 4ZYUA 1TJ5A 4MTLA 3U6KA 1ZM4A 3E9MA 2IBTA 5LMZA 1XA4A 1W4BA 1OMOA 2PZFA 3AHDA 2NT3A 3PHCA 4J9VA 2VUUA 3GEBA 5LBUA 3W0LB 4DDKA 4KXYA 4UEQA 1US8B 2PX0A 2V7QA 4YCBA 2C42A 3A6HA 2C58A 3H6HA 4C05A 3H2SA 5JFOA 2Z8XA 1Q7BA 4B3SB 1VBMA 2KQUA 2ODQA 4GS5A 1T4CB 1U2DC 3ZHQA 3JZIA 3E6AA 5C8YB 1F9EA 5H81A 3TYXA 1WCIA 3L40A 3LYUA 3WL7A 1XVIA 4R8SA 4UUAA 1MOZA 2O2ZA 5K1ZA 3W04A 1CP3A 3ND5A 3W9BA 1K3UB 4QWMA 3WAKA 1QQBA 1Q6ZA 1K2VN 3RREA 3I4LA 2REQB 1SD2A 2DQYA 3QUAA 4FINA 4WA7A 3RVDA 3SHVA 2VJQA 4QLBA 5ENZA 2I2FA 2QRLA 2Z56A 1BDMA 4P92A 2JAWA 3W7AA 2JAHA 2X42A 4EUEA 3UWKA 3B2EA 3JAKB 1HZZA 3K1ZA 1XQYA 4F6RA 8ATCA 5KTOA 1JS1X 2CJWA 2XTMA 2DERA 4V0QA 2X5KO 2YC4C 1PJLA 2FEMA 4KXFB 2QRNA 2VJLA 4JJEA 4D6XA 4J91A 2OORC 3V1NA 1NBWB 4KODA 3V1YA 2VH1A 4DJFC 1CEXA 1SOWA 4CGZA 2Y0BA 4WNAA 1EIZA 3WQSB 5H8WA 1WVIA 4G5RA 3VDXA 1RRPA 5JD3A 4KE9A 1U04A 3OEEA 1SCUA 5LNK6 4MPTA 1G2IA 1VP3A 1TKRA 4DNFA 3ZE2B 2QQ5A 4J7AA 3UOAB 2B1JA 3RARA 1ECJA 4E46A 2Y2UA 3RVQA 3K5IA 4ETNA 5IVKA 1E20A 2Y4NA 5HM6A 2GKOA 3RSLA 4C2AA 2HFKA 3FUCA 2EFCB 3EUEA 2WWVD 4NEHB 1E4OA 5EUQB 1G2OA 4CIAA 3AHEA 2XT0A 4HI0E 4GXRA 1OZAA 3BCRA 4E08A 2CJYA 4G5YA 4PFJA 4CL2A 1VL6A 4R1SA 3FVWA 1XTZA 1CY4A 1I94B 1SAYA 2PXCA 3I0NA 3LYHA 1W1UA 4K7JA 4LZPA 1BGVA 2FAXA 2PU5A 4C0LA 2H51A 2QG4A 3QX8A 3WC4A 3H1BA 3HKCB 1FC0A 3ETLA 2Z2ZA 1PS0A 3QUBA 4DR6B 1Z56C 1T3LA 1YNSA 4UHKA 2ZB4A 2PZBA 2F3RA 4WXMA 4KC0A 5ULLA 3ZDCA 1X0XA 3QPAA 5CVVA 1GAJA 3V48A 3BGVA 2GEDA 4D3SA 3ZWDA 1YO6A 2FRDC 1SC6A 1CJKC 1GNQA 3TTUA 3VC2A 1EWTA 5EWLB 2MSLA 4IKOA 3HA5A 2Y1EA 3G9TA 2D59A 3E7DA 1P2GA 3J81A 2OESA 1ESEA 2MWMA 3ENZA 4X1KB 5FHQA 2V0CA 3IT0A 4E5KA 4HLNA 1K8XB 2Z8YM 3B60A 2X0EA 2L17A 3SQNA 2CNLA 2WTEA 1XTBA 1CUSA 1OA0A 4IIGA 1IPEA 1SM4A 2ZRBA 2G88A 3JVEA 3NIDB 3OJCA 4DLKA 4EYKA 1GTL1 1VKNA 5CYFA 3SHFA 3IMCA 4CRWB 5LJIA 1W4ZA 4BECA 4FHFA 4YJHB 3UTDA 4D3DA 1GVNB 4LXUA 1BW9A 4JJ4A 5E6SA 4HNAB 4ZDIA 4DQDA 2X0IA 1KK1A 1MD9A 2JGIA 3OZWA 4RLFA 5E38A 4GHWA 1Z5GA 4MYSA 2XW6A 3U6BA 1RJEA 1UK8A 1Z0UA 5B7QA 3F3YA 5EJFA 2ADFA 3REQB 3RTBA 2ZR7A 4MGEA 4YYEA 3ZWQA 5MDHA 1XDGA 2P9ZA 3WYNA 2PRZA 1OVGA 1N0VC 4DR4B 2Z58A 2NO4A 3MFYA 1QQTA 2OBMA 1J8QA 3T0IA 3UANA 4FDMA 4CIBA 1AO3A 2OTCA 3N8KA 5SV2A 2PFSA 4BVFA 2JGAA 3HK2A 2OCBA 5G02A 2B3TA 2ETVA 2FUEA 2HMAA 4FX5A 5GV8A 1O9BA 3THOA 4FS3A 3G2MA 1I2AA 4TL8A 1DQZA 1PX2A 1DT3A 1O77A 2MSKA 2ZSEA 3EG5A 4JD5A 5T41A 3WLKX 5I48A 5LQNA 4H1VA 4H0CA 3PKIA 1J24A 1Y8QA 1RWPA 1YAJA 2QT0A 4K9RA 1WDMA 1ZMBA 4DV7B 4RMIA 2VPWA 1MJHA 2LDBA 3DDUA 5AOVA 1RTTA 4BO9A 3M82A 3GH3A 4OGKA 4ARSA 1GAXA 4LZLA 5TPZD 1ADGA 2P3QA 1KTIA 1PL8A 1PI3A 5I9NA 1E3JA 1GGNA 1H6DA 3SF8B 1Z4QA 1SWVA 1YJQA 3B3JA 1CJCA 3KP1A 4H1TA 3JTMA 3I61A 3K32A 1QZXA 5AKLA 4IQGA 3PK0A 4A6PA 5AQEA 4PEVA 1PN3A 3EIOA 1CULC 2CHFA 2P8JA 4ZVMA 2JZCA 1VXOA 1NMEA 2JC3A 2WM2A 4R51A 3KPYA 2BEUA 1GSAA 1JJBA 4S1OA 4CM1A 1PR9A 4MYHA 1MJGM 1WHTA 3CURA 3OG9A 4GU5A 4UVHA 3ZI0A 1QK3A 4BJ5A 2G9NA 2QAGA 1ND5A 2WJVA 2Z6UA 1KU6A 1EFPB 1EG2A 3DXYA 3CUWA 3ZD6A 1EGAA 2HK9A 2DTXA 2EWMA 4PYIA 1SOMA 4YJGB 2ZB8A 1LJLA 3EEFA 1UP6A 1MGOA 4PV7A 3QPDA 3RIHA 3UPUA 1CG6A 1VI6A 3OC6A 2ZJ5A 5CNJA 1V5WA 2BSXA 3PPXA 5AFSA 3UTCA 2UVQA 3AW8A 4B9AA 1QRRA 1JBKA 4TS9A 1XQWA 2IP4A 2Q5FA 2JANA 3IBFA 4BEVA 1KZ9A 1U7XA 1RPJA 3FGNA 3JWEA 3JYPA 2CT8A 1HSZA 4CDGA 1E0JA 2WV9A 4KMMA 4Q4AB 2Z3ZA 2Q3JA 3E03A 4EGCB 2B8TA 4IIUA 1NDUA 3PDHA 4MS1B 5A5DA 4HWGA 3HRKA 3GEPA 2FK7A 3W9YA 2J09A 5CLJA 1A97A 1RLUA 2C2BA 2D2VA 2WSSD 3KOUA 5TQ2B 4GQAA 3RB8A 1FP1D 5FOXA 1TYAE 4IJUA 1X1TA 2ZBQA 3I6YA 1I10A 4F06A 4PZAA 3R5SA 4DAEA 2J07A 2E1RA 2D1YA 4KAJA 3UFXB 4BQQA 5IM4A 3COJA 3GFGA 1QU3A 5HBRA 4XLLA 3RASA 2J0UA 3NM6B 4UTOA 3RTCA 4MIYA 4EZIA 4RZ2A 1NU8A 3ER8A 3HUEA 3RF6A 1YVRA 3BE6A 4LZWA 5JJBA 1C9JA 4FIDA 4U7WA 1CR0A 3RTGA 1XD2B 2NYVA 3QWBA 1F3OA 4OI4A 4BVLA 3HCAA 4ITRC 3O47A 5KINB 3N3BC 1IBCA 4ZMSA 4Y6RA 4A8JC 1NVAA 1EFPA 2QY6A 4UFNA 3PCRB 4H7KA 3IVRA 4HB4A 2WD9A 1B41A 2R8EA 3JQEA 1XTQA 4BUZA 4HCJA 3RWMB 3MW8A 1ACJA 4II3A 3THWA 4TRRA 1KERA 2HA0A 5CNKA 4LYEA 3V46A 1GEGA 3HHEA 3QVXA 1KRXA 4OQEA 5LKAA 1XTTA 2NPOA 4K87A 3KK0A 5LYJB 4DJDC 5AW1A 5FWDA 4Q4HA 4CLOB 1ZA2A 5BSRA 5JTUA 4EG6A 4J1QA 5G1OA 4FI3F 2JCSA 3CNOA 5EKTA 3ZK8A 4CKBA 2GRUA 2FPRA 3RC3A 1NJFA 4MRAA 1HYHA 2BEKA 3NEYA 4XX0A 5JS7A 1FSPA 2J6IA 3OA2A 5D5PA 1M5TA 1Q0SA 1SXJB 3JQRA 3B1ZA 3E3OA 3AJAA 4PSVA 1GPDG 1BN7A 1GOTA 2WHPB 3I04A 1JYFA 2XZOA 3UVEA 2WG0A 2O2EA 2GZ3A 5EWMA 3P19A 2O0JA 3ND7A 1GNLA 3K5HA 2MCFA 2ZQ5A 3ZHSA 5C7YA 3B1VA 5TSDA 1EX6A 3ZYCA 2D5BA 2FXVA 3HB9A 4A0RA 1XSEA 3G2LA 5LYYA 3CU5A 4AO6A 3AESB 5JLAA 2GZ2A 2G04A 2H5LA 4UARA 5IJXA 4B83A 1JR2A 1QU2A 1O5IA 1E64A 1UDCA 4DRZA 3O7WA 3PPVA 1QAMA 5KNCD 4M1QA 1JXOA 4GI1A 3UK0A 4CM8A 3TL2A 2VHZA 3D4IA 4Z8XA 5AVXA 3S8EA 3ADDA 3L6CA 3FX2A 3L3BA 4IF4A 4A4DA 5KS2A 1FZTA 2ZTSA 5IBRA 1T8SA 1ECFA 2OV6A 4M98A 1KP9A 1RQ2A 2FFHA 3V97A 3AH8A 3AIOA 2I4IA 3F3KA 3O8RA 1GA4A 1RC8A 2XNDD 4EHIA 1I9CA 5HW0A 3MELA 2OV1A 3IUMA 1RC0A 4IS2A 4YDSA 1EWVA 1N3YA 2H9IA 2ZRCA 4I4TF 4Q4HB 2VP5A 3FSJX 5ES4B 1W93A 3HL0A 5CFRA 1HURA 5FOQA 1T1GA 1R16A 2F90A 2RH8A 3LRPA 1JLLB 1CZOA 3IE1A 1X8KA 1JHUA 2E4YA 2B4AA 1BXZA 2WFLB 3ADKA 4G37A 4EG3A 3DQPA