2I4TA

Crystal structure of purine nucleoside phosphorylase from trichomonas vaginalis with imm-a
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
236
structure length
230
Chain Sequence
ATPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINRIRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHERQNSFQNMMKIALEAAIKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trichomonas vaginalis purine nucleoside phosphorylase
publication title Inhibition and structure of Trichomonas vaginalis purine nucleoside phosphorylase with picomolar transition state analogues.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transferase
total genus 83
structure length 230
sequence length 236
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2006-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2i4tA00
3KHSA 4D8VA 5F7ZA 1NC3A 4DA8A 3LGSA 1VFNA 3T94A 3O4VA 4U2KA 1TCVA 3GGSA 3EUFA 2Q7OE 4DABA 3UAWA 4KN5A 4BMXA 3LA8A 4BN0A 1JP7A 1ZL2A 1ODIA 4IP0A 1RSZA 2HRDA 4TS3A 5F7XA 3DF9A 3KUKA 4L5AA 4H1TA 4P54A 1Y1RA 1RYZA 4L0MA 5F7JA 1I80A 4WKNA 2ISCA 4OJTA 4DANA 1JPVA 1ODKA 2A0YA 5ETJA 2GUWA 3MMSA 3FUCA 1ULAA 1XE3A 4QFBA 4L6IA 1FXUA 3DPSA 3OOHA 1T8SA 1M73E 1U1DA 3UAVA 4X24A 3FNQA 3TL6A 4LNAA 1PK9A 1SJ9A 2ON6A 3EEIA 1Z34A 1OV6A 3PNPA 4RJ2A 3OZDA 1Z37A 4M3NA 2BSXA 1WTAA 4TXHA 3K8OE 4D8YA 4LZWA 4TXLA 2QTTA 2AI3A 1TGYA 4OF4A 1K3FA 4TXNA 3O6VA 1TD1A 1SQ6A 1VMKA 4YNBA 3DP9A 3C74A 1T0UA 3EMVA 1Z36A 1VHJA 5C80A 2AI2A 1A9RA 5B7NA 1YQUA 1U1CA 4UC0A 5F77A 4BMZA 3P0FA 1PR4A 1A9PA 4L5CA 4QASA 3FWPA 4JWTA 1NW4A 4ECEA 4TYMA 4MARA 4TTAA 1RR6A 1LVUA 3NM4A 1N3IA 2QSUA 1RFGE 4F3CA 4WKCA 1G2OA 1PKEA 1Z5PA 3NM6B 2QTGA 5F76A 2PGAA 2OC9A 1RT9A 3BL6A 3KVVA 3GB9A 4JP5A 2OXFA 3UAYA 3FOWA 4QARA 4NSNA 4PR3A 5F73A 3BGSA 3UT6A 4EB8A 4WKBA 3DJFA 5KB3A 1ODJA 1SD2A 1Y6RA 1Z38A 4NS1A 1RXCA 1T8YA 3DDOA 1TGVA 4OEHA 4G8JA 4QATA 1A9OA 1ODLA 3UAXA 1LX7A 4F2WA 4DA0A 1RXYA 3KVRA 3LBAA 5FAKA 3E9ZA 4LDNA 2HN9A 3QPBA 1OTYA 4GLFA 4GLJA 3INYA 2HWUA 4M1EA 1JDUA 4OGLA 4DA6A 4MCHA 1CB0A 4DAOA 5JPCA 5IFKA 4LNHA 3OCCA 5EPUA 3K8QA 1Z5NA 4QEZA 1K9SA 1B8OA 5CYGA 2I8AA 5CXQA 4E1VA 1OVGA 1PW7A 1LV8A 1PK7A 1PR5A 2A0XA 1PR1A 2B94A 1JE1A 4OGKA 4WKOA 1Z39A 3PHCA 4G89A 4YO8A 1PWYE 3SCZA 3OF3A 3IEXA 5B7QA 4GKAA 1JE0A 5CYFA 1PF7E 4D98A 1RCTE 4QAQA 1V4NA 5EFOA 3F8WA 4MCIA 5IU6A 1PR0A 1JDSA 1A9QA 2QDKA 3ONVA 4OY3A 4DA7A 4R2WA 4TXMA 1JDZA 3EUEA 1Z33A 3OOEA 3FAZA 1CG6A 5K1ZA 1ECPA 3KU4A 4WKPA 3BSFA 1YRYE 1V41E 1T8RA 1C3XA 1YQQA 4YJKA 3P0EA 3BJEA 1Y1QA 4L5YA 1Z5OA 4BMYA 3E9RA 1PBNA 5CCEA 1Q1GA 4FFSA 4DARA 1T8WA 3OZEA 1ZOSA 1Y1TA 3ENZA 2IQ5A 3KVYA 2A0WA 3NM5A 2AI1A 1Y1SA 1YR3A 1V45E 1K27A 3MB8A 2I4TA 4TXJA 1ULBA 2HSWA 1VHWA 5F78A 5B7PA 4TS9A 4R31A 4F3KA 4TTJA 1Y6QA 4D8XA 5CCDA 1QE5A 2A8YA 5EUBA 1A9TA 4F1WA 4GMHA 1A69A 4EARA 4D9HA 2QPLA 4M7WA 4I2VA 3NBQA 3PNSA 3D1VA 1YBFA 4DAEA 1JYSA 5I3CA 2OECA 1TCUA 1JDVA 3U40A 2RJ3A 4R2XA 3E0QA 3UAZA 5DK6A 2P4SA 4PNPA 1JDTA 1OUMA 1V3QE 1U1FA 1OU4A 5CXSA 1B8NA 3IOMA 2XRFA 1A9SA 1RXSA 4NY1A 2AC7A 3PHBE 4TTIA 4K6OA 3FB1A 4JOSA 1RXUA 4LKRA 3OPVA 2H8GA 1PR2A 1V2HE 5F7OA 1U1EA 1OTXA 1SD1A 1Z35A 3OZCA 1PR6A 5B7GA 1NC1A 3ODGA 4G41A 1V48A 4F2PA 2OC4A 3OZBA 4YMLA 1U1GA
chains in the Genus database with same CATH superfamily
3TYXA 2NU6B 3D8BA 1ZKMA 5F7ZA 2B35A 4CGYA 1AQLA 2R79A 2PX5A 1J2UA 4MKXA 2H2GA 1IXRC 4NJEA 4OKSA 4IKEA 4KV7A 1KWKA 5TT0A 4J0KA 3JWGA 2R00C 3TWOA 2XLCA 3QOXA 5J5CA 4DDUA 1J9GA 4BEVA 2G83A 4NCBA 3UK0A 5IAOA 3PA8A 4JUBA 5CVVA 5AJUA 3W8NA 2WV7A 5I8ZA 5K4HA 1H9BA 4D3SA 5PGMA 1MT0A 1TPZA 2Q8NA 5GOZA 2XA2A 1JQKA 4DIUA 2C92A 1KZ6A 4LN1A 1B15A 1T9CA 3ABZA 4F96A 3D4BA 4D92A 5JNLA 1FNBA 3TTVA 2ANBA 1EI9A 1F3OA 1ZHHA 2QZ9A 2WWRA 3GQVA 2N42A 2HCJB 3CNBA 3OEEA 3QFCA 2QMUA 3NIFB 4WZBB 5L6MB 2I67A 2P77A 3BZWA 4PLYA 3GRUA 4RACA 3MJDA 2ZP1A 1N0HA 3SIRA 5JD5A 2J3IA 3LIPA 1ZONA 1RKQA 3E58A 4TVBA 4UNIA 3KQNA 4IYJA 1NBIA 5SZIA 1M74A 5D7NA 1A9XA 2OLEA 2FE1A 3DS8A 1NMZA 2RGNA 3LKVA 5FLKA 2AYXA 3VOTA 2B30A 4UUOA 5EIHA 4GFDA 1KFJB 4QPNA 5AVQA 5C18A 2QNRA 2OCKA 2P69A 4CM9D 1T2DA 3FUTA 5KDOA 2Q3EA 3AM3A 4FOTA 2AQIA 5JOQA 3N6XA 4Q9NA 1TTPB 4FHCA 4DANA 2VDOB 1GARA 1XNJA 1SVIA 4LI3X 1XC7A 3CJTA 5ILQA 2CT8A 3NC4A 5EAIA 3PEUA 3F6RA 3IUNA 5LFAA 1UBHS 2BTQA 3OURA 4RVHA 4RY9A 4BMDA 1I1NA 1E6KA 1BXKA 5CDHA 1U31A 3IAEA 5KO2A 3B3JA 1PP4A 3H83A 2X9QA 3F6PA 1QO0A 2UUOA 1U7UA 2G9QA 2FSSA 1ZGJA 3LIIA 1O3YA 3WB0A 3ZY5A 3GLHA 4G0NA 5FKJA 3ZBQA 3KJNA 3IAXA 3R3ZA 1WUHS 1Z6YA 3IA7A 4Q02A 2XNHA 3E27A 2OA0A 3SSOA 4B46A 2XVXA 1CQJB 2FUCA 2HQSA 2JGLA 3ONEA 4EJFA 4F2DA 3FMGA 3ICPA 5K0ZA 1OZGA 3VSEA 2DPLA 3DLPX 1EHCA 4LECA 5H16A 5FADA 4B6PA 1VJCA 5IJXA 3X1JA 3ZVMA 5ECGC 2WNSA 1X7ZA 3I8OA 3MRVA 2F43B 1RHKA 4F71A 3IDSA 2XAUA 4N3AA 4B73A 4TXHA 3ICOA 1FFSA 1MC4A 4ZDJA 3KFXA 4FFOA 1G5RA 4XUGB 4M0FA 3S55A 2KB0A 4FNMA 4KX3A 1PD0A 2ID8A 2X4GA 4LZWA 4M1YA 2G9VA 3JQFC 3WK6A 4F21A 5KJCA 1Q6YA 3TIXB 2FG7C 2PXHA 1TJ4A 3VNQA 4C3OB 4RA6B 2RC6A 5K3OA 4WN9B 4RTQA 5KNDA 4YACA 4GM0A 4YBRA 2ZTUA 3N8IA 2X4IA 5L4NA 4A91A 1AURA 1QQTA 4LAFA 2P1DA 2KI5A 3A0UA 4TKLA 3TAHA 1FP4A 4EECA 1Z36A 1W8IA 2B9VA 5KTYA 4TTRA 4C78A 4TV8F 3IQGX 4I1RA 5FEUA 1VP3A 3AILA 4KW7A 3EQ8A 4MQEA 3B5EA 3LT0A 3G2NA 4WDQA 5DN9A 2YOHA 1OWNA 1F60A 3OWHA 1DB3A 4D6YA 3T0FA 4BMZA 2VN8A 4LC1A 2O8CB 1KI2A 4PS0A 5LQJA 3PEYA 1NBAA 2F3UA 2IYPA 3F3KA 2D1RA 4IVPA 4ENVA 2ZUCA 2WD7B 1EVYA 1FYWA 1R0BA 2P79A 2XSZD 3H5NA 4C29A 4DLUA 3STTA 4DSTA 4DG5A 3K6JA 1IWOA 3U9SA 4B3XA 3BRQA 5CFNA 1WIWA 3NM4A 3T99A 4HGPA 4JJ7A 3LK6A 3H8JA 2BHSA 4JGGA 1RP7A 2BM9A 1JEOA 1QHFA 1E6EA 1PKEA 1MU0A 3VYSB 5FCDA 4YRRA 3T4UA 1W85A 3ZQUA 2D0PB 7MHTA 2WPDA 4G0WA 3LC0A 1U0RA 1MJFA 3KVVA 2QVYX 5DNDA 2GAAA 2X0FA 3KJZA 1OLUB 5HJ7A 2P40A 3FI0A 1SXJC 3PGJA 3QUSA 1J0EA 3H6GA 1YRWA 3QUCA 1U9YA 3Q2IA 4ZJUA 4WK4B 1XKXA 3ENVA 4M0CA 1NUQA 2XXAA 3BGSA 3I9MA 1KFBB 2ZM6B 5CFLA 1LFAA 4PXYA 2L18A 2F1JA 5FT9A 5ADUS 1D6JA 4P2BA 5TQJA 2X6TA 3HV2A 5CT6A 1P9WA 1EDDA 4PAWA 4K9OA 1TUIA 2E4YA 4H17A 1Q1QA 2DJIA 3DCJA 4LWOA 1JKMA 3E82A 3PQ6A 5EZSA 2RBEA 5JWRA 3LTEA 3P94A 2GPYA 4YAIA 1C14A 1YRBA 2CL7X 2ICAA 2O0KA 2XHZA 3HKCB 5ALYA 4GQBA 5D00A 5A02A 1T91A 2GYWA 1JEJA 2CXQA 3HA3A 1MF7A 3DDUA 4O4LA 3SC3A 4B40A 1DBWA 3FCCA 2ZJ5A 4J0IA 2CZQA 3R0XA 5A3VA 4DV6B 1Q1AA 4C5BA 2V96A 4XX1A 4KDCA 2DBYA 1Y82A 2H29A 3OPNA 3EY4A 4XVHA 3CRVA 4PTYA 3RTGA 1RYDA 3DUFA 4A15A 4CMHA 1VPVA 4G0MA 1H23A 4YECA 2DVMA 3FE2A 1MAHA 3ICWA 3JTEA 1PYDA 5FOTA 5JD4A 3CVWA 4E2WA 4PFQA 3RYHB 4I5GA 5I48A 5I7FA 2P41A 2YMQA 3WYFA 5AKYA 2HWUA 3AR5A 2QIOA 1UBCA 4C0SA 1N8TA 4OGLA 2QY6A 2G07A 1SC3A 1GCOA 3WWPA 3MTEA 5EHQA 3SJBA 1DFHA 4LRQA 1T9AA 2HBQA 3HDTA 2D1QA 2VK2A 1ZICA 2YXDA 1O9GA 5DTMA 4CKWB 5I45A 4R54A 4R16A 2PDAA 3OZIA 1TKCA 2AG6A 4LV6A 4FFBA 1JLSA 4FBMA 2FW6A 1ADCA 2NU9B 4E09A 4F4DA 3LLVA 1N2JA 2ACWA 4EI8A 1PCXA 5B3JC 4HZIA 1DP4A 1CNEA 1NR1A 5AXBA 5C5DA 5CYGA 2RKBA 4FSHA 3EDQA 3LBYA 2NQTA 3MGGA 3W34A 2P5UA 4DY4A 2VJYA 4F8EA 3ZDBA 1OZFA 2BDTA 5C8VA 1EVEA 4UAUA 3H5WA 1I24A 3EVZA 3ROFA 4L75A 2BPOA 3AUAA 5FI1B 4F6LA 2H1VA 1XJQA 2JKZA 2NLOA 2XUHA 4NDNE 2JH3A 4XARA 2GAFA 4N49A 3UUGA 3ZUPA 1JHDA 2WNHA 1XZPA 4OQEA 4WI1A 1GCGA 3DYIA 3FX2A 2H18A 3OF3A 5HMMA 1E6MA 4MJLA 4B74A 1NJ5A 3R8CA 4UM7A 3JSAA 2O0HA 3ELBA 4RGVA 1E9AA 4UJ3A 1JWAB 2RHLA 3MD0A 4C01A 1M6VB 1JSCA 3FLMA 4J0DA 1F4PA 3BFJA 4MGHA 1VIMA 3OSZA 2GXSA 2JF0A 1FFBA 4G09A 4R9VA 4DOMA 1ZISA 1UEXC 1U2TA 3C7TA 4IKOA 1HFKA 1T3ZA 3DE4X 5AJWA 5H1YA 1YOBA 3CB2A 4H6PA 4ZVUA 1UAAA 5JJBA 3BWYA 3WV4A 2GLTA 1E1KA 5CMLA 5B2FA 2LUOA 2YH2A 5L3ZA 1VSTA 3UV6A 1E1RD 1WSWA 2X7XA 3NIBA 2CVZA 5H59A 2E48A 4BVFA 4DIBA 1TF5A 1D2MA 1Z45A 1SVSA 3FYCA 2ZIVB 4RA9B 4W8GA 3UICA 1OGIA 2EDCA 5IASA 1ABEA 1UC4B 3LP6A 4JHXA 1NOIA 3SDZA 2C31A 1EUCA 1QVRA 4PV7A 4NK5A 4FHZA 1ZH8A 4JLPA 4RIIA 2WM2A 1XA3A 1QFJA 4MS4B 4RQAA 5B2ZA 3LU1A 2NOAA 1OLXB 4QODA 4ZYZA 4WESB 5AW8A 5HIKA 3LUGA 3OZAA 3GJXC 1JLMA 1GG8A 4TN5A 2X0EA 3TLZA 4DREA 2A1TS 3ZD9A 1VECA 3P0EA 2OZPA 3CF6R 3LE8A 1DEHA 1ORTA 2AVDA 5G3YA 1TT7A 2NO7A 3TAUA 3GDWA 5JCPA 1V8FA 5L45A 3E3NA 4GXRA 1FTYA 3I1YA 4L0CA 4M8IA 3UWDA 3L1UA 1M1ZA 1NYRA 3V3KA 4QKQA 4G26A 4RM2A 4Z4CA 1HV8A 1XZLA 1NSYA 1ZINA 3HLKA 2BR4A 3PWTA 3QEJA 4AFNA 3WL7A 3NEYA 3PX3A 3T35A 5JQGB 4LX8A 2XOKA 4Q93A 3ZWBA 5CCEA 2PU7A 1ECGA 2C42A 3BKWA 1WKCA 3CUSA 3JAWB 1RWWA 3CQ9A 2A67A 1KEZA 4Y9UA 4COKA 3SM3A 5A4MS 2J3LA 4BMVA 3Q8MA 2JK1A 3OTHA 3E6AA 1ZGBA 3MTGA 2GK6A 3BF8A 1LPAB 4WFQA 1ORRA 2C9CA 2NZVG 1N5DA 2RAFA 5FL7A 2HAEA 3Q0EA 4CPDA 3HCCA 4OI1A 1OLSA 3SHFA 1RI4A 1RIFA 3GFOA 1EWVA 3O82A 1LBSA 4ROSA 3CEAA 3U31A 3HKDA 4DLVA 2X14A 2VHCA 2AG1A 3NO4A 3O5AA 4CIAA 1Y1SA 1PT7A 2ATEA 3KSZO 4FKBA 3JASA 4JQZA 3TQHA 2CWDA 2IEIA 5CDUA 5HILA 3ZE7A 3I9V6 5HSGA 2JCBA 2R8BA 3ANXA 1P9OA 4PX3A 4RJIA 1WNFA 3WDMA 2F1KA 2HMVA 4TKVB 1C5KA 3X1YA 3Q0TA 3WB1A 2QBYA 1CJSA 5K01A 1N2ZA 2BFBA 2C54A 2P65A 4FEYA 2JLRA 5FYQA 4XX0B 1A2OA 4I55B 4RF3A 5AHRA 3ZWKA 1NW3A 2FQYA 4NXMB 4GT1A 3LPNA 2I2AA 1MD9A 1COZA 1ZVKA 3OEED 1BXZA 4RMIA 1U2ZA 2QRNA 1W30A 3GG2A 4UUBA 4B3TB 2HRZA 4C4OA 5BY2A 4LZOA 3QELA 1N0UA 5K5EA 3VZSA 2XTNA 3EVFA 3A1VA 4F3KA 1LK0A 1M6NA 2E4XA 3B5JA 3JD4A 4N40A 4US1R 4JI2B 5FPYA 2WQZA 5BXYA 2QTVB 1RQ7A 2B98A 1DTEA 5IARA 3A2KA 4CQJA 2ZYRA 1Q57A 3A8TA 1QPGA 1E2MA 1SCIA 3DC7A 4A0QA 2C04A 2ZSAA 5FOUA 5IJZA 1SXIA 3NFYA 5KX5B 3NRJA 2H1RA 4GXQA 5DGDA 1L8OA 2VYQA 3AVWA 1GXSB 4HGNA 2FZVA 1QVVA 3OZXA 3P2EA 4MRMA 1F6DA 1XXHA 1I4OA 2ABWA 4JQYA 1ZUNB 5SZJA 1NYLA 1QRAA 3NALA 3WFZA 4IV5A 5AM5A 2MWMA 4QOFA 3C4QA 4Q3CA 3GBSA 1FVXA 5CAEA 1QO0D 5DBFA 5B3KA 2HBZA 3K0KA 1E9DA 3FYUB 4DR7B 2FCRA 2GN6A 4C7OB 1KL7A 3P4XA 1BN7A 1JDVA 2E18A 1MXHA 1QXSA 2RJ3A 3NHLA 1USIA 3N2KA 3NCHA 4Q3BA 5AOBA 2DYKA 1B4DA 2JI8A 4HS9A 4MUFA 5ARDA 1Q6ZA 3OQ6A 1RXEA 3T7DA 3T5TA 3WLKX 1CUVA 1N0WA 1LPOA 1RBMA 2ECKA 5HPYB 3UK1A 2JIZD 5DYYA 4MK4A 2QUIA 1GKKA 1GVNB 4C2TA 5JDIA 2ZSHA 2JGMA 4UBMA 2IH4A 2QLBA 1NI5A 2ZULA 2AOUA 1QB8A 4AO6A 1KGSA 5CURA 5IBPA 4QU0A 3MRTA 4C30A 4NBRA 3SJCA 3BDAA 3IOMA 4GMFA 2YWEA 4JP3A 4BAUA 2ESRA 3OIWA 1ML4A 4F1KA 2ZYAA 2XYHA 4N0MA 1GR1A 5LP6F 2AMLA 2AC7A 4LCBA 4A0RA 3KS9A 4AUKA 4RULA 2IZOA 3SZMA 1VPWA 1USGA 2O3SA 1TI7A 1R27A 3ECCA 2SCUB 1RZUA 4TTIA 4D9JA 1SXPA 4KWCA 4ZVQA 2Q0HA 2VYND 2NO5A 4G1MB 4QL3A 4E94A 5J4LA 1HG1A 4MNTA 2IEGA 1W4LA 4UW9A 3VC7A 2J4CA 3SIWA 2IYQA 3WSVA 3GD7A 3C3EA 2OHOA 6Q21A 2J3KA 2H8GA 1PBTA 5BVHB 3U1BA 1HEIA 1OV4A 1OIWA 4EMUA 1O6BA 1NVFA 3KEGA 3DBHA 1OA1A 5CVUA 2CV0A 4CEIB 2NU7B 2Q1YA 2HK6A 1YASA 5TVKA 2QV0A 5JZVA 4BQFA 4Q9IA 1TQ8A 2JJ8A 2QPOA 3CT4A 1RI3A 4FZ3A 4N7JA 3ITKA 5EI5A 4Y7CA 5DM70 2XUGA 4EZBA 3JYNA 1BHO1 4ZI2A 4AULA 1WW3A 5JAPA 2ZJAA 1PVOA 1G5HA 5DEIA 2EBHX 1R4ZA 2CLSA 1LVGA 2DZDA 2LGJA 2Q9UA 3A3YA 3KR9A 4MRPA 4F2PA 4ZKDA 4JUCA 1BA3A 1NBMA 1ZAKA 3DE2X 4TROA 3S68A 2J5QA 4OA8A 3FUVA 2OHHA 5KEIA 4YRMA 1XQVA 4O2BA 5E38A 4B7ZA 3AHFA 1I2MA 2BLNA 4I0WB 1W34A 2Z4RA 3JQCA 4X20B 4EKDA 1NVWQ 2C9MA 3S99A 2OL4A 4PYNA 3TUJC 3CSDA 4R81A 1U3GA 3CIOA 2WPDD 4J1TC 4RD4A 1GY8A 5AKIA 1LZLA 4PYLA 3KJIA 4HN9A 2HV8A 2F1HA 4G0PA 1G3UA 4PLWA 5BNZA 3K05A 4RAQA 1LW7A 1X19A 2GUGA 1U94A 4HGQA 5C46F 2VT7A 4XJSA 3OD5A 3NDPA 3OZ7A 1UPXA 1KYZA 5HG0A 3GI1A 3JCZA 4GKJB 2BKUA 5K3CA 2E37A 2COUA 4NENB 4O4HA 3UAWA 1NF9A 5EQDA 1Y6GA 4YRQA 4HH1A 5FIUA 1OPRA 3H86A 2ZIXA 1NUTA 3NHSA 1N2HA 4BMXA 4CTJA 3QMMA 1WO8A 1C29B 3GPCA 5EJMA 1YB4A 2CLFB 3JQGB 4C89A 4ZCIA 1AT1A 1UBJS 1DI0A 1FJ2A 1ODSA 2O1SA 2KLHA 1PJTA 3K1ZA 3PLRA 5F7XA 4HZUA 3EC7A 4KGVA 3CF2A 2QUKA 4L02A 4ZMBA 3LXXA 4IIBA 2VDPB 4ZVNA 1QB7A 1QIGA 3HSYA 2O9JA 4KE9A 4F2HA 5E2BA 2R84A 5EHNA 3UO8B 3ZQ4A 4DRXA 5LXTA 1MJHA 3F5MA 3TLGB 1S89A 1ISFA 3R6WA 5KVAA 1ODKA 1Q7CA 1T5SA 2DCUA 2L69A 2KX7A 1F6WA 4KNWA 3SMVA 2CNWA 1CP3A 4ZALA 4MW1A 5FUVA 1TIBA 5CLJA 2ZRJA 3GUZA 3JQBA 4QFBA 2ZZKA 3CT6A 2EXXA 1BE8A 1IOWA 3U7QA 5GOTA 3CRQA 3DZCA 1SOAA 4C6TA 3A28A 4YRNA 1TL7C 5BOVA 3KKZA 4B4UA 3C85A 1DJLA 2QD1A 3VJKA 3PJFA 1XX6A 1ZGGA 2PX6A 4YHHB 1X92A 1O0BA 4KFCA 3DE7X 2ISQA 3WYGA 4QLBA 4NJEB 2Y1XA 3K9BA 2BCJQ 4FNOA 2DMRA 4XWOA 3WG9A 4DVGA 4L8YA 1XZIA 2IYOA 2AD1A 3DYVA 3PNPA 4Q0MA 3PEEA 4YS6A 2GHTA 3SE0A 4G85A 3L01A 3JZAA 4F56A 1UXKA 3GLGA 2OQ2A 5E1DA 1Y4AE 3QJ5A 1PS0A 3RCBA 3TFQA 3V4FA 1JNXX 3IE0A 1J8DA 3I9V1 4QDJA 5NLLA 1X8LA 1ZLXA 3G0BA 4KFSA 2RH9B 1V95A 2WJJA 4DPLA 4L9SA 1PZFA 2WICA 4YJHB 1I36A 4HYEA 3FAKA 3ND5A 2KBEA 3MCUA 3NWPA 3Q4GA 1KI9A 2YMLA 4YMTA 4YP1A 2I6XA 4NOLA 4KUEA 1VBFA 3H3XA 4TMKA 1XEXA 3DOCA 2C4KA 5BNTA 5KKAA 1A9XB 4H0NA 2PMDA 5EXDA 2BUCA 3AR3A 3BXHA 4G0OA 4CMAA 1JILA 1Z8FA 2XWPA 4YUZA 1JQDA 3T06B 1T8UA 4MUMA 2CB9A 3FSRA 4ZI5A 1A9RA 3ML1A 2RGBA 4X1IA 1OZ0A 4Q7QA 3GEMA 2EEZA 1RLTA 1YU6A 3A1SA 4XJTA 4EUSA 3CJRA 2BRUA 4U7DA 2VATA 3QE0A 1O96A 1RC8A 1XG5A 5THQA 3P0FA 3BSYA 4KQ9A 2GILA 4G8DA 2XNSA 3LVQE 2BTQB 4ZOEA 2A84A 1YR8A 1E0KA 2DTXA 1BNCA 2YJTD 2QAGA 3T7JA 2HMTA 2FF7A 5DHAA 1WU7A 4DGSA 5LQCA 1JEEA 4MARA 3RASA 4V2IA 1NM5A 4JIMA 4RMGA 4Z99A 2GZAA 3ZDRA 1U0JA 3DAYA 1A97A 1FYFA 3GLHB 4DFDA 1KEKA 3PXBA 3A7DA 4PLTA 5IANA 1Y3BE 3GIDA 3Q7QA 4RFVA 3EB9A 2JAPA 4RHFA 3SSNA 3OT5A 2QW1A 1GPWB 2YZ7A 4YJDA 1MVOA 3L93A 4DEYA 4B3MB 3R3YA 4H15A 4R83A 4K9QA 2HXYA 1AA9A 3L04A 1KJZA 5E1OA 2K4MA 2Z2YA 2H6EA 3H8SA 3TCKA 1B8VA 1MQSA 1X7ZB 4J3NA 2IU6A 1O5IA 2IWHA 4N5LA 3GCXA 3RK0A 4BX9A 3VR0A 5IG2A 1G5TA 3OLVA 2QMQA 4KXLA 5LCXA 3VR4H 1CUXA 3IDZA 1H2AS 3QRWA 1KKMA 2AZXA 4Z6KA 3O8OB 2BISA 3MYYA 2JH8A 2XDQB 3T52A 1SD2A 1R2QA 2W6JA 2G1PA 4IUYA 3O31A 1RXCA 4V0MA 4ZRDA 1E2NA 1SA0A 5EVJA 2D1TA 3PYXA 1FP4B 4E0BA 4IWXA 3F67A 1GV1A 4C22A 1UBTS 4ZQBA 2FWMX 1Q11A 1NJSA 3MPUA 4OEHA 4M49A 4RF4A 1PV4A 1FNMA 5CX1A 3UOGA 4DUYB 4U4AA 3L4JA 4MQEB 5FL7D 4EIWA 3EGDA 1S7CA 1ZG3A 5COBA 3E7FA 2H7YA 4EB3A 1TTTA 1P4SA 3KKKA 1H0HA 1ZI6A 3EAQA 3NHYA 1JHYA 3UKOA 3E3MA 4PTLA 4PWZA 1KYTA 1SG9A 4B6OA 4JIGA 4B43A 3QKRA 4TWRA 1KBZA 3E9ZA 2CCJA 2Y99A 1UQUA 3CHYA 1TPYA 3LQFA 5COAA 1JKJA 3EZNA 3QPBA 4MROA 3VVBA 1KSHA 3HDJA 2LCFA 4WXMA 3T1OA 1IB0A 4HDAA 2GERA 4BAGA 5MGBA 2CEAA 2X3FA 4TV9A 4B4VA 1CR6A 3K4PA 4OI4A 2OORC 1NBEA 2A35A 2GCPA 3DPIA 1NDQA 2VFAA 4R51A 3U7JA 3WYDA 5BWOA 1EA7A 2D5CA 2Z5VA 4L3OA 4EHNA 4M53A 2AS0A 1SOUA 1GLNA 1ZYUA 1W85B 4FI3F 4LCEA 2C84A 4DXAA 4PG7A 3T1TA 4AO8A 3LMKA 1BJRE 3N1UA 3INNA 4MYDA 1QKKA 4DMFA 5EJ7A 3PXGA 5IFKA 2JHFA 4Z3DA 1K89A 2POQX 1YA8A 5I7AA 1KMHB 1XVVA 4KQCA 5HKKA 5E4YA 5E6SA 3TUIC 4GVLA 1O6ZA 3O84A 1F8UA 3AEKA 3O91A 1GL6A 3EXG1 3WISA 4MI9A 1Z56C 3GZTB 5EIOA 1TUEA 1C8LA 3LUCA 3F5SA 5ISMA 1C9JA 2EX4A 1W4ZA 5AW7A 1N7GA 2WBLC 1EX1A 1H1TA 5FPSA 1NI3A 1Y9EA 3RS2A 3VHXA 2B8TA 4ZCLA 3ETDA 4I1SA 1ZMOA 2G28A 5C4GB 2IYFA 4ZT2A 3PQDA 1HE1C 4RHTA 1OB2A 1PJZA 3IHLA 2WFLA 4YUVA 4TTSA 2WYOA 4GWKA 1XEWX 3UW3A 2NZ8A 1RAIA 3BK7A 2PJUA 1NQAO 2BY4A 2VT3A 2VNIA 2QAIA 4FS3A 3QE3A 3KZVA 1Y5NA 3VQTA 2ZUDA 1D5CA 2QW8A 3I2FA 2I6SA 3KE9A 4O4LB 5TMPA 2VPWA 2WINI 4O4JA 3BBPA 3TBKA 2WSBA 1HM5A 3U62A 4KQMA 5FTLA 5HGXA 3DT6A 3QXSA 4YJFB 2EF0A 2HWXA 3HKBA 3QVWA 1CZNA 3DDSA 1HBJA 1H2BA 1J0DA 2C5LA 3P5SA 3PQ3A 4X00A 4YP5A 4AZTA 4DMGA 3DUFB 5ILOA 4TVOA 5HF6A 2BR3A 3QXHA 2JAUA 4E2YA 2NACA 1W6UA 5LDHA 1VCIA 3V48A 3SYTA 4DGQA 4BJ3A 4LRUA 1DAGA 3PUHA 3JXEA 2D62A 3BKXA 3LUJA 1UP7A 2OZLA 3LXMA 3NZEA 4P3NA 1U8FO 2BT4A 2PL1A 2QDKA 4PVDA 2PX0A 4EYKA 1MC1A 2AZDA 3CUEF 2Q3CA 4KE6A 4N3GA 3EE6A 1SBYA 1HEYA 1Y3AA 2LDXA 3VI3B 1TJNA 3S70A 1R8QA 3FPHA 2I4NA 2ADFA 4NH0A 3W2EA 4D8UA 2Q49A 3OUZA 4B80A 2PLFA 5CD9A 4FFBB 3RLIA 3G5UA 1YVUA 2JVIA 4K6GA 1DOAA 5H3HA 4D57A 2AJLI 1YI0A 3LC1O 2P3OA 1FSZA 3IPXA 4GI2A 2AK2A 2VZLA 1H4SA 1EEXB 1XTPA 1GT6A 3OCWA 1AKMA 1C3EA 1D04A 4HGZA 4IXTA 3TRIA 4J1QA 2FSUA 2PO5A 1WQ3A 1PAUA 3EZ9A 3M9LA 4P5EA 4PPFA 4JBXA 4RE6A 3VC1A 5H9WA 4MMYB 4QXMA 1FDSA 3V42A 2FJUA 4ZIRA 4AIIA 2C61A 2H2WA 2R65A 4L5YA 4M54A 3U4MA 1Z18A 4FR0A 3RVNA 4LNUA 5B57C 3ONFA 2OCDA 1EFPB 4GC9A 4MUKA 4TKUA 4QG3A 1UKBA 2HQOA 5KNCH 2IBSA 2QMHA 2NN3C 3CIFA 1FE8A 4I8IA 3RR2A 4DARA 4X6LA 4R6XA 1GGFA 1DRJA 1DAPA 3OZEA 2FETA 3MOIA 1JJ7A 2QY9A 3LH5A 3MN1A 3PR2B 1V16A 1NBMD 4JT9A 4UNSA 2GEVA 2P0YA 3MGAA 1STOA 1Y1TA 2CMFA 8ATCA 1PLJA 1FP6A 3FFTA 1Z62A 1UJ6A 3DO5A 1KAQA 1VJ5A 2R1UA 3ETEA 1TEVA 4DJDC 3WHPA 4ZK2A 1J1IA 2P9FA 3OA0A 5JAMA 4QXPA 1ZGCA 1P6XA 4M8LA 1AS3A 4UHKA 4ZFNA 5LQUA 4C43A 4HQNA 4UCFA 1GO2A 2Q0SA 2IUTA 2A94A 3MWEB 4MI3A 4UBKA 5ENDA 5FI3A 1KMNA 4FWBA 5D1NA 2XZDA 2V7TA 3FBTA 4BQNA 3UGJA 1C80A 2HNBA 1M1YA 1DEXA 2QQ0A 4CKXA 4DLTA 5A4IS 3ER8A 4IMRA 1IOLA 2CHVA 3TOVA 3ZNQA 1IVNA 3CO0S 1S4QA 1SEPA 3E22A 4V02A 2P35A 4BWYA 1WUYA 3QWBA 3EFOA 3LBHA 4BNXA 3TPFA 3HABA 1G64A 2DSNA 2Y0DA 1BFKA 2PMBA 1EUCB 2QL6A 4FE3A 2Z5FA 4PLZA 4R2JA 3LFHA 3U44A 2FEXA 2VSOA 1HE4A 4KP7A 2VDWB 2IK8A 4NBKA 1EGMB 3V4ZA 4JMLA 5JZSA 3GK3A 1TEHA 2IXTA 3I42A 1Z6GA 3ZZUA 1S2DA 3VH3A 3UPDA 4RH1A 4K8RB 1OBCA 5HUJA 3QPCA 3ANMA 5HCUA 3OU7A 1IDOA 4TMXA 3ZH2A 3SAJA 4R1OA 5IAGA 2IDZA 3TM5A 1TU0A 1T10A 3ITEA 1GEGA 3QVGA 2QUAA 3RH0A 4Z49A 4K88A 3DFZA 4F91B 1XD9A 2FSFA 4RPHA 1VPDA 4IHJF 4MVJA 1V8DA 4MHOA 3P32A 3TIGA 1PL6A 1F17A 2AG5A 3Q12A 5A4FS 5B4UA 1L7DA 1MOZA 5KYGA 2AN3A 2R9VA 3KJHA 3OHMA 3FPBA 4JJ8A 4OM8A 4BNDA 4C4AA 2HIHA 3F0TA 3PNSA 3OM9A 2H4WA 3TECE 1H66A 1FY2A 2FOIA 2IOHA 2V5AA 4FZRA 1RRGA 2JFFA 3I72A 2WRZA 3DVAA 3BA1A 4JWKA 4KRGA 3MJ4A 4M2LA 4DZRA 4FDTA 4PNEA 4EG3A 4H3HB 3U48A 2A9PA 4GUAA 1OLSB 3U4IA 4CF4A 2CUTA 4LJ9A 2XUJA 1VXRA 2ZUBA 3HKDB 2BHNA 2WT4A 4PS1A 2B7LA 3OQ1A 4Y6RA 4PG5A 5DLEA 3JASB 3UAZA 1TK9A 3Q7TA 1CXZA 1YQTA 4C87A 4IIDA 3T5MA 4JBLA 1I5EA 3ZV3A 1JFTA 4NOJA 3EPHA 5JJCA 1D6NA 1GPLA 13PKA 4WFJA 4X71A 2P4SA 4PRKA 3RSQA 2EFDB 1OUMA 4O5OA 3FFAA 4NHEA 1GJRA 1TZCA 2EJCA 3ZWAA 2Z8YA 5K0CA 2BZSA 3TK1A 2IITA 2BFBB 1FJGB 3UXYA 2AZ4A 4P0TA 2YFHA 4W99A 1D7OA 4IFIA 1K08A 4V0KA 4C3UA 4HNUA 5AM3A 4MIOA 4HEHA 3L02A 4P32A 1BIFA 2HHLA 1Q5PA 2WEKA 4TKMA 4QQNA 1GGNA 2II6A 3W5JA 3OU6A 1FDVA 3BWVA 5KTTA 3COSA 1Z17A 3CN9A 3HM2A 1X8XA 3B3AA 3QELB 4GH5A 2OAQ1 2FPMA 4S04A 3FYUC 4OI0A 1K7FB 2ZB8A 2C94A 1E61A 3AERA 3C8DA 2MSDB 4MYUA 4OXNA 4U8HA 4AN1A 1IK4A 1Z4NA 3L0OA 1TRHA 5FPPA 4BCCA 1WXQA 1UMDA 1M6EX 1IVYA 3QPAA 4Q1DA 5KYYB 2NTNA 3EVGA 4KVFA 4YASA 3U3KA 2IS6A 5LB2A 4BUCA 3EC2A 1UJCA 3HJTA 1Z2CA 1ZUD1 2WJ4A 2I4MA 4XH9B 3RTEA 4B6RA 2FWIA 2HPVA 1MHTA 3JU3A 2YJ6A 1PZEA 1XZHA 3NT4A 3HVHA 4ZOLA 4ZVOA 2ZRPA 3LY7A 3GFPA 5KIAA 5EWJA 3W06A 3CRMA 1IHXA 1KI1A 1NC1A 2BEKA 2C88A 2XX3A 4QEDA 5CVJA 5IDVA 3F9IA 5LB4A 5JLJA 1E1MA 4L15A 3QTLA 1B0ZA 4EITA 2G09A 3D1JA 3KBOA 1E5DA 2FWNA 3KKLA 2VTBA 2WIDA 3LPAA 3WJ7A 2W42A 2ZSIA 2AEMA 5HX7A 4MKHA 3BB1A 1CF9A 2FDRA 3A4NA 5CAEB 3T3MB 1QDLB 5K3BA 1SRRA 2MR6A 4LWQA 2DETA 2BE7A 1B3RA 3P2MA 5LP6A 3IEVA 1B3BA 2JHGA 3UK2A 3PD1A 3N2KB 1XCOA 1SCAA 4RK7A 2RH5A 1X9HA 2JGIA 4OQ4A 4GOND 2H0AA 3OJFA 4F6CA 2BKLA 2IHTA 4YREA 3MUOA 4INOA 3VDNB 1M7GA 1Z13A 4DYVA 1KKLA 4CG2A 4Z7JA 1ZIDA 4DSOA 3N58A 3OP4A 1AKWA 5BT9A 1IHUA 1I4DD 4R2MA 3IIIA 4DMUB 3LOPA 4EVIA 1Y7PA 1U3UA 5LU8A 1LKZA 3QX3A 3C3XA 1E60A 3CMMA 4K6KA 4Q3AA 4V0OA 3BXXA 3TW0A 4DJAA 3DLHA 1UJ5A 3I5YA 3T3PB 1IIBA 1UFQA 5CGZA 1VCNA 3DOOA 4IGEA 3RRYA 2UYCA 4DR2B 2VZ0A 3OIFA 4UNRA 1R0CA 2CMDA 4XRRA 4MP3A 5BSWA 1K6MA 1WQ1R 3LA6A 2HSDA 3AL2A 3KAQA 3UJ9A 3ZWXA 2W6JD 2G71A 3EMBA 3Q6IA 4QWWA 1GTJ1 2XCLA 4LI0A 3IUMA 5E4JA 2P9CA 4LKOA 4LV8B 4RTRA 1WMDA 3B48A 4U39A 3FWKA 1Z7BA 3GNSA 4P54A 2QQFA 5L95A 1GIAA 3DMTC 1L6RA 5CA0F 1RYZA 3TZLA 2QQEA 5ALZA 1PGQA 5JCXA 4OQYA 5HW0A 1MAUA 2ONZA 3JWJA 4PY2A 1R3UA 1K4KA 4YVFA 3NOVA 3N2LA 1VJDA 2HOQA 3H2HA 2J0VA 1KOJA 3HE3A 5ETJA 3T12A 1IQ0A 2I3GA 2ZRQA 4X85A 2Z6VA 1WBBA 1CEEA 1DZ3A 4L6IA 4DDKA 4P84A 4JI0B 3L0IB 1TUBA 4A8JB 2Z58A 3FDZA 3RFCA 4UBNA 5DM1A 1M73E 3CW8X 4BX0A 2QZPA 2H7CA 4XGQA 5DCUA 4RPJA 5D1HA 4R1TA 1QFSA 2VEOA 5E7MA 2E5WA 3FNHA 1DEKA 4US2R 2Q8QA 4CT5A 4DKJA 4RLFA 3RU2A 1Y3HA 5TLSA 2ZPAA 1BVRA 2WM9B 3LY8A 4RD0A 1M10A 4KSYA 5JRZA 3W4JA 2OFOA 3K6RA 4RENA 2C2OA 1PEAA 1V37A 2FKAA 3C6XA 1NV8A 5J3JA 1OH5A 2D3TA 2JFZA 4IJMA 4M8NE 3QEBZ 2W6IA 1WY7A 4C07A 1J09A 1Q50A 1ESDA 1SBZA 2Z1DA 2JJMA 1ORIA 3PRYA 1T35A 1FJXA 1XPUA 3OO0A 2IF0A 3QLUA 1RYFA 4O4HB 3RFUA 2VP5A 2AFHA 5I3ZA 4GHWA 2GJAA 1MG0A 1PX0A 3HNRA 2I65A 2ZIXB 1TGYA 3LWZA 4RVUA 3W6OA 1SKQA 2FMXA 1GV0A 1W76A 2GPSA 1MX3A 2VF8A 2XUKA 3I2IA 2IYXA 5M3BA 1IRIA 4RZHA 2W6NA 1U8ZA 3IT1A 1ACJA 3P5BA 4FSDA 3KT0A 5AVOA 5IT5A 1FXWA 5A9TA 1NJ6A 3P7MA 4HX2A 5K4GA 1HE5A 1BTOA 3RYIA 5KCMA 4HAZA 3KD3A 1FBTA 1GT91 4HZUB 4MGZR 3C7DB 3KZCA 4U7JA 1EGAA 1YR2A 3FMVA 1XHEA 2FFQA 2YMPA 2ZAMA 3WLNA 4ESHA 3GLGE 1QDUA 3L2OB 2OFWA 1U11A 3ZJYA 2H06A 4YV2A 2YZ2A 4YIKA 1QHGA 5LXTB 1QLJA 1O95A 4DRXB 1I7PA 1ACLA 1YQUA 1L4HA 3KETA 5C3UA 1K3UB 1MTZA 1POWA 3AI3A 4EATA 2GBPA 3G0HA 4G8CA 3WSWA 4EJSA 4TQUS 3ADBA 2ZKLA 4EQZA 1PL8A 1RTKA 1NVVQ 3FJ1A 3V9AA 3ZOKA 3ZJTA 1FZTA 3QMWA 4L5CA 5JH7A 1E2UA 2H0QA 3EC1A 2K2WA 4E4TA 1R50A 1E0DA 2OBYA 2B3TA 4N5DA 3U7QB 2HW8A 3E3OA 3QOFA 4EY7A 2GZ3A 3X1MA 4TTAA 4EGSA 3AG5A 3BIFA 3IRVA 4RJJA 2P30A 3LWBA 3PXUA 5FNVF 4LGCA 5L53A 1AHPA 3KB8A 3B2NA 5AQ1A 1IBLB 4ARSA 2BJVA 2HK7A 2JLBA 3ZV4A 2RHJA 1VDMA 3VHQA 2K7FA 2HEGA 5CG1A 3ENKA 4PBSA 2I03A 2YV5A 1U7TA 2P75A 1WE2A 2GEDA 2RGNC 1PFGA 3Q9SA 4F7DA 3L5KA 1I3OA 3GN1A 3WADA 3I9FA 3LUBA 4KR0A 1I2AA 3T9FA 3WLAA 4AJHA 4AP6A 3COVA 2A9KA 2TS1A 5AHWA 4Q5IA 1RJDA 2B9EA 4XSGA 2YZNA 4ZICA 1RHQA 1MA0A 2XE6A 1SZCA 5TY0A 1VCOA 1JIIA 3NDIA 3WNVA 5IAKA 4LHEA 3ZHUA 1QQ6A 1H0KA 1PG0A 2HO4A 2OZVA 3LGXA 3H1PA 4UEQA 2GZMA 5I9SA 2VHZA 4PRZA 2GA8A 5ALVA 3WHLA 5AVUA 2WHPA 4MVJP 4CDMA 3IOEA 2ACKA 5KVVA 4WNYA 3TINA 5LMZA 4ZTZB 3SI7A 3ZV7A 3E23A 4XYLA 2XBUA 2BMAA 1Y6RA 3LD9A 3TRKA 1DADA 1N3LA 4RH3A 4US0R 4NS1A 1XEXB 1G9TA 3EZYA 3H8WA 2IV3A 2ZYIA 2JVKA 3G0CA 3PNLA 1YRAA 3HN2A 4MB0A 1GFZA 1IBCA 2M6RA 5K8IA 5C51B 4ENWA 2ZQZA 2C1EA 4GLLA 1XTJA 1CY7A 2J30A 3LT5A 1LZKA 1U28A 3TOZA 1ADJA 3NEPX 4AZSA 5F9HA 3ZK8A 4CKCA 1T6ZA 3VR2A 4DIEA 5KC8A 1DFIA 1EWYA 4O1MA 4X1IB 4BO6A 1QRSA 5TRTA 2HF9A 3BGWA 2BZGA 1O96B 3JYOA 2HMSA 3ETLA 4WSOA 4X8HA 3SLKA 4GE3A 4X1YA 1SXQA 4G1BA 1PFUA 4QXQA 3E2MA 1I4LD 5AW5A 3AHGA 4KE8A 1FLNA 1NVBA 2CN1A 2QAGB 3D54D 4RWEA 4Z9XA 5J2TF 3SJUA 421PA 1GNLA 3DCYA 2FPPA 1YRHA 3GQBA 4JODA 2OV4A 2V7VA 3PXCX 4NU8X 3IUPA 3KPWA 3G9QA 2G4CA 2Q46A 3Q3VA 4DA6A 4DWJA 1PKXA 1WVMA 5BURA 4CW7A 1GLGA 2CJPA 4NAVA 4KRFA 3ER9A 3O0TA 1M8JA 1MR3F 4U2FA 4IJWA 4MUNA 4YRTA 1Q3TA 2O3TA 4ZVKA 1MDFA 2C8JA 3GP3A 2QYOA 4WOCA 4Q9LA 2WWYA 5IC6A 1PZGA 1Z0SA 2CFSA 1U7DA 4M1WA 1EA5A 4LXUA 4AKSA 1Z8NA 1BVHA 4IBOA 1SHJA 2MSLA 4RIHA 3BBLA 3Q7PA 4XYEA 2VRCD 4BC1A 1QU2A 1OT5A 3W4KA 3IBCA 2FW7A 4JBGA 5J2UB 3DHVA 1OVGA 1UL1X 1CUDA 3AUJB 5IKMA 4CF7A 4Q3EA 3U60B 2GN8A 3UC5A 4IDHA 4Y67A 2Z04A 3GAMA 2C98A 4EFDA 4TYYA 2W90A 3L6CA 2B2NA 3RC1A 1NBOA 3KKQA 5B58T 2X41A 3HVUA 4MVJD 1SA0B 4QFMA 2G08A 2N1MA 3O4HA 4IHAA 3CX3A 3CVXA 1GPJA 4S24A 1NQUA 3HB4X 2OSBA 4DLSA 3FZEA 5TR9A 5F5NA 4ER6A 1WLYA 1ZMXA 4J90A 1N2XA 4CM4A 5IVPA 2JRCA 4UASA 4G4SP 1Z0FA 3E7PA 3WTCA 1D8TA 1FFEA 3EGDB 1K8QA 4AKEA 4DR6B 2ZYSA 1V4NA 4G25A 2A58A 3TTUA 1U6KA 4QBHA 1JU4A 1EEHA 4J6EA 3CLTD 4N0PA 5ARBA 2OPHA 5DM0A 1E2FA 3KQUA 4EA9A 5M04A 2PMCA 3QKRB 2XV1A 4OXRA 4YFYA 2HJVA 3RS7A 1AQUA 1JKJB 2YIVX 3FB4A 3K2BA 4GBJA 5CDFA 1DDOA 4UPDA 2PAAA 5C8XA 2EAUA 2P9HA 5JFTA 3OM8A 2ZSDA 1D2CA 4G0XA 4ITUA 4ZRNA 3EF3A 2O8FA 2C99A 2CLOB 2ZI3A 4C0JA 4YR9A 1YWGO 4NWIA 4OBXA 3EZ6A 4W7SA 1M2HA 1RYHA 1VIVA 1Y3CE 3HQ4O 3Q5EA 1NIJA 3JATA 2WUFA 3WFIA 4LJ4A 3ZDDA 3WZMA 1JDZA 3MSXA 4HNQA 3I37X 2NUTA 1NF8A 3IB3A 3DM5A 4I7EA 2QN3A 1CP2A 3GPDG 4BFZA 2XTMA 4H1VA 3PR1A 3R2JA 4XM0A 1AHNA 2OZKA 5E6SB 2Q27A 1KH2A 1S8FA 4G0YA 4WCVA 3NXKA 2XIQA 1AQ6A 4ALKA 5GAJA 4KLZA 2R8ZA 3D6FA 3JAKA 3I9JA 4ALIA 3V8NA 4GP7A 1KOFA 4X65B 1XSEA 2FOLA 3AB3A 4W1QA 3ASZA 5HCIA 3HP4A 1TLLA 1L8AA 4EMBA 2XPCA 1CJBA 3BJEA 2J7PA 3BK1A 4RCZA 1QRTA 3ELYA 1R64A 1JDBB 2ZSFA 4YJGA 4R0MA 3K3PA 3WK9A 3ZE1B 5LZ4A 3BWDD 3TQCA 2WFLB 3QM1A 3TMKA 4ZANA 5IW8A 2CLHB 4GKBA 6YASA 2Y68A 2ZJFA 1DCFA 3NETA 2D7JA 5CJPA 1K5HA 1Q1GA 1WW2A 2Z2KA 4JYPA 2PBZA 5I6DA 3NJRA 2G3YA 4I4TA 3W79A 5LNK6 1YFJA 2GM3A 3M6WA 4FMBB 4LJYA 1DARA 4C0XA 3RKRA 2GNPA 1DHRA 1V5WA 2WFZA 4O4JB 4XFDA 4OG2A 3W6ZA 3SZGA 4EHIA 5BUZA 3HKBB 3SVZA 4ZV9A 4DW8A 2WU8A 2WYUA 1J4AA 5I51A 4P9NA 3TQTA 2QE7A 3NMUF 3FWHA 3PUKA 1MH1A 3MOGA 7ABPA 4R84A 1V45E 2VVTA 1N2IA 1NX6A 3KJXA 3L06A 3MJCA 2CDRA 4Y2HA 5DNEA 4JP8A 2HZ7A 1CDEA 2OZLB 3QKSA 4MHSA 2G1UA 3GYBA 3ET4A 1TO2E 1TVCA 3ETNA 3HBLA 5K3SA 4EK9A 2VJNA 1KI7A 2E82A 3A11A 4L73A 2XBLA 5AI6A 4BZQA 2V3VA 1HDCA 1ONPA 5IT0A 3K9HA 3ENNA 3I4FA 4O4IA 1P7CA 5T57A 4EGJA 1G38A 5I8PA 8LDHA 5IH7A 2Q28A 2HSWA 4RWZA 1YZVA 3WAKA 4EI7A 2RI0A 4LK2A 2NYVA 3TEFA 2B99A 3BUSA 3H05A 3K0AA 4OAQA 5LOVA 4R31A 1P2FA 1RLOA 4V0QA 3ST7A 3T5CA 2PBFA 1Y4ZA 5DZSA 3GMSA 3HY3A 1VB3A 1OLOA 3C3AA 3E9MA 2H1SA 1P5JA 2V74B 2GEUA 2Z98A 1C7JA 4ZIRB 5GJVC 3ZGXA 2PD3A 1J56A 1XXLA 5I9IA 2KM1A 5L8VA 1O8BA 2OHJA 4H77A 2FEAA 3IMGA 4IOLA 4LMBA 4LNUB 4MKZA 2XOEA 1MPTA 4TKUB 4WXHA 5DOVA 5AVWA 5GZ1A 3GJ6A 5AIAA 1CU1A 1MEJA 4B83A 3HB5X 4U0JA 3HEBA 4FYVA 5DTQA 3GFQA 2NPIA 4M7WA 1W5AA 2Z30A 4NZNA 4XWYA 4ALMA 4X7MA 5KTOA 1Q44A 2Y4OA 3GFBA 3TLBA 1EHIA 2N9UA 1H69A 3GUCA 4HWKA 5JMWA 1GCIA 1V16B 2EG9A 3CEHA 4O6VA 4E5PA 3ACDA 5IDWA 1ENOA 4I1OA 4DAEA 4KN8A 3IP8A 1Y7IA 1IHDA 1ZH4A 2FPWA 1UK9A 4R2XA 4FGWA 3G2LA 1EQUA 4ZT6A 1KY5A 4RCYA 3FSGD 5CVDA 3EHDA 3OF5A 4P1ZA 2J0UB 3E7DA 4KC0A 3KYJB 1T2EA 1WABA 1KI4A 1N75A 1XVUA 1TO1E 3PHHA 1V9SA 3L9WA 4NDZA 4N0QA 1MEEA 1FMTA 1L1EA 3L8GA 2LXNA 4B71A 4HD8A 2W6ID 1U3WA 2GK7A 2IXGA 1P62B 2O57A 3E22B 3BB3A 3EFOB 5MFZA 1INLA 1SBHA 4RPGA 5ER9A 2WF9A 1AUOA 2GPBA 1Z5ZA 4Z4QA 2X58A 3K9CA 4LY3A 4MA4A 2Y1EA 4KI7A 1EDEA 1ONNA 1EH5A 4J2HA 4N18A 3U44B 1GFWA 4HY3A 1FUIA 3G3EA 2ODEA 1NZDA 3BERA 5FV7A 3FIJA 1HZZA 1W2HA 3STHA 3HCBA 1TRKA 1EBBA 2PWBA 5HE8A 3ESCA 3B6EA 2AR9A 4LKRA 3U13A 3RREA 1WCIB 1E63A 1WD5A 1QP4A 2CHEA 1K8YB 2H4FA 4AVYA 4QRIA 4NMMA 4EELA 4UPEA 5ICFA 1O8CA 2QTZA 4RZSA 2W6ZA 3EAFA 1O95D 1T3GA 3L6OO 3EH2A 2VDNB 3QVGB 4GPAA 1GM5A 3C6ZA 1I10A 2FMKA 4OSOA 2Q4TA 3IAHA 3D9QX 4IIFA 3QW2A 1QTRA 4IGIA 4KGDA 3WAJA 2PZGA 2QD4A 1PT6A 1LA2A 2QRPA 3ZY6A 4S2UA 1M1NA 1W0CA 4BNDB 1DKRA 5GVSA 1NJ1A 2ZJ8A 4YJ2B 1MDBA 2GZ2A 3Q98A 3KSMA 1O58A 4G9BA 2XITA 1V48A 1UC5B 3MFYA 2CVHA 4LY0A 4XEUA 3R7AA 2PZKA 3X2EA 4CHGA 4GL2A 2HMWA 3N0XA 2GJ8A 4Q4JB 2YWDA 4RHYA 1OI7A 3H1AA 2PRZA 4J9UE 5BWMA 1A4RA 2HREA 5NULA 4CN8A 4CLDA 3WLRA 1SBIA 5JI2E 5DK4A 2R8RA 1TZMA 3VI4B 2QX8A 2Q62A 3OLXA 3DXFA 1P1FA 4HN4B 3T94A 3O4VA 4ZI7F 5CRIA 2F67A 3QU4A 1W87A 4FJ2A 3FPEA 1O6FA 3O93A 2MTBA 1FNNA 5HFAA 2H1WA 3RYFA 1JHXA 3IP9A 3QNMA 4EPWA 5GV8A 4B48A 3SS7X 4DJ5X 2IYEA 4F5ZA 1J2EA 3K0SA 1ONOA 4DABA 3BIJA 3M9WA 1XN4A 5EINA 2A9JA 3S8MA 3RJTA 5C7YA 3AKZA 4FOOA 3IERA 3ESXA 3R3UA 3GZ4A 1JZTA 3EZ2A 4P3OA 1OYYA 2BMEA 1QZTA 4GS5A 4U7GA 5F2EA 2OGZA 3T61A 3U3OA 1Y98A 3E1KA 3CZ9A 3GMIA 4ZOAA 5A2QA 2YV4A 1K3TA 5KJ6A 2RHGB 3AERB 3BE6A 2HJ9A 3VHRA 1Q0TA 3FN4A 4EAAA 1UMDB 4MDFA 2VJAA 2ZVJA 3BX1A 3DKVA 3MTBA 2ONKA 3F74A 2XB8A 3B9PA 3LP5A 1OI3A 4FUTA 3PU6A 5CT8A 1WV0A 1P2SA 1V5EA 3S27A 3NNDA 1E89A 3CZ4A 3EY9A 3HDQA 3LLSA 4GE0A 4PPYA 2XZLA 3HCDA 1OYOA 2QLMA 1YR7A 3RS3A 3PSAA 5EWJB 3TAXA 5JDIC 3RSLA 5JSYA 3WYBA 3KQOA 2V55B 3ILXA 2W22A 3UHAA 3A14A 2HRBA 3NVAA 2IDMA 1PJAA 1ZUWA 2ZRFA 4S1VA 4JVSB 3V7FA 4QUEA 3KVNA 1TAHA 2IOFA 5DE3A 4D6PA 2NZ2A 2X1LA 4AKTA 1YUMA 1XE3A 2H9YA 2WTNA 3NHUA 5A7GA 1RYNA 1ZO8A 2OVFA 4KCGA 1DAKA 2W93A 3I76A 5HBRA 2C4UA 4IOMA 2QVLA 4P5DA 5JYEA 5LP6B 5LNK1 5E3IA 1I1OA 1QHEA 4HXFB 3BHIA 4EW1A 2LIVA 3QWFA 2Z95A 4XUEA 3OJEA 3KBBA 3Q5DA 3IKTA 2AHOA 5AWFC 5FBQB 1SJ9A 4FMCF 1FDTA 2QV7A 4HMQA 3NRBA 3UQYS 4P81A 4C0LA 1P5ZB 1ZL0A 2HA2A 3V1TC 3WGNA 3ZPXA 1BO6A 4Q9AA 2QUHA 4CLOA 1Z34A 1Q1NA 1F3LA 5TF4A 4C4ZA 5ECDA 4XWKA 1AS2A 4M3NA 5AKZA 5CITA 4EFNA 3ZK7A 3G7SA 5CLQA 3X1WA 4QLAA 5C1BA 4EPRA 2YHBA 2H1CA 3CUUA 1NTOA 1THZA 1ZOOA 1CLEA 2HMUA 4YX9A 3G6WA 1QRUA 3DR3A 3GGCA 3IP1A 4UBJA 3KEOA 2C7QA 1XP8A 1PN3A 2A7XA 1GTRA 1WF6A 1VOTA 1DJOA 3LT2A 1TVMA 3CZMA 3BQ9A 1E2LA 2Z2ZA 3L82B 4ND3A 4A8JC 3THXA 5A0VA 1WDLA 5ALPA 3CF0A 3BE8A 1KJJA 5LZ5A 2V98A 3JYLA 5CHEA 3HRIA 2BWJA 3KKOA 3LHDA 2IBTA 4KZKA 1YS6A 3DP9A 1GU7A 3QTTA 1GZ5A 3VOBA 3GT7A 1KAGA 1R6DA 2AF4C 5JPIA 4G5YA 4C06A 4DCGA 1IXKA 2V0NA 4NLLA 5JU6A 1IBMB 1E8MA 2OEPA 3EG5A 2XNCA 1RCUA 2CNKA 2CVQA 3DEIA 1R0KA 1D1TA 4RADA 3FOEC 2Q5LA 1Q95A 2R6FA 2I6QA 2WAAA 3NW9A 4KODA 4GX1A 4Z53A 3UXHA 3WQQA 3PQ7A 4O33A 5EQTA 4DCMA 3CH6A 2WNIA 2X77A 1TYCA 1II9A 1TUBB 2VHUA 3FDZB 2GBIA 1M76A 2HU5A 1GQ2A 1B2LA 3OCZA 1RR6A 2FPIA 1LVUA 4TS1A 2PV0A 2PWPA 4KN5A 5K0BA 5IXSA 4RZQA 5A4KA 3HY6A 4K1LA 1U0OC 3PWZA 5DBHX 1A7KA 5KTSA 2IU3A 2MYUA 4CIXA 3QTBA 3OQJA 1MH9A 1XQWA 3FVWA 3URKA 1KYWA 1OBHA 3BTOA 3OFKA 3BMNA 1ZPDA 1GRQA 2A9OA 2DKFA 2PSSA 1GDDA 1LDEA 2IP2A 1L7AA 2WG0A 3TE6A 3MVEA 3F2VA 4BFCA 2I91A 4DQLA 4NRDA 3HU3A 1OF1A 2AFHB 3H04A 2E4WA 1JDJA 1XDBA 1JEQB 1QGDA 2DUMA 2J7PD 1I2ZA 3RAPR 2NW6A 1YRLA 3W5DA 1F12A 3JQBC 4E15A 2A59A 2O1EA 2ECFA 2OBXA 4U2BA 4L27A 4YH1A 4AC9A 2DLCX 3D7KA 5HJ5A 2QU8A 1OOEA 2XE4A 3KZXA 4X95A 3O1JC 3RYIB 5JJLA 4Z3OA 3ASVA 1FK8A 2NUAA 2RHWA 3EXEA 3T6KA 1XMJA 3U26A 3KX2A 3OTOB 5CBPA 3PXAA 3DDOA 3D6UA 4IIJA 1S3IA 3JQ9A 3ZGLA 3BJIC 2H1HA 3EARA 5GZ6A 2HBYA 4Z4EA 1P18A 2PZJA 3RNLA 5JBIA 4YLEA 2GMWA 3V4RA 3PNMA 1A04A 3CY6A 3WIUA 1JR6A 1MRSA 5IYZF 1I7NA 2G1JA 1L6IA 3QFTA 2C8LA 1SMKA 4XUDA 4Y0NA 4B6EA 3P9ZA 5JNWA 4EJSB 1UOPA 1SKYB 5CTAA 4RK0A 2IEDA 3B2EA 4BWGA 2QE7D 4OHZA 1GNRA 1NZJA 2JAHA 4M36A 5DOZA 4ESEA 4Z5XA 5JH7B 2DHQA 4H4EA 4JSYA 1JQLB 1HF3A 4LZJA 3KYBA 5IAJA 5SY4A 4AMVA 4YPOA 4GAEA 4I4NA 5I8WA 3AR7A 3H2ZA 2JZCA 2Y1DA 3V2HA 2VSXA 3ZH9B 4YDQA 1QYVA 1ZA1A 1ZK0A 4XWAA 2W8BA 4UU0A 2P0EA 3MLBA 4R8KA 4RSMA 1DEAA 2GYUA 1TMGE 3WIEA 2I0FA 2J5RA 3MWLA 3AF4A 4FXPA 4NCAA 2YIDA 4YRDA 2GESA 4D9MA 5A04A 3QPUA 1Z4KA 1LF0A 1YIOA 5AKEA 1R9JA 4L50A 1SZJG 1L4BA 4ZODA 3SQOA 1Y42X 1MIOA 3PC4A 3TI7A 3IVCA 3RAEC 1OFVA 2OAP1 2A1IA 5IVDA 1R5NA 3RVKA 2HZBA 3UB2A 5DM60 5AW9A 4D3YA 3CCFA 3EGWA 1KI8A 5CU7A 1XRNA 3K20A 3EAGA 1I01A 2D0IA 4FHGA 3GRZA 1G8GA 2HHAA 4FYXA 4Y6SA 3KXDA 5EJ2A 2JLQA 5CXQA 1LLQA 2QKYA 3UXMA 3DC2A 1UKAA 3IXLA 3KSDO 3LW8A 1JHPA 3QLVA 1RRMA 5IHXA 3BFPA 1PHRA 2WHPB 3D0QA 4KAFA 5A62A 1EYZA 4M76B 2QAGC 1AKRA 3Q8XB 1USKA 2I6FA 5AI5A 2IYSA 2V8BA 1NM5C 4OGKA 1XZQA 2HA3A 1X14A 3FJYA 4LDRA 2WZDA 4HVTA 2PYIA 3R6DA 4HUQB 1G1AA 2O7RA 3A1DA 4ND7A 4AKIA 1W4CA 3HY4A 1X80B 3D6HA 4OJKA 2QW0X 5DPMA 1ZMTA 4YCMA 2PX4A 2Z8ZA 5BV0A 1I6KA 1ECFA 2GA9A 3IOBA 1J8FA 1OHHA 1TVEA 5FOVA 4CKCB 3GV0A 4CTMA 4YCCA 5BVGA 2H54A 4PN3A 2CZCA 2HFJA 4KXVA 7AT1A 1E3IA 2PZEA 2XQJA 4CCAA 4NXNB 1GL7A 3KYIB 4X1YB 1G98A 5A6VA 1RZVA 1YZ3A 1D4FA 2IXEA 3VGJA 5EJ5A 3WLLA 4E08A 4KLAA 2SBTA 2EX0A 1ZMRA 1PIWA 4P8RA 4H2DA 1VKJA 4BVGA 3WE7A 3O8CA 3MWFA 4PXSA 1KC3A 1ZZEA 4CDRA 2QROA 4E5VA 5KOHA 1NUSA 3VPSA 5K8TA 4XFKA 2DH5A 2Z5LA 4OREX 4ZCMA 2Y0BA 3GQBB 4EG1A 3B89A 3JZMA 1JG1A 3MT9A 5TQVA 4DA7A 5CH8A 3I1IA 2AKEA 221PA 1B0UA 1TU3A 4IR7A 3EVBA 4BS9A 1SHTX 3GJ0A 3OOEA 2C4NA 1EP9A 5FOSA 3FAZA 1K5PA 3A3KA 4WA8A 1HRDA 3H99A 3ROXA 5JS8A 4LF9B 4CEJA 2WDPA 1SRQA 4UXJA 4IIEA 5FA8A 5ERGB 4YP9A 1XDWA 1U6IA 3EIFA 3LT4A 1ZC4A 4JASB 3ZW7A 4EHKA 1A8HA 5CDFE 1M0EA 1M0WA 4KFRA 1QYXA 4FN4A 2I6TA 3R9WA 4B8YA 2WDZA 1B2RA 2JEOA 4FSXA 4FMDB 2BI4A 4K1XA 4LPKA 1DIHA 3TTWA 4DC1A 4MKIA 3VR3D 2HMAA 5EQJB 1Y1QA 2HU7A 1FYDA 3ETHA 1DJPA 5DXAA 4BGEA 3K2EA 3H2GA 4C05A 2VHVA 1EFRA 4MUYA 4XYMA 5J9FA 3UMYA 3CEPB 3DZHA 4HADA 5I7WA 1ILWA 2BGUA 4X92A 2HCTA 1C1DA 3FUXA 1E2DA 1T8WA 2QEQA 4I36A 4CM4B 3IP7A 4POOA 1CUGA 4FFDA 4XAQA 4Q1CA 2ACEA 2JZOA 1WDMA 2XJ4A 1ORWA 1IMOA 2Y2UA 4INJA 4DQ0A 4QZVA 2NTEA 2EFEB 5JJKA 3CSSA 4ESVA 4EA7A 2O5CA 1JKIA 5H0IA 5C32A 2JJ1A 2VSFA 2OGWA 1C7QA 2XZPA 3AW9A 3NTUA 3CRW1 4PXAA 2P2GA 1OXKB 2BHRA 2O2HA 3WB9A 3THYB 4TMWA 3H87A 1E58A 4GPD1 3M4XA 1ZK1A 1M0SA 2BFOA 3A05A 3AY6A 4JLSA 1RRKA 4LQDA 3IEKA 4RCVA 3VJLA 2P3QA 3CZPA 2D74A 2NTYC 3CH5A 1HMPA 3L7CA 3Q1LA 4C7MA 3W7VA 1P7ZA 5JZ9A 1T24A 3KPJA 3JD2A 5EE1A 4LDQA 1JDBC 3U39A 1ZUHA 3EWIA 3MPOA 4F0JA 2C7RA 2O8FB 3WYCA 3Q3CA 3TRDA 3MTAA 4G4GA 4BO2A 1KR2A 1XO1A 3OO1A 1WSBA 3WIVA 2VT2A 3JATB 2QRGA 4EFKA 3H16A 4J7CA 3RHZA 2LCIA 3F3MA 1E9FA 3BFKA 3R9IA 1I7SB 1ZJJA 3K5WA 3O21A 1KC1A 1RXIA 3Q9UA 4NU6A 1NR5A 1GRRA 3UHFA 2DUUA 1VL5A 2I5PO 3Q7EA 3SS9X 3BT7A 1L7MA 1PR3A 2Z0MA 3PTAA 4XLLA 4PYKA 3ZE9A 4RVFA 2RHCA 4MMXB 1T1GA 2W8ZA 3BIWA 2YJ5A 3JAKB 1SIWA 2BELA 2WJIA 2VAVA 4GRDA 4WTOA 3SSAA 4XTCS 2P6PA 1OYVA 2J67A 3V8BA 2ZJZA 3D3QA 3ZD6A 4YJGB 3RIGA 1B23P 2BEUA 2A8YA 3OKAA 3HWWA 2PUEA 1CR2A 4G2NA 4JUFA 4M4SA 1I9CA 1LW6E 1Q7TA 2GNAA 2H52A 1KARA 4LXHA 5LLSA 1J8MF 4EARA 4ID9A 1B41A 5E9WA 4I4TB 4MULA 3TLXA 2P9QA 2CMHA 1F1JA 3MS4A 4D4GA 1K4MA 4LYJA 4OQQA 4ML3A 3IEIA 1I13A 4LJRA 2ZYUX 1PGPA 3H2SA 4GLOA 2GXQA 3PI6A 1EFCA 2G1KA 1AVTA 2HLDD 3TD2A 4BJHB 1JFFA 1NQTA 3KE8A 3T1HB 4RX1A 3U40A 3L7NA 1ZK3A 2B61A 4QOSA 4TTQA 4WZAE 5E7IA 2IPNA 4LYGA 3RS5A 1KEEA 4IS3A 1U8EA 4RNDB 3UJ3X 1ID8A 2BTEA 1CY4A 1CNMA 1GSIA 2F9MA 4X5OA 3S2SA 4H27A 2JW5A 4FFMA 3W9SA 2BHLA 3GLFE 4GYJA 4NZ9A 3RUHA 4K6FA 3NH6A 4J2OA 4OL0A 1UDWA 1EB8A 3ZGVA 1M7HA 1S2OA 2NUPA 4YK7A 3SXUB 3UWPA 3V1MA 4CBVA 4F11A 4BE9A 1OA0A 1S01A 4I6JA 4O4IB 4OAPA 4I4IA 4TL7A 3RIXA 4BVAA 4MRNA 4CTOA 1TQHA 1GZ4A 4IZOA 3O75A 3X1XA 5C3MA 3I05A 1YGYA 5BW8A 2DG2A 3PC3A 1Z82A 3K0AB 4ZO4A 5LOVB 1E9VA 4LZNA 2BBOA 5FA6A 5COQA 3QPVA 4JJGA 1NAIA 4HKTA 4KLNA 4MH0R 4IIVA 4KHZA 1MKYA 4HYYA 4N5IX 1LNSA 4IJ5A 3S28A 2WVGA 4MV7A 2O0JA 3FGNA 1W0KA 5CVCA 4UU7A 4REMA 3H18A 3WGUA 1JIXA 3K1YA 4NBLA 3T3OA 1X2BA 3IVGA 1RWQA 1NT2A 3B6IA 5CYOA 3ZCSA 2ENUA 3FNRA 4OUKX 2H7XA 1XN1A 1M5UA 1OTXA 1SD1A 5DHRA 3M6MD 3GJ3A 1HZJA 4F8YA 1YL6A 2ADMA 2J5XA 3O1IC 3M5WA 2L19A 2H08A 3USZA 2PZAA 5B6IA 1N5RA 1YKGA 1DE0A 3KKNA 1AHIA 3ABQB 3K5PA 4CMEA 3UWMA 3P9NA 4ZT5A 1F1BA 5EXEA 5CDGA 2HIAA 1YDGA 1ZH6A 5FLYA 3G59A 4CMJA 2OHFA 3KM0A 1NLMA 1PEDA 1SU7A 1H42A 2IW1A 2OD9A 3CURA 3AR9A 3LYUA 2C58A 4IDOA 3JQ6A 1L7EA 3RS0A 5LMCA 1GYQA 1IEXA 1N1DA 1TB4A 2QM7A 4K9KA 2XKJE 4KHPB 4JBIA 4ZOBA 1T36A 4U2GA 3RVJA 4DLLA 1DO0A 3PENA 2PFKA 1RPJA 3ROTA 3QVKA 1GA1A 4IHQA 2DOKA 2NXNA 4H4CA 2J32A 4WJKB 1GDTA 3TIVA 1U2QA 3KOMA 2F8TA 2G6TA 2WVAA 3VU0A 1X15A 1E3LA 4X63A 2G0NA 3U0BA 2O52A 1JDPA 4ER7A 2KQUA 1B93A 4HDRA 4PQGA 4K2HA 1BDJA 2BFWA 3IR5A 5C8YB 1WCYA 4H9GA 1D6SA 3REOA 5MN6A 3O8NA 2B0JA 2CXPA 4GWGA 3RRXA 2FZCA 1XVIA 5EMLA 1YCHA 1GQYA 2J45A 2XT0A 4KQXA 3G7UA 4BN0A 4RANA 3I5AA 4GPTA 4OLBA 1YL7A 4XPIA 2N75A 5AKLA 5CPFA 2HRQA 3JPYA 3IP5A 4JP1A 4BIMA 1ZJYA 3C5HA 3CLTC 3F9CA 4MJXA 1N1MA 1NTRA 2HRDA 3PYMA 3CG4A 3LYLA 4IRXA 4H35A 3ZGNA 1ST3A 4ZCSA 2FN8A 4J76A 5ICMA 3GU3A 3KFLA 3CE9A 1TTHA 1QF9A 3WL6A 4JBHA 2D54A 2DT5A 3ZK9A 3RBZA 2AQ8A 1X8KA 4C4XA 1Z4OA 1JPVA 1TQ2A 3UB4A 3VR4A 4F93B 5AK0A 2HA6A 1M1NB 1R8JA 1XTUA 3CNNA 4BTVA 3D8RA 4GNRA 2AUMA 3KEQA 1P7WA 1VJTA 2GYVA 2AN1A 2CVOA 2IKSA 3DD5A 3GHHA 1P45A 2ZGVA 3ORFA 2HD4A 2M2IA 3AETB 2VK8A 2YXNA 3GFSA 2VTVA 4ZQCB 3R5HA 1O08A 8AT1A 2CJYA 2YVKA 1QE0A 4OOFA 4JA2A 1QAQA 4FS8A 3MTQA 4NCXA 4F5EA 1GQOA 1Y4SA 1JHRA 1DQPA 1TQDA 1ULZA 2A5JA 3WO0A 4YRBA 2QTMA 3DNMA 1IEQA 2YICA 3L7OA 5A5DA 1G5QA 1AV6A 5EMNA 1U3FA 1ENZA 2VP3A 3VJMA 3WJ2A 4YYEA 1QIJA 1J9ZA 1YKFA 2JGKA 3F8SA 5AOVA 8GPBA 3BJRA 3AR4A 3UJ7A 3FCXA 3K0BA 1ORDA 5JSHA 1QFMA 1DAOA 1JXQA 4D9EA 2P5TB 5K8VA 5K8CA 3SF8A 3HUDA 4A0HA 2PRYA 2COKA 2VXOA 2Q4DA 3NRCA 3ZBPA 4EG0A 1UKVY 3T4EA 1S4MA 1J24A 4KH1A 3UH0A 1H3EA 3C1AA 1BW9A 2FNAA 1G5IA 3JWPA 4HRYA 4LOIA 4MJ7A 4WCFA 3LQYA 4LFCB 5ELLA 1E5VA 1XMPA 4H1UA 2QSYA 4F3RA 4JV5B 4IX9A 2C9DA 3MMPA 5LP6C 1CIVA 2QG9A 1RZRA 2YCBA 1F2UA 4A73A 3HMKA 3OE5A 5LQKA 1X9IA 1I1QB 3M5CA 1WKVA 1ADBA 3NGXA 5C80A 3ZHSA 2HWWA 2ZRHA 2D5AA 1OHHD 5JHGB 3TUZC 2IKQA 4JC0A 1QTNA 2ZIUB 2A9FA 4KB5A 1ECBA 3VXKA 2AE1A 3DB1A 4IPTA 2ZYHA 1QHYA 4D4KA 4MW2A 2YHSA 1J8VA 1WMEA 4H7KA 4UHHA 1UBMS 1WCWA 5DP1A 2Y9PB 1ZQ1A 3DOIA 5AK5A 4E4RA 1MW9X 1A2BA 4I6EA 1C3OA 3ZVNA 3AJ9A 2XGGA 1A9PA 1HFJA 3OOJA 1V8OA 3ZDZB 1W4AA 3D4OA 2DC1A 2DFLA 3BHNA 1U0EA 1ZJ5A 2ZRMA 4QECA 2VAMA 1QGYA 2FUKA 3GFVA 1TYBE 2F6RA 4Q4DA 3C16C 5HMLA 1DAMA 3ED1A 1DAFA 1HPLA 2OV1A 3C6QA 3MQFA 4F3CA 1C8BA 3WICA 4K28A 4L51A 3HBAA 3JX9A 1C30A 1KZ1A 3AFGA 3BXZA 3RSCA 3W6NA 5AHOA 2VL7A 3CLSD 1JPNA 3L5OA 4OGWA 3KTAA 4CODB 1U99A 4QT0A 1Q15A 3MIZA 4K2AA 1L5QA 3TNYA 2V7QA 4RZXA 4CTNA 1H0SA 1K7XB 2R66A 3L6DA 3WYAA 4KN9S 2PEZA 1W29A 1JG6A 3CW2A 2DQSA 4WK2B 5JD3A 2R5NA 4B3BA 2WFAA 2XCIA 4B45A 1P3Y1 1ZVJA 4JH0A 1TM1E 1D09A 1J8YF 3DFKA 2C3UA 2IDJA 3LUDA 3V8QA 3WIOA 1IPFA 3ZWVA 1N6NA 3I04M 1UOQA 3TRHA 5C5EA 4KPFC 5ESWA 3ZLTA 4H31A 1QS0A 5ALXA 4AF7A 3H3FA 3HFRA 4Q7JB 4F04A 4Z51A 5MGNA 4KXMA 4ND6A 4CUZA 1EFRD 1N5IA 2FUG6 2R1VA 4NK4A 1A77A 1DRKA 2CFCA 2GVNA 3A10A 2Q6TA 4KGXA 4KUGA 2CUKA 4JLAA 4L0DA 4PNHA 4E3ZA 4K26A 1U81A 2H65A 5AFSA 1FCJA 2QTCA 1KDTA 3GAZA 4FBGA 1MJGM 1Z5UA 2VP6A 4FZ5A 4WCDA 4W6ZA 4M0UA 2BGGA 1GQFA 1TGVA 1Z75A 4EG6A 3ME5A 2NXCA 3GFGA 5DASA 2V6GA 3I09A 4P34A 4OH1A 3ECAA 4JI5B 2JJ1D 3IBFA 3IXMA 3LQ4A 3PP8A 1J7KA 4YP0A 2M6KA 3PE4A 4FIZA 3WLHA 1EJ0A 4G67A 5EKUA 4PQRA 2WOJA 3LX5A 5K8JB 1RYEA 4A6DA 1TO6A 1QTIA 3OY7A 3QLUC 4MQBA 4UAGA 1N57A 1DBSA 2J33A 1OTYA 2OM6A 3V8MA 4BMNA 5KNCA 4HH3C 1X7YA 2ZDQA 3M7IA 3VR6H 3JAMA 1JR3A 2WE8A 2EZ4A 3DDCA 1ZD8A 4Y2TA 1T2UA 2CL0X 2PLRA 1P33A 4PHGA 5SY6A 4TV8A 1GAWA 2A5LA 1P19A 4WV3A 2G5TA 2CBGA 3I1JA 1U02A 1U2DA 4MO9A 5TGTA 1JA1A 3RRJA 3PI7A 3OCCA 1IBSA 2PLWA 3BMNB 1O5OA 2I2BA 3TRJA 5FH9A 4OK3A 4ZKEA 3FSEA 1NFFA 3G49A 2YUIA 1O95C 3UOWA 1C41A 2FMHA 5A0FA 3BMCA 1YE8A 2PUVA 1SCKA 2CXNA 4Z9YA 2JI6A 3DOJA 1K6XA 1WCXA 4BATA 3P52A 3PCXA 4L9RA 2OCGA 4EJSC 5L3QA 4BO8A 3MM4A 4I4LA 5ALFA 1O9HA 2FPLA 2CYCA 5KMGA 2EFHB 4BNLA 1TFRA 1A98A 1Z47A 4DMLA 5J23A 3LTNC 4YCAA 3R7LA 4MV5A 4CXMA 1M2KA 4FOSA 4RV5A 2OHGA 3ZI0A 1NFRA 1R9MA 2RI1A 1DX6A 3EXEB 5FJIA 1LJUA 2UUBB 4XA8A 5CBPB 2AF3C 2FEOA 2VWHA 3GCWA 4G1EB 1R74A 3IEXA 3RPEA 3LFTA 4ZV7A 5KYUA 4YPFA 3E5NA 1V0JA 4GKAA 5BQXA 4QOEA 3HJBA 4QAQA 4Y9SA 2H2FA 1UBUS 5GP1A 1LX6A 2DFKB 5C5CA 3QSGA 2IELA 5CG2A 1NDUA 3OT1A 4Z8XA 3L0YA 1JZSA 2JIBA 3GLQA 5IHPA 3C8MA 4K0RA 1P81A 1VE9A 5JLAA 5HZGA 4WECA 3UGKA 3AF3A 1KO4A 5KNLA 3AYZB 5DSXA 1Y5MA 3CKKA 3UCXA 3VR2D 4RQTA 5GGYA 1IXSB 1PT9A 3X3HA 2VAXA 3SQWA 3I32A 4Q7EA 1A95A 1BE0A 2PJDA 4QPPA 1EBFA 4D6XA 1MIOB 3ANTA 3ZVLA 4PSDA 3M6XA 3PFBA 1A3CA 1SUSA 4QGHA 5EE0A 1EUDA 2ANCA 2ODQA 3RC9A 1CG6A 2ERYA 3AV3A 3DEHA 4GOLD 5K1ZA 4P83A 4YHBA 4ACAA 2Y6UA 2O2XA 4F1JA 5FOQA 2VQ3A 1T8RA 2L2QA 3D3WA 3LDUA 3M4ZA 3T9DA 3TE7A 2UUPA 4ZJYA 1JIJA 1V1JA 1HO3A 1YU9A 1EMDA 4NS4A 3TXXA 1QE3A 3DE6X 2J9YB 1OBFO 3D6NB 3NKLA 4YTEA 5KQSA 2NSJA 4D96A 5I7VA 1Y81A 3WR5A 3W78A 4EFLA 3BGOS 3TBFA 1E7RA 1R8XA 3O1LA 1LLFA 1PVDA 4L6CA 3OHPA 2C5HA 3F73A 3RU7A 1Q74A 2WJ6A 1C8VB 2VSQA 3C7AA 4BMYA 3PFFA 4PYRA 1LC3A 1NQVA 3ZCVA 1QK3A 5CCBA 1ITZA 3EQ7A 5DBOA 4W9MC 1CUSA 2DQ4A 2ZWPA 3ZZ0A 2Q8PA 2XT6A 4CMBA 1FVHA 1PJ8A 3AU8A 4QUIA 3K16A 1LS1A 2NPOA 1GQQA 1N2CA 1N9KA 3WHIA 3A6PC 3T9EA 1MG5A 2AX4A 2DULA 2OCLA 4QPCA 5EIBD 4ZMSA 2RHHA 4BUZA 3Q8KA 2X1VA 3KUDA 1KXJA 2ORYA 5EZYA 3WLJA 3M2TA 3WFJA 1A8UA 2WYHA 3OSUA 5BVGB 3B1VA 4Z4IA 2NQ8A 1LI4A 4MAMA 2RHDA 3IEMA 4NAUA 1EFVA 1JU3A 2ETVA 2YS7A 4U63A 1Y37A 1GLVA 2EWWA 4M9SA 1M8KA 4IJKA 5KI6A 4FUQA 3WJAA 5ICEA 1UBLS 2FEMA 2RGAA 3RWBA 2A57A 5KOHB 3FVVA 3R40A 3G2JA 5GGXA 2LE0A 4JI8B 1N4DA 2GZ1A 5C37A 3MT8A 4QJ3A 4LXTA 5AJYA 1G17A 1E1CA 3D4PA 3RRNA 4MW0A 5K3EA 1MZPA 2X3UA 3SP1A 2IY7A 3T7EA 2WJ3A 4CG0A 4HXYA 5ICGA 1T3TA 2WD8A 3IR6A 1ZD2P 4PAOA 1KK3A 3DZKA 5HP4A 4OB6A 4ZQHA 4PZUA 3WQSB 1WZNA 2IRWA 4BBJA 4GSKA 9ATCA 4EHLA 4IDBA 5JO0A 2WUEA 1E99A 2PO7A 3ZWQA 4X41A 4EM6A 1XPJA 5ALOA 4JC8A 4ZHQB 3IUJA 4D9CA 4CEJB 1P9NA 2TRSB 2PLNA 1VCHA 2LPMA 2SECE 3G0IA 1FMFA 4EHHA 2GAIA 3EZGA 3QU5A 3VBCA 4GNKA 2GRJA 2H5LA 2PT7A 4IJQA 4Q7MB 4QTUB 4J2TA 3ZHRA 1SXJA 3A6EA 5I4IA 2PZMA 3KXIA 2B8JA 1T5HX 1KJ9A 1EB9A 1L3CA 1EK5A 5GONF 3HYSA 1RFLA 2PGXA 3HI4A 1TKAA 3A4LA 3H4IA 3GFFA 3MGCA 3QE2A 1AV7A 1J00A 1DCMA 1N9GA 2FVXA 4YT2A 3B1FA 1DC4A 3C3CA 1Y8AA 3G5MA 3GPIA 4MUGA 3UHJA 5CA1F 3FNEA 2OK8A 3X43A 3VR4D 1NJ8A 1XV5A 3R3VA 1FRQA 1GUFA 2EW1A 2QRJA 3AGPA 5FO1A 5KSYA 1BYIA 1C1DB 2A88A 4HZGA 1FP1D 3NBFA 4FFLA 3D7LA 3EVCA 3HXPA 5KTKA 1IHOA 4NCHA 2FJPA 4BRUA 1LDNA 1MABB 1YJCA 3V7YA 1NBWB 3D1VA 3RRZA 4BO1A 3VNAA 3RC7A 3IULA 3ONDA 2FUG1 1JFRA 3R9XA 2B6NA 2NZUG 3AIIA 3EG9A 5AKHA 3V9PA 4EKNB 1NG1A 1T2AA 1ULTA 4WX2B 2H3EA 3FF4A 1YA6A 2NADA 3GFRA 4Q1FA 2VH5R 5D86A 4HTAA 4LXGA 4FDMA 2M9MA 3UHPA 4EJ0A 4GQAA 4EUNA 3QK7A 3UFBA 1QH0A 2WUGA 4AF8A 5TDHA 4JU9A 4H6XA 3W5HA 4RD6A 4TZTA 9LDBA 3ZKWB 1DBVO 3V2IA 1IL0A 1O77A 4DMRA 1OCEA 4I99A 2PXXA 1OU4A 2V0CA 3FPAA 4HEQA 2GM5A 5JYBA 5K0FA 2IHYA 1RLMA 2PBLA 1VM6A 5J59A 5B4TA 1C4KA 1GDHA 1G7CA 5CT9A 1ZCZA 4FE7A 1BD4A 3QQ5A 5LBUA 1X1EA 4DJTA 1IQPA 2BFEA 1P4RA 2W98A 4EAQA 3BD8A 1QR2A 3G8YA 4D74A 1VQ1A 3CNQS 3RVLA 4UUPA 4QBTA 4K7JA 4K6OA 1XZBA 1L7VC 3FB1A 3D5EA 3FLEA 3V1LA 1DG1G 1EXNA 3FOZA 4JVNA 3SQMA 3NX4A 4HEJA 1RZRD 3JVUA 4RUKA 1SBQA 2C78A 2J4FA 4GPEA 2JG3A 4EGCB 4O2LA 3SFTA 2R6DA 5H8WA 2QM3A 5A6SA 1KY4A