2I59A

Solution structure of rgs10
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
138
structure length
138
Chain Sequence
b'SMQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of G-protein signaling 10
publication title Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 42
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00615 RGS Regulator of G protein signaling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2i59A00
1IAPA 2DLRA 2A72A 2I59A 3C51A 4WBOA 1ZV4X 3AB3B 1SHZC 3T8OA 3CX6B 4YHJA 4L9IA 4WNKA 3C4ZA 4IGUA 2ACXA 2PBIA 1HTJF 3CX7B 4GOUA 2ES0A 3C50A 3C4XA 3QC9A 3C4WA 3CX8B 4PNIA
chains in the Genus database with same CATH superfamily
5ABEA 4DR6T 3B13A 2Z6EA 2I59A 1IZNB 5JDNA 3AEDA 2Y8DA 2VURA 2VKJA 4E7SA 4EOZB 3WAJA 1LVKA 1NAFA 1ZHCA 3NWIA 3O9XA 2XQ6A 3SFEA 4HKAA 2PTFA 2CXLA 4WBOA 1VCSA 2UXBT 3HL6A 1IJ5A 4H9OC 4EXTA 4JI4T 2X9YA 3AEBA 2H7OA 2MAWA 2W63A 3DJBA 2VKHA 2CM0A 4U33A 5ADXL 1BR4A 1W9RA 2BG9E 2EHOB 3EDVA 4IHJE 5HCMA 3ONJA 3NKZA 1HX8A 4O4JE 4IIJE 5LGNB 4LFCT 5FVLA 3KBUA 4U3CA 3KV4A 1QUUA 2CHNA 1LKXA 2ACZA 3TLTA 4B3RT 2YDSA 4LF7T 4HFDA 1ZEEA 3AE4A 3UUMA 1X79A 3RH3A 3IHRA 2W62A 3O1HA 3UULA 4BAYB 4LF4T 3AXJB 3AA1B 3V5UA 2VKOA 3FBZA 4B3MT 4UV8B 2JMKA 1N32T 4DV2T 3FHNA 3SOLA 5HXRA 3FXDB 3Q5XA 4YSXA 5ABFA 4GK0E 2IDOB 2QGSA 3AVRA 2E8IA 2WB5A 4Q25A 5L3DB 2V7KA 2UU9T 2WP9A 2OLTA 1W0AA 2XZEA 4IE6A 1MNEA 4EV6A 3PUAA 3F2EA 5HWYA 4HFIA 3N5LA 1T8BA 2A72A 1XDPA 2LSKA 3P4RA 3CIRA 3AE5A 4QX7B 3Q5DA 3ZEFB 2LSIA 2YINA 2XM2A 2XQ8A 3KVBA 2XPKA 2WWVA 3ESLA 5J2TE 2HPJA 4UF0B 3AB3B 3LK42 2IC9A 5A1LA 4ZHQE 2E5VA 4J2CA 4KMCA 2HN2A 2P9BA 2PBIA 1D0YA 5HEUA 5LG3A 5GONE 1IBMT 1IJ6A 2Q9QA 2UUBT 2HH7A 4IREA 1OEDB 3MZKB 4JI3T 4XZCA 3TLVA 4EIWA 3QNUA 2X9XA 1HTJF 3ANWA 5AQPB 4IE7A 3ZPOA 3AA7B 2VL8A 4DUYT 3UU6A 3QOFA 4DBRA 1MMAA 2IIUA 3AAEB 1CHUA 4PJMA 4H9QC 1HS7A 3C50A 4DR3T 2XQ3A 5IYZE 4LMKA 3NRYA 3GN5B 3IA3A 4MALA 5HEHA 5KXJA 2HN1A 3UT5E 2XHEB 2VB6A 3QK6A 3NVOA 4CI2B 4X1KE 4ILUA 5HCJA 1D0ZA 4OHFA 2VWAA 3NBXX 5AQHB 2DWKA 3AAAB 1MMGA 2FJAA 3I0OA 3RYHE 2E5LT 4WNKA 3B5MA 4AQGA 4YXDA 2W61A 5F3JA 5C8YE 4A98A 4JI7T 4YJ2E 4EB6E 2XJ7A 2L3LA 1WYBA 2EHOA 1U5PA 4CXWA 5C2TA 3PUYF 1UK5A 2JMHA 2RA1A 4AXPA 4U2YA 5J0ZA 2NTYA 4JYAT 3OTOT 3AE3A 5AQVB 5AQQB 2Y48B 4HWFA 4HFVA 4GOUA 5F5WA 3AXJA 2BKPA 4IDNA 2X9WA 3O1IA 3PJAA 5KMGP 3AA0B 4BJMA 4PK6A 2XTLA 3PUZF 1OWAA 2WZIA 2LOPA 2SPCA 4JEHB 3ZLIA 2V5DA 2LHRA 1W09A 2E9XC 5L3FB 2KLQA 2CEAA 4MHCA 3VR8A 2XAQB 5CJ5A 2K48A 3AVSA 3WI3A 1T7SA 1T72A 2JRKA 2CBJA 1KEYA 4JI6T 2V5CA 4HFEA 2ZM6T 3CKDA 2FJDA 4G63A 5HXSA 5FY1A 2WS3A 3UFGA 5J2UE 2CPTA 1U4QA 3GWHA 2W00A 2F4VT 4H63H 2CMRA 2KSRA 3OKQA 3D0TA 2N9DA 3P4SA 4EZ4A 2ZM0A 2C5IT 2V6YB 3CX7B 4DBQA 3ZMZB 3ZYKA 3C4WA 2CXFA 4OX9T 4DR7T 3A8YC 3A5XA 1N33T 3P7IA 4AKRB 2RPAA 4ANJA 4AKGA 4WYVA 1MIWA 4AKIA 1Z0PA 3R6NA 4AQFC 2L8KA 2WCAA 3K3OA 4YLHA 2X0HA 4ISSA 3BK9A 2LKHA 4UVBB 2M6IA 4K0KT 3AE9A 4HFHA 2WAUA 5LP6E 3LDQB 4JBWF 4AKLA 3MXZA 2KNDA 3GN5A 2J47A 2DCFA 1FEWA 5E0OA 4O4IE 3P50A 2X66A 1WYCA 3PUWF 3X1DA 4PJJA 2YU1A 5JTGA 2LM2A 3TLWA 4ISTA 4TUYE 3VU7H 4DUZT 2Q9QD 3FB2A 3IBPA 5LCYA 2IW5B 3L39A 1XZYA 2BG9C 4QXBB 1LVFA 2YU2A 3TLSA 2RP4A 3CQCB 2X51A 3PU8A 2IUBA 4M1PA 3KV9A 2LHNA 2C5KT 2JQQA 4EGWA 2NW7A 5JREA 3G06A 3HI2A 3ZKRA 3J7Yq 2IAKA 4I0UA 4DR4T 1YXRA 4P1NA 2WDVA 4IL4A 2WMOA 4CN6A 3RQUA 4UR9A 3ONXA 2YN6A 4BJNA 3F57A 3HR0A 3AEFA 1NEKA 3Q5WA 4JI1T 4QXCB 4YTPA 4ZI3D 4HWCA 5HEGA 1KFYA 4U74A 4A5XA 3ZC1A 4U2ZA 1FIOA 3EAMA 3AE6A 5EZYE 3C64A 4NIQA 5JDHA 3DTOA 2N1GA 1YQ4A 3RIUC 5DABA 2X0YA 5AQGB 1E2AA 4O4HE 5AQOB 2K5BB 2XAFB 3MJXA 2LSJA 5LNKA 3UQ7A 1WR6A 1FMVA 2CBIA 1B7TA 4TV9E 3K1SA 2BDEA 1D1BA 4EAHA 1G73A 2V7JA 4DVDA 1AJ3A 1SUMB 4Z90A 4OYJA 4JI5T 5ETWA 2LLYA 3CVRA 3QB5A 2EHOD 3K3NA 3AECA 5LBQB 5JQGE 3ZC0A 4YT0A 2NP9A 2MYSA 5FY7A 3RC3A 2IHR1 3N9MA 4IDOA 2ES0A 2V7MA 2IMLA 2VKDA 3K3QC 2KMFA 3RYFE 2V7IA 3C51A 3LJCA 3K8PC 3ZJ2A 3UUXB 5BR8T 2JPFA 2V6YA 4ADZA 2OA5A 4IE5A 2CLYC 4GKJT 2YK0A 5ABGA 3ZN1B 4PNIA 4X5TA 1KK7A 3L09A 1E1HB 5L3GB 1N34T 3ZT6A 2K3WA 3OYZA 4EYUA 3AE1A 2WWUA 5HWXA 3ZJ1A 3PUXF 4IDZA 1XMQT 3RIFA 5L3EB 3QC9A 3UTKA 5L2LA 3RX6A 3RIAA 3RRCA 2GK9A 1HNXT 4NUUA 2BVMA 4I50E 3RKOA 2K9AA 2WU5A 3C98B 3LG7A 3N9NA 1KNRA 4EEDA 3OPCA 2XM1A 3PTRB 4DV3T 1VCTA 1OXZA 2V26A 2LM9A 1XNQT 2LRLA 4U7YA 4Z8XA 3SRZA 3PU3A 5FL1A 5LGUB 1OEDC 2CRBA 2WSSV 5FMNA 3OBVE 3RI5A 2DL1A 5HEJA 3CQXC 5CGMA 4KP3C 2NTXA 4K0UA 5M4YA 3E22E 5H6RB 2V1DB 3PUSA 4X65T 5DQWA 3U78A 2KT9A 4HWIB 5JDFA 4X66T 4WZXA 4H63V 2B76A 4EYYR 5CFBA 5AQSB 3ZN0B 1L0VA 1YKEB 2D2SA 3QB5K 2BG9A 3MK7C 2V6XA 1OEDE 2MTQA 4OK0A 2WBLA 4KBMB 4IDQA 1I94T 4F6RC 4HGAA 2W2UA 3CPZA 2C0SA 4NUVA 3FZMB 1E7PA 1NWMX 4HEAA 4LF9T 3CK6A 5EK2A 1M7KA 1X9BA 4GYSA 3UUBA 4U72A 1WLXA 4U31A 3ONLC 5JDMA 5L47A 2BS4A 4X62T 2D0UA 5LMNT 1G8XA 4DR1T 3P4WA 3BQIA 2DI4A 2V7LA 4IE4A 3RYCE 2CCQA 3VKHA 2LE8A 1BR2A 2UXDT 1QSDA 3PE0A 4O8SA 5DQVA 3TKLB 5L4HA 4E7ZA 4GK5E 3W15B 2A3DA 3J9X1 2DHRA 4PJLA 2VQET 5FXWA 3ETVA 4QHOA 3UU4A 3ZCJA 1SE7A 2MOZA 3VRAA 2G0UA 1HX1B 2BS3A 3ZT7A 3E08A 2CA5A 1NENA 5TAOA 5JVDE 3UQ4A 5AQLB 1HCIA 1Z8UA 4ILAA 1W0BA 2VVSA 1I6ZA 2UXNB 2LOSA 1YD8G 4COFA 5FKYA 4AISA 3CX8B 3PURA 1MMNA 3JAFA 4DNDA 4L5GA 4IT4A 2XQ9A 3IEEA 2E9XB 3JAEA 2NR4A 2WY2A 1N36T 4JI0T 1HR0T 2DNXA 2XQ4A 2E2AA 2UUAT 3LBXA 4PW8A 4JI2T 5FNVE 4UVAB 2H7VC 2XQ7A 2VK9A 3HKBE 5JR9C 2JIWA 2ZLYA 3ZMSB 4EZHA 4DR2T 4F8HA 4YHHT 5BMVE 4NPPA 4PFPA 4B3TT 2VQFT 3OJAA 2PG8A 1DU2A 4ZZCA 4A56A 3EABA 2K24A 2FJEA 5HXEA 5FL0A 3O1JA 2VASA 3ZMTB 5J1GA 4KI0F 3KBTA 5LHGB 4TWDA 4HFCA 2ACXA 4H9SE 5FXXA 3JCFA 1MIYA 3AA6B 3RRWA 1UURA 1SA0E 3MACA 4DMVA 1IAPA 5AQJB 2KXPB 2J1DG 5CB4E 4LFAT 2JQHA 2BVLA 4PK4A 2XAHB 5LJMA 3MA9A 4B3ST 4WW0A 5KX5E 5DJQC 4A97A 1D0XA 3ZYMA 4JLEA 3AAIA 1D1CA 5HYAA 1J5WA 4LMJA 3SS1A 4H9RC 2ODUA 3JC6D 3M65A 3AE7A 4XAXB 4ZI2D 4TZ4C 3AE8A 5FXZA 5HXCA 3ZMUB 3N9PA 3R84B 2Q9QC 3Q2MA 3HKEE 3ETUA 5HEOA 4QWNB 4KUMB 2FJBA 4DV1T 3A7MA 4U7IA 3LK2B 3T8OA 4TN7B 4CN1A 4DR5T 3RKGA 4L9IA 3EDUA 1T98A 4YSYA 1WCRA 3KVAA 4TV8E 4UVCB 3WAKA 3I9YA 3AE2A 4IGUA 5L3CB 4ZI3C 2BG9B 4MFRA 1Y01A 4UIGA 4CI3B 2LEHA 4FJOA 3PV0F 1CUNA 1ZOYA 3I9WA 4I55E 5LB7B 2L9QA 4ZZBA 3FZLB 3ZYLA 3UUNA 1HF8A 1JNRA 3PUVF 3TLUA 1UGOA 3KFWX 1WFDA 2A2FX 4DV6T 1MIVA 3GA8A 4PK5A 2UXXB 1UX4A 4KHPT 4C90A 3L3PA 5IHYA 1BR1A 3KINB 3O4XE 1YQ3A 3HKCE 1SHZC 2YOEA 4TWHA 2LKGA 5CA1E 3L8RA 2I6HA 2NWBA 2EHOC 3P4PA 2H3RA 1J5ET 1HNZT 4AQYT 4MBQA 5LGTB 2N2NA 3UU5A 1HG2A 4HE8A 3EVYA 2W66A 4YY3T 4H9PC 2KWHA 4PJNA 4Z91A 2ZM8A 4TNWA 2CXDA 4LF5T 2E9XA 4X1YE 5CA0E 4TWFA 4LFBT 2IC6A 2XQAA 2M67A 4G2AA 3FZFB 3E0ZA 5FVKA 4ZOLE 2X9HA 3HKDE 2XSBA 4YTMA 3N9LA 2HHHT 2Y6XA 2AE9A 2XY8B 1XMOT 2X0LB 4I4TE 3RQWA 4CI1B 2J4GA 3VRBA 3NZQA 2LRKA 5JDQA 5H6QB 1J1JA 3N9OA 4YHJA 3RF1A 2JQKA 3EI0A 2D9DA 5JR9A 3LK3B 4X64T 3HA4A 4HTEA 2YEVC 3C4XA 4QX8B 3LBXB 2XAGB 1S35A 3RC8A 2XASB 2QVAA 5JH7E 5HXHA 5LG4A 4GIWA 1VRBA 2CLYB 1ZV4X 1R8IA 2QRXA 3Q5EA 3GMIA 2C5JA 4TNVA 5LHIB 2XSAA 2YDRA 2KZ7B 4QH5A 5JRCA 2YDQA 3ZSSA 1MMDA 2DLRA 3AEGA 3PUQA 4UELA 3I1AA 3PDYA 5EK3A 4YTNA 5LA6E 2ZMAA 4NXNT 3N2OA 3B57A 4AQFA 2YKSA 2WM9A 4ILBA 1IBKT 4ASKA 3KV6A 1Y64B 3ZMVB 3UU3A 4P0BA 4ZEYA 3RPUA 3ABVA 3UFEA 5AQKB 4QXHB 4ERRA 2VVNA 4QH1A 3M3ZB 5L3BB 1FJGT 2BZBA 3EUHA 2W0GA 3PJAJ 3RLFF 3CQGB 5LYJE 4JV5T 2KINB 4HN9A 5AQNB 5F8PA 3ZSTA 2W4XA 3QUJA 4LF8T 4NXMT 4HWHA 4CN4A 4GKKT 4DV7T 4B6XA 4GYRA 2PFVA 4WBNE 2ODVA 4X1IE 2NOXA 4DV5T 2XAJB 3F31A 1LRZA 3P8CD 1O3XA 5AQRB 5LHHB 2UUCT 3FZKB 1UCUA 1XNRT 1XDOA 4ZXLA 2X68A 2LSYA 2DWGA 3SWHA 4DMWA 2WZHA 4BA9A 2LT3A 3N9QA 1QLBA 2CWOA 2W67A 2BBJA 2HPLA 1FMWA 2D0TA 1XWMA 1BR0A 4V1Av 4CXYA 3VR9A 2BKOA 2PJQA 3H3MA 4AKHA 2KWIB 4UXNB 2QA7A 4EEBA 3RIUA 1US7B 5LJNA 3N2GE 3MKDA 4CQIA 4JUYA 4ILCA 2AXDS 3RHWA 2M6BA 5HAXA 2QYWA 3CMLA 1WRDA 3CX6B 5AFUL 5EK4A 1WR0A 3H3AA 2X67A 3KDSE 5L4EA 4YJ3E 4UV9B 2OV9A 1D1AA 3BQLA 3P4QA 4QH4A 4YFSA 3LSVA 4KX6A 1JNZA 5LOVE 3ZT5A 2FBWA 3I0QA 4KHZF 2WDRA 2NW9A 2XUEA 2MPKA 1ZKEA 3OVUA 1YKHB 4DO0A 2BKNA 3FXEB 3NZPA 1IBLT 2JQ9A 2LSGA 5LMUT 1V9DA 2JJ9A 4I43B 3KV5A 2XQYA 3C4ZA 2MBGA 1H7CA 4AIUA 1UX5A 4AI6A 2XQ5A 4O2AE 3OYXA 2BBHA 2WDQA 2BS2A 5IUXA 2NW8A 3VKGA 4C91A 3H37A 5ABHA 5JR9B 2H89A 3FZHB 4IE0A 5AQUB 3N2KE 4N78D 4PFOA 4O2BE 3Q9DA 2E9XD 5ABFB 2J62A 3BQKA 4H9NC 3NRXA 1YW0A 4CZZB 3DP7A 2D5UA 3T1HT 1S94A 1HNWT 5FP3A 4HFBA 1KNPA 4JI8T 3T1YT 4JEUB 3UU8A 5FYMA 3RYIE 3JC6C 5JDLA 4OYKA 3V5SA 2ZM2A 5FY0A 4ZI2C 5JDGA 4LF6T 4MLKA 5KDMC 4IDPA 4UF0A 5JRCB 2CE7A 3FBLA 5IWAT 3CWZB 3AEAA 4P09A 4TX5A 3EHZA 2WMNA 3JADA 3VHLA 4CXXA 5AQMB 1OEDA 2UXCT 2VL0A 5LXTE 4DV0T 1M62A 3U3IA 5LBMA 5AQIB 4OFZA 3RGLA 4ZI7E 2CHOA 4LMLA 4UEMA 4DV4T 5AQTB 3AEEA 4PAGA 4ZS3A 3ZCIA 2V8SV 3SFDA 1KNZA 4P0AA 5C3JA 4O4LE 4HWDA 3S4UA 2Q9QB 1HG5A 2R6GF 4ZS2A 4IL9A 4XBFB 5AQFB 2CWYA 2WQYA 1EZ3A 1KF6A 4L0RA 3ANWB 4QKNA 1GQEA 2H88A 1MNDA 3LFMA 3PUGA 4DIDB 2A9UA 4FI5A 2WU2A 4X20E 1VOMA 4YSZA 2LJLA 5FXVA 3IF8B 1HFAA 2I0MA 2B1EA 1ZP0A 2FUPA 1UUSA
chains in the Genus database with same CATH topology
3CPZA 5JH7E 5HXHA 2CMRA 2C0SA 4NUVA 3B13A 5LG4A 2Z6EA 3OKQA 3D0TA 4GIWA 1VRBA 2N9DA 2I59A 2CLYB 1ZV4X 4EZ4A 2ZM0A 1IZNB 2C5IT 3GMIA 2C5JA 1NWMX 5JDNA 4HEAA 2Y8DA 2VKJA 4E7SA 5EK2A 5LHIB 4EOZB 3WAJA 1LVKA 1NAFA 3CX7B 4GYSA 4U72A 4DBQA 1ZHCA 1WLXA 3ZMZB 3O9XA 2KZ7B 3ZYKA 5JDMA 5JRCA 3C4WA 4HKAA 1MMDA 2DLRA 2CXFA 2D0UA 3PUQA 1G8XA 4UELA 3I1AA 2CXLA 3PDYA 4WBOA 3BQIA 5EK3A 3A5XA 2DI4A 5LA6E 2V7LA 4IE4A 3HL6A 1IJ5A 2ZMAA 4H9OC 3N2OA 3RYCE 4EXTA 2X9YA 2CCQA 3B57A 3VKHA 2H7OA 2LE8A 3P7IA 2W63A 4AKRB 1BR2A 3DJBA 4ANJA 2VKHA 2CM0A 4AQFA 1QSDA 3PE0A 4O8SA 1BR4A 5ADXL 5DQVA 4AKGA 3TKLB 4E7ZA 2WM9A 4GK5E 3W15B 4ASKA 3KV6A 1MIWA 2A3DA 3J9X1 1Y64B 4AKIA 2DHRA 1Z0PA 3ZMVB 4PJLA 4P0BA 5FXWA 3ETVA 2EHOB 3EDVA 4IHJE 3RPUA 4QHOA 3ZCJA 3R6NA 2MOZA 4AQFC 3UFEA 2G0UA 1HX8A 2L8KA 3K3OA 4O4JE 4YLHA 4IIJE 4QXHB 4ERRA 4ISSA 3E08A 5LGNB 2CA5A 5TAOA 3BK9A 3KBUA 5JVDE 1HCIA 5L3BB 4UVBB 2BZBA 3KV4A 3EUHA 1QUUA 2W0GA 1LKXA 2UXNB 2LOSA 3CQGB 2WAUA 1ZEEA 3UUMA 5LP6E 1X79A 3RH3A 5LYJE 3IHRA 2W62A 4AKLA 3O1HA 3UULA 3MXZA 2KINB 4HN9A 4BAYB 1YD8G 2KNDA 5F8PA 3GN5A 3AA1B 3V5UA 2VKOA 3QUJA 3CX8B 3PURA 1MMNA 3FBZA 4DNDA 4L5GA 2DCFA 4UV8B 3IEEA 1FEWA 2E9XB 4O4IE 5E0OA 2X66A 4B6XA 4GYRA 2PFVA 4WBNE 2ODVA 1WYCA 4X1IE 2NOXA 2DNXA 2JMKA 4PJJA 2YU1A 2XAJB 3FHNA 3SOLA 3LBXA 4PW8A 5HXRA 3F31A 1LRZA 3FXDB 3Q5XA 3P8CD 5FNVE 4UVAB 1O3XA 4ISTA 2H7VC 4TUYE 3VU7H 4GK0E 2Q9QD 3FB2A 3IBPA 2VK9A 3HKBE 5LCYA 2IW5B 5LHHB 5JR9C 1UCUA 4QXBB 2ZLYA 2QGSA 3ZMSB 1LVFA 3AVRA 4EZHA 2E8IA 2YU2A 5L3DB 2V7KA 2X68A 2LSYA 5BMVE 2RP4A 2DWGA 3CQCB 4PFPA 3SWHA 2X51A 4IE6A 1MNEA 3PU8A 4DMWA 4BA9A 2LT3A 3OJAA 3PUAA 4M1PA 3KV9A 2PG8A 2LHNA 3N9QA 2C5KT 3F2EA 2JQQA 5HWYA 2CWOA 4A56A 2K24A 2NW7A 3N5LA 2HPLA 5JREA 1FMWA 2D0TA 1BR0A 2A72A 3HI2A 5HXEA 4V1Av 2LSKA 3J7Yq 3O1JA 2VASA 3ZMTB 4CXYA 2PJQA 2IAKA 4AKHA 4QX7B 2KWIB 4UXNB 5J1GA 3KBTA 5LHGB 2QA7A 2WMOA 3ZEFB 2ACXA 3ONXA 4H9SE 5FXXA 2LSIA 2YINA 4BJNA 1MIYA 3F57A 3KVBA 3AA6B 3RRWA 3HR0A 3Q5WA 1SA0E 3MACA 1US7B 4QXCB 3ESLA 5LJNA 4DMVA 1IAPA 3N2GE 3MKDA 4ZI3D 5J2TE 2KXPB 4CQIA 2J1DG 4JUYA 5CB4E 4U74A 2HPJA 4UF0B 3ZC1A 3AB3B 5HAXA 1FIOA 3CMLA 2BVLA 1WRDA 5EZYE 3LK42 2IC9A 2XAHB 3C64A 3CX6B 4PK4A 5A1LA 3DTOA 5AFUL 5JDHA 2N1GA 4ZHQE 5LJMA 5EK4A 4J2CA 3MA9A 5DABA 4KMCA 3H3AA 4WW0A 5KX5E 2P9BA 2PBIA 2X67A 3KDSE 1D0YA 5DJQC 5GONE 4O4HE 1D0XA 3ZYMA 4JLEA 2K5BB 2XAFB 4YJ3E 3MJXA 2LSJA 4UV9B 3AAIA 1IJ6A 1D1CA 5LNKA 5HYAA 2Q9QA 2HH7A 1D1AA 3BQLA 1WR6A 1FMVA 3MZKB 2ODUA 3JC6D 3M65A 1B7TA 4H9RC 4YFSA 3SS1A 4XAXB 4TV9E 4ZI2D 4XZCA 4TZ4C 2BDEA 5LOVE 1D1BA 3I0QA 1G73A 4EAHA 5FXZA 5HXCA 2V7JA 4EIWA 3ZMUB 3N9PA 4DVDA 3R84B 2Q9QC 3Q2MA 2X9XA 1HTJF 3ANWA 2NW9A 3HKEE 2XUEA 3ETUA 1AJ3A 4OYJA 5ETWA 3CVRA 4IE7A 4QWNB 1ZKEA 4DO0A 1YKHB 4KUMB 3ZPOA 3FXEB 3AA7B 3NZPA 2VL8A 2LSGA 2EHOD 3K3NA 4DBRA 1V9DA 2JJ9A 1MMAA 3LK2B 5LBQB 5JQGE 3T8OA 4TN7B 3ZC0A 4I43B 3AAEB 2NP9A 4PJMA 2MYSA 3KV5A 2XQYA 4L9IA 5FY7A 3EDUA 1T98A 3C4ZA 3RC3A 2MBGA 3N9MA 4H9QC 1HS7A 2ES0A 1H7CA 3C50A 2V7MA 1UX5A 3KVAA 5IYZE 4AI6A 2VKDA 3K3QC 3NRYA 4TV8E 4UVCB 3GN5B 2KMFA 4O2AE 3RYFE 4MALA 2V7IA 3OYXA 3WAKA 3C51A 3LJCA 3K8PC 3ZJ2A 3UUXB 3I9YA 3UT5E 2XHEB 2JPFA 2NW8A 4ADZA 2OA5A 3VKGA 4C91A 3H37A 5JR9B 4IGUA 4IE5A 5L3CB 4ZI3C 4IE0A 4MFRA 2CLYC 2VB6A 3QK6A 3N2KE 4UIGA 4N78D 2YK0A 4PFOA 4CI3B 4O2BE 3ZN1B 4CI2B 2LEHA 3Q9DA 4ILUA 4X1KE 4PNIA 4FJOA 1CUNA 1D0ZA 1KK7A 2E9XD 2VWAA 3I9WA 2DWKA 3L09A 3NBXX 4I55E 1E1HB 4OHFA 2L9QA 5L3GB 3BQKA 4H9NC 3NRXA 1YW0A 3ZYLA 4CZZB 3AAAB 3DP7A 1MMGA 2D5UA 3I0OA 1S94A 3UUNA 1HF8A 3OYZA 5FP3A 3RYHE 4EYUA 3KFWX 4WNKA 4JEUB 2A2FX 2WWUA 4AQGA 3ZJ1A 5HWXA 5FYMA 2W61A 3RYIE 4IDZA 5F3JA 1MIVA 3GA8A 4PK5A 5C8YE 5L3EB 2UXXB 3JC6C 1UX4A 5JDLA 4OYKA 3QC9A 2ZM2A 3V5SA 4C90A 5FY0A 3UTKA 3L3PA 5IHYA 4ZI2C 5JDGA 5L2LA 3RX6A 4YJ2E 1BR1A 4MLKA 3RRCA 3KINB 5KDMC 4UF0A 4EB6E 5JRCB 2CE7A 2GK9A 3O4XE 2L3LA 1WYBA 2EHOA 1U5PA 3HKCE 4CXWA 4NUUA 1SHZC 3FBLA 2BVMA 4I50E 3RKOA 2K9AA 3CWZB 4P09A 3C98B 4TX5A 3LG7A 2JMHA 3N9NA 5CA1E 2NWBA 2EHOC 2RA1A 2H3RA 4AXPA 2WMNA 4MBQA 3PTRB 3VHLA 4CXXA 5LGTB 2N2NA 2NTYA 1HG2A 5LXTE 1OXZA 2V26A 4HE8A 2LM9A 3EVYA 3U3IA 5LBMA 4OFZA 4ZI7E 4Z8XA 3SRZA 4H9PC 3PU3A 2KWHA 2Y48B 4UEMA 5LGUB 4PJNA 2ZM8A 2WSSV 4HFVA 4PAGA 4GOUA 5FMNA 2CXDA 4ZS3A 3OBVE 3ZCIA 1KNZA 2X9WA 4P0AA 3O1IA 4O4LE 5KMGP 3S4UA 2E9XA 3AA0B 4X1YE 4BJMA 2Q9QB 4PK6A 3CQXC 2XTLA 5CA0E 1HG5A 1OWAA 4KP3C 2IC6A 2M67A 2LOPA 2NTXA 4G2AA 3E0ZA 2SPCA 4ZOLE 4K0UA 4ZS2A 5M4YA 2X9HA 3HKDE 3E22E 4XBFB 5H6RB 2V1DB 2CWYA 3N9LA 3PUSA 4JEHB 1EZ3A 2Y6XA 3ZLIA 2LHRA 2E9XC 2X0LB 5DQWA 4I4TE 4L0RA 3U78A 5L3FB 2KLQA 4CI1B 3ANWB 2CEAA 2KT9A 4QKNA 4MHCA 1MNDA 2XAQB 3LFMA 3NZQA 3PUGA 5JDFA 2K48A 4H63V 3AVSA 3WI3A 5JDQA 4FI5A 3RC8A 5H6QB 4X20E 1VOMA 4EYYR 2JRKA 3ZN0B 3N9OA 4YHJA 1YKEB 2D2SA 5JR9A 3LK3B 2LJLA 5FXVA 3CKDA 3MK7C 4G63A 5HXSA 3IF8B 1HFAA 2MTQA 3HA4A 4OK0A 4HTEA 5FY1A 2B1EA 5J2UE 2YEVC 2WBLA 3C4XA 4KBMB 4QX8B 1U4QA 3GWHA 2XAGB 3LBXB 1S35A 4F6RC 4HGAA 2W00A 2XASB 4H63H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IAP A;  2DLR A;  2A72 A;  2I59 A;  3C51 A;  4WBO A;  1ZV4 X;  3AB3 B;  1SHZ C;  3T8O A;  3CX6 B;  4YHJ A;  4L9I A;  4WNK A;  3C4Z A;  4IGU A;  2ACX A;  2PBI A;  1HTJ F;  3CX7 B;  4GOU A;  2ES0 A;  3C50 A;  3C4X A;  3QC9 A;  3C4W A;  3CX8 B;  4PNI A; 
#chains in the Genus database with same CATH topology
 5ABE A;  4DR6 T;  3B13 A;  2Z6E A;  2I59 A;  1IZN B;  5JDN A;  3AED A;  2Y8D A;  2VUR A;  2VKJ A;  4E7S A;  4EOZ B;  3WAJ A;  1LVK A;  1NAF A;  1ZHC A;  3NWI A;  3O9X A;  2XQ6 A;  3SFE A;  4HKA A;  2PTF A;  2CXL A;  4WBO A;  1VCS A;  2UXB T;  3HL6 A;  1IJ5 A;  4H9O C;  4EXT A;  4JI4 T;  2X9Y A;  3AEB A;  2H7O A;  2MAW A;  2W63 A;  3DJB A;  2VKH A;  2CM0 A;  4U33 A;  5ADX L;  1BR4 A;  1W9R A;  2BG9 E;  2EHO B;  3EDV A;  4IHJ E;  5HCM A;  3ONJ A;  3NKZ A;  1HX8 A;  4O4J E;  4IIJ E;  5LGN B;  4LFC T;  5FVL A;  3KBU A;  4U3C A;  3KV4 A;  1QUU A;  2CHN A;  1LKX A;  2ACZ A;  3TLT A;  4B3R T;  2YDS A;  4LF7 T;  4HFD A;  1ZEE A;  3AE4 A;  3UUM A;  1X79 A;  3RH3 A;  3IHR A;  2W62 A;  3O1H A;  3UUL A;  4BAY B;  4LF4 T;  3AXJ B;  3AA1 B;  3V5U A;  2VKO A;  3FBZ A;  4B3M T;  4UV8 B;  2JMK A;  1N32 T;  4DV2 T;  3FHN A;  3SOL A;  5HXR A;  3FXD B;  3Q5X A;  4YSX A;  5ABF A;  4GK0 E;  2IDO B;  2QGS A;  3AVR A;  2E8I A;  2WB5 A;  4Q25 A;  5L3D B;  2V7K A;  2UU9 T;  2WP9 A;  2OLT A;  1W0A A;  2XZE A;  4IE6 A;  1MNE A;  4EV6 A;  3PUA A;  3F2E A;  5HWY A;  4HFI A;  3N5L A;  1T8B A;  2A72 A;  1XDP A;  2LSK A;  3P4R A;  3CIR A;  3AE5 A;  4QX7 B;  3Q5D A;  3ZEF B;  2LSI A;  2YIN A;  2XM2 A;  2XQ8 A;  3KVB A;  2XPK A;  2WWV A;  3ESL A;  5J2T E;  2HPJ A;  4UF0 B;  3AB3 B;  3LK4 2;  2IC9 A;  5A1L A;  4ZHQ E;  2E5V A;  4J2C A;  4KMC A;  2HN2 A;  2P9B A;  2PBI A;  1D0Y A;  5HEU A;  5LG3 A;  5GON E;  1IBM T;  1IJ6 A;  2Q9Q A;  2UUB T;  2HH7 A;  4IRE A;  1OED B;  3MZK B;  4JI3 T;  4XZC A;  3TLV A;  4EIW A;  3QNU A;  2X9X A;  1HTJ F;  3ANW A;  5AQP B;  4IE7 A;  3ZPO A;  3AA7 B;  2VL8 A;  4DUY T;  3UU6 A;  3QOF A;  4DBR A;  1MMA A;  2IIU A;  3AAE B;  1CHU A;  4PJM A;  4H9Q C;  1HS7 A;  3C50 A;  4DR3 T;  2XQ3 A;  5IYZ E;  4LMK A;  3NRY A;  3GN5 B;  3IA3 A;  4MAL A;  5HEH A;  5KXJ A;  2HN1 A;  3UT5 E;  2XHE B;  2VB6 A;  3QK6 A;  3NVO A;  4CI2 B;  4X1K E;  4ILU A;  5HCJ A;  1D0Z A;  4OHF A;  2VWA A;  3NBX X;  5AQH B;  2DWK A;  3AAA B;  1MMG A;  2FJA A;  3I0O A;  3RYH E;  2E5L T;  4WNK A;  3B5M A;  4AQG A;  4YXD A;  2W61 A;  5F3J A;  5C8Y E;  4A98 A;  4JI7 T;  4YJ2 E;  4EB6 E;  2XJ7 A;  2L3L A;  1WYB A;  2EHO A;  1U5P A;  4CXW A;  5C2T A;  3PUY F;  1UK5 A;  2JMH A;  2RA1 A;  4AXP A;  4U2Y A;  5J0Z A;  2NTY A;  4JYA T;  3OTO T;  3AE3 A;  5AQV B;  5AQQ B;  2Y48 B;  4HWF A;  4HFV A;  4GOU A;  5F5W A;  3AXJ A;  2BKP A;  4IDN A;  2X9W A;  3O1I A;  3PJA A;  5KMG P;  3AA0 B;  4BJM A;  4PK6 A;  2XTL A;  3PUZ F;  1OWA A;  2WZI A;  2LOP A;  2SPC A;  4JEH B;  3ZLI A;  2V5D A;  2LHR A;  1W09 A;  2E9X C;  5L3F B;  2KLQ A;  2CEA A;  4MHC A;  3VR8 A;  2XAQ B;  5CJ5 A;  2K48 A;  3AVS A;  3WI3 A;  1T7S A;  1T72 A;  2JRK A;  2CBJ A;  1KEY A;  4JI6 T;  2V5C A;  4HFE A;  2ZM6 T;  3CKD A;  2FJD A;  4G63 A;  5HXS A;  5FY1 A;  2WS3 A;  3UFG A;  5J2U E;  2CPT A;  1U4Q A;  3GWH A;  2W00 A;  2F4V T;  4H63 H;  2CMR A;  2KSR A;  3OKQ A;  3D0T A;  2N9D A;  3P4S A;  4EZ4 A;  2ZM0 A;  2C5I T;  2V6Y B;  3CX7 B;  4DBQ A;  3ZMZ B;  3ZYK A;  3C4W A;  2CXF A;  4OX9 T;  4DR7 T;  3A8Y C;  3A5X A;  1N33 T;  3P7I A;  4AKR B;  2RPA A;  4ANJ A;  4AKG A;  4WYV A;  1MIW A;  4AKI A;  1Z0P A;  3R6N A;  4AQF C;  2L8K A;  2WCA A;  3K3O A;  4YLH A;  2X0H A;  4ISS A;  3BK9 A;  2LKH A;  4UVB B;  2M6I A;  4K0K T;  3AE9 A;  4HFH A;  2WAU A;  5LP6 E;  3LDQ B;  4JBW F;  4AKL A;  3MXZ A;  2KND A;  3GN5 A;  2J47 A;  2DCF A;  1FEW A;  5E0O A;  4O4I E;  3P50 A;  2X66 A;  1WYC A;  3PUW F;  3X1D A;  4PJJ A;  2YU1 A;  5JTG A;  2LM2 A;  3TLW A;  4IST A;  4TUY E;  3VU7 H;  4DUZ T;  2Q9Q D;  3FB2 A;  3IBP A;  5LCY A;  2IW5 B;  3L39 A;  1XZY A;  2BG9 C;  4QXB B;  1LVF A;  2YU2 A;  3TLS A;  2RP4 A;  3CQC B;  2X51 A;  3PU8 A;  2IUB A;  4M1P A;  3KV9 A;  2LHN A;  2C5K T;  2JQQ A;  4EGW A;  2NW7 A;  5JRE A;  3G06 A;  3HI2 A;  3ZKR A;  3J7Y q;  2IAK A;  4I0U A;  4DR4 T;  1YXR A;  4P1N A;  2WDV A;  4IL4 A;  2WMO A;  4CN6 A;  3RQU A;  4UR9 A;  3ONX A;  2YN6 A;  4BJN A;  3F57 A;  3HR0 A;  3AEF A;  1NEK A;  3Q5W A;  4JI1 T;  4QXC B;  4YTP A;  4ZI3 D;  4HWC A;  5HEG A;  1KFY A;  4U74 A;  4A5X A;  3ZC1 A;  4U2Z A;  1FIO A;  3EAM A;  3AE6 A;  5EZY E;  3C64 A;  4NIQ A;  5JDH A;  3DTO A;  2N1G A;  1YQ4 A;  3RIU C;  5DAB A;  2X0Y A;  5AQG B;  1E2A A;  4O4H E;  5AQO B;  2K5B B;  2XAF B;  3MJX A;  2LSJ A;  5LNK A;  3UQ7 A;  1WR6 A;  1FMV A;  2CBI A;  1B7T A;  4TV9 E;  3K1S A;  2BDE A;  1D1B A;  4EAH A;  1G73 A;  2V7J A;  4DVD A;  1AJ3 A;  1SUM B;  4Z90 A;  4OYJ A;  4JI5 T;  5ETW A;  2LLY A;  3CVR A;  3QB5 A;  2EHO D;  3K3N A;  3AEC A;  5LBQ B;  5JQG E;  3ZC0 A;  4YT0 A;  2NP9 A;  2MYS A;  5FY7 A;  3RC3 A;  2IHR 1;  3N9M A;  4IDO A;  2ES0 A;  2V7M A;  2IML A;  2VKD A;  3K3Q C;  2KMF A;  3RYF E;  2V7I A;  3C51 A;  3LJC A;  3K8P C;  3ZJ2 A;  3UUX B;  5BR8 T;  2JPF A;  2V6Y A;  4ADZ A;  2OA5 A;  4IE5 A;  2CLY C;  4GKJ T;  2YK0 A;  5ABG A;  3ZN1 B;  4PNI A;  4X5T A;  1KK7 A;  3L09 A;  1E1H B;  5L3G B;  1N34 T;  3ZT6 A;  2K3W A;  3OYZ A;  4EYU A;  3AE1 A;  2WWU A;  5HWX A;  3ZJ1 A;  3PUX F;  4IDZ A;  1XMQ T;  3RIF A;  5L3E B;  3QC9 A;  3UTK A;  5L2L A;  3RX6 A;  3RIA A;  3RRC A;  2GK9 A;  1HNX T;  4NUU A;  2BVM A;  4I50 E;  3RKO A;  2K9A A;  2WU5 A;  3C98 B;  3LG7 A;  3N9N A;  1KNR A;  4EED A;  3OPC A;  2XM1 A;  3PTR B;  4DV3 T;  1VCT A;  1OXZ A;  2V26 A;  2LM9 A;  1XNQ T;  2LRL A;  4U7Y A;  4Z8X A;  3SRZ A;  3PU3 A;  5FL1 A;  5LGU B;  1OED C;  2CRB A;  2WSS V;  5FMN A;  3OBV E;  3RI5 A;  2DL1 A;  5HEJ A;  3CQX C;  5CGM A;  4KP3 C;  2NTX A;  4K0U A;  5M4Y A;  3E22 E;  5H6R B;  2V1D B;  3PUS A;  4X65 T;  5DQW A;  3U78 A;  2KT9 A;  4HWI B;  5JDF A;  4X66 T;  4WZX A;  4H63 V;  2B76 A;  4EYY R;  5CFB A;  5AQS B;  3ZN0 B;  1L0V A;  1YKE B;  2D2S A;  3QB5 K;  2BG9 A;  3MK7 C;  2V6X A;  1OED E;  2MTQ A;  4OK0 A;  2WBL A;  4KBM B;  4IDQ A;  1I94 T;  4F6R C;  4HGA A;  2W2U A;  3CPZ A;  2C0S A;  4NUV A;  3FZM B;  1E7P A;  1NWM X;  4HEA A;  4LF9 T;  3CK6 A;  5EK2 A;  1M7K A;  1X9B A;  4GYS A;  3UUB A;  4U72 A;  1WLX A;  4U31 A;  3ONL C;  5JDM A;  5L47 A;  2BS4 A;  4X62 T;  2D0U A;  5LMN T;  1G8X A;  4DR1 T;  3P4W A;  3BQI A;  2DI4 A;  2V7L A;  4IE4 A;  3RYC E;  2CCQ A;  3VKH A;  2LE8 A;  1BR2 A;  2UXD T;  1QSD A;  3PE0 A;  4O8S A;  5DQV A;  3TKL B;  5L4H A;  4E7Z A;  4GK5 E;  3W15 B;  2A3D A;  3J9X 1;  2DHR A;  4PJL A;  2VQE T;  5FXW A;  3ETV A;  4QHO A;  3UU4 A;  3ZCJ A;  1SE7 A;  2MOZ A;  3VRA A;  2G0U A;  1HX1 B;  2BS3 A;  3ZT7 A;  3E08 A;  2CA5 A;  1NEN A;  5TAO A;  5JVD E;  3UQ4 A;  5AQL B;  1HCI A;  1Z8U A;  4ILA A;  1W0B A;  2VVS A;  1I6Z A;  2UXN B;  2LOS A;  1YD8 G;  4COF A;  5FKY A;  4AIS A;  3CX8 B;  3PUR A;  1MMN A;  3JAF A;  4DND A;  4L5G A;  4IT4 A;  2XQ9 A;  3IEE A;  2E9X B;  3JAE A;  2NR4 A;  2WY2 A;  1N36 T;  4JI0 T;  1HR0 T;  2DNX A;  2XQ4 A;  2E2A A;  2UUA T;  3LBX A;  4PW8 A;  4JI2 T;  5FNV E;  4UVA B;  2H7V C;  2XQ7 A;  2VK9 A;  3HKB E;  5JR9 C;  2JIW A;  2ZLY A;  3ZMS B;  4EZH A;  4DR2 T;  4F8H A;  4YHH T;  5BMV E;  4NPP A;  4PFP A;  4B3T T;  2VQF T;  3OJA A;  2PG8 A;  1DU2 A;  4ZZC A;  4A56 A;  3EAB A;  2K24 A;  2FJE A;  5HXE A;  5FL0 A;  3O1J A;  2VAS A;  3ZMT B;  5J1G A;  4KI0 F;  3KBT A;  5LHG B;  4TWD A;  4HFC A;  2ACX A;  4H9S E;  5FXX A;  3JCF A;  1MIY A;  3AA6 B;  3RRW A;  1UUR A;  1SA0 E;  3MAC A;  4DMV A;  1IAP A;  5AQJ B;  2KXP B;  2J1D G;  5CB4 E;  4LFA T;  2JQH A;  2BVL A;  4PK4 A;  2XAH B;  5LJM A;  3MA9 A;  4B3S T;  4WW0 A;  5KX5 E;  5DJQ C;  4A97 A;  1D0X A;  3ZYM A;  4JLE A;  3AAI A;  1D1C A;  5HYA A;  1J5W A;  4LMJ A;  3SS1 A;  4H9R C;  2ODU A;  3JC6 D;  3M65 A;  3AE7 A;  4XAX B;  4ZI2 D;  4TZ4 C;  3AE8 A;  5FXZ A;  5HXC A;  3ZMU B;  3N9P A;  3R84 B;  2Q9Q C;  3Q2M A;  3HKE E;  3ETU A;  5HEO A;  4QWN B;  4KUM B;  2FJB A;  4DV1 T;  3A7M A;  4U7I A;  3LK2 B;  3T8O A;  4TN7 B;  4CN1 A;  4DR5 T;  3RKG A;  4L9I A;  3EDU A;  1T98 A;  4YSY A;  1WCR A;  3KVA A;  4TV8 E;  4UVC B;  3WAK A;  3I9Y A;  3AE2 A;  4IGU A;  5L3C B;  4ZI3 C;  2BG9 B;  4MFR A;  1Y01 A;  4UIG A;  4CI3 B;  2LEH A;  4FJO A;  3PV0 F;  1CUN A;  1ZOY A;  3I9W A;  4I55 E;  5LB7 B;  2L9Q A;  4ZZB A;  3FZL B;  3ZYL A;  3UUN A;  1HF8 A;  1JNR A;  3PUV F;  3TLU A;  1UGO A;  3KFW X;  1WFD A;  2A2F X;  4DV6 T;  1MIV A;  3GA8 A;  4PK5 A;  2UXX B;  1UX4 A;  4KHP T;  4C90 A;  3L3P A;  5IHY A;  1BR1 A;  3KIN B;  3O4X E;  1YQ3 A;  3HKC E;  1SHZ C;  2YOE A;  4TWH A;  2LKG A;  5CA1 E;  3L8R A;  2I6H A;  2NWB A;  2EHO C;  3P4P A;  2H3R A;  1J5E T;  1HNZ T;  4AQY T;  4MBQ A;  5LGT B;  2N2N A;  3UU5 A;  1HG2 A;  4HE8 A;  3EVY A;  2W66 A;  4YY3 T;  4H9P C;  2KWH A;  4PJN A;  4Z91 A;  2ZM8 A;  4TNW A;  2CXD A;  4LF5 T;  2E9X A;  4X1Y E;  5CA0 E;  4TWF A;  4LFB T;  2IC6 A;  2XQA A;  2M67 A;  4G2A A;  3FZF B;  3E0Z A;  5FVK A;  4ZOL E;  2X9H A;  3HKD E;  2XSB A;  4YTM A;  3N9L A;  2HHH T;  2Y6X A;  2AE9 A;  2XY8 B;  1XMO T;  2X0L B;  4I4T E;  3RQW A;  4CI1 B;  2J4G A;  3VRB A;  3NZQ A;  2LRK A;  5JDQ A;  5H6Q B;  1J1J A;  3N9O A;  4YHJ A;  3RF1 A;  2JQK A;  3EI0 A;  2D9D A;  5JR9 A;  3LK3 B;  4X64 T;  3HA4 A;  4HTE A;  2YEV C;  3C4X A;  4QX8 B;  3LBX B;  2XAG B;  1S35 A;  3RC8 A;  2XAS B;  2QVA A;  5JH7 E;  5HXH A;  5LG4 A;  4GIW A;  1VRB A;  2CLY B;  1ZV4 X;  1R8I A;  2QRX A;  3Q5E A;  3GMI A;  2C5J A;  4TNV A;  5LHI B;  2XSA A;  2YDR A;  2KZ7 B;  4QH5 A;  5JRC A;  2YDQ A;  3ZSS A;  1MMD A;  2DLR A;  3AEG A;  3PUQ A;  4UEL A;  3I1A A;  3PDY A;  5EK3 A;  4YTN A;  5LA6 E;  2ZMA A;  4NXN T;  3N2O A;  3B57 A;  4AQF A;  2YKS A;  2WM9 A;  4ILB A;  1IBK T;  4ASK A;  3KV6 A;  1Y64 B;  3ZMV B;  3UU3 A;  4P0B A;  4ZEY A;  3RPU A;  3ABV A;  3UFE A;  5AQK B;  4QXH B;  4ERR A;  2VVN A;  4QH1 A;  3M3Z B;  5L3B B;  1FJG T;  2BZB A;  3EUH A;  2W0G A;  3PJA J;  3RLF F;  3CQG B;  5LYJ E;  4JV5 T;  2KIN B;  4HN9 A;  5AQN B;  5F8P A;  3ZST A;  2W4X A;  3QUJ A;  4LF8 T;  4NXM T;  4HWH A;  4CN4 A;  4GKK T;  4DV7 T;  4B6X A;  4GYR A;  2PFV A;  4WBN E;  2ODV A;  4X1I E;  2NOX A;  4DV5 T;  2XAJ B;  3F31 A;  1LRZ A;  3P8C D;  1O3X A;  5AQR B;  5LHH B;  2UUC T;  3FZK B;  1UCU A;  1XNR T;  1XDO A;  4ZXL A;  2X68 A;  2LSY A;  2DWG A;  3SWH A;  4DMW A;  2WZH A;  4BA9 A;  2LT3 A;  3N9Q A;  1QLB A;  2CWO A;  2W67 A;  2BBJ A;  2HPL A;  1FMW A;  2D0T A;  1XWM A;  1BR0 A;  4V1A v;  4CXY A;  3VR9 A;  2BKO A;  2PJQ A;  3H3M A;  4AKH A;  2KWI B;  4UXN B;  2QA7 A;  4EEB A;  3RIU A;  1US7 B;  5LJN A;  3N2G E;  3MKD A;  4CQI A;  4JUY A;  4ILC A;  2AXD S;  3RHW A;  2M6B A;  5HAX A;  2QYW A;  3CML A;  1WRD A;  3CX6 B;  5AFU L;  5EK4 A;  1WR0 A;  3H3A A;  2X67 A;  3KDS E;  5L4E A;  4YJ3 E;  4UV9 B;  2OV9 A;  1D1A A;  3BQL A;  3P4Q A;  4QH4 A;  4YFS A;  3LSV A;  4KX6 A;  1JNZ A;  5LOV E;  3ZT5 A;  2FBW A;  3I0Q A;  4KHZ F;  2WDR A;  2NW9 A;  2XUE A;  2MPK A;  1ZKE A;  3OVU A;  1YKH B;  4DO0 A;  2BKN A;  3FXE B;  3NZP A;  1IBL T;  2JQ9 A;  2LSG A;  5LMU T;  1V9D A;  2JJ9 A;  4I43 B;  3KV5 A;  2XQY A;  3C4Z A;  2MBG A;  1H7C A;  4AIU A;  1UX5 A;  4AI6 A;  2XQ5 A;  4O2A E;  3OYX A;  2BBH A;  2WDQ A;  2BS2 A;  5IUX A;  2NW8 A;  3VKG A;  4C91 A;  3H37 A;  5ABH A;  5JR9 B;  2H89 A;  3FZH B;  4IE0 A;  5AQU B;  3N2K E;  4N78 D;  4PFO A;  4O2B E;  3Q9D A;  2E9X D;  5ABF B;  2J62 A;  3BQK A;  4H9N C;  3NRX A;  1YW0 A;  4CZZ B;  3DP7 A;  2D5U A;  3T1H T;  1S94 A;  1HNW T;  5FP3 A;  4HFB A;  1KNP A;  4JI8 T;  3T1Y T;  4JEU B;  3UU8 A;  5FYM A;  3RYI E;  3JC6 C;  5JDL A;  4OYK A;  3V5S A;  2ZM2 A;  5FY0 A;  4ZI2 C;  5JDG A;  4LF6 T;  4MLK A;  5KDM C;  4IDP A;  4UF0 A;  5JRC B;  2CE7 A;  3FBL A;  5IWA T;  3CWZ B;  3AEA A;  4P09 A;  4TX5 A;  3EHZ A;  2WMN A;  3JAD A;  3VHL A;  4CXX A;  5AQM B;  1OED A;  2UXC T;  2VL0 A;  5LXT E;  4DV0 T;  1M62 A;  3U3I A;  5LBM A;  5AQI B;  4OFZ A;  3RGL A;  4ZI7 E;  2CHO A;  4LML A;  4UEM A;  4DV4 T;  5AQT B;  3AEE A;  4PAG A;  4ZS3 A;  3ZCI A;  2V8S V;  3SFD A;  1KNZ A;  4P0A A;  5C3J A;  4O4L E;  4HWD A;  3S4U A;  2Q9Q B;  1HG5 A;  2R6G F;  4ZS2 A;  4IL9 A;  4XBF B;  5AQF B;  2CWY A;  2WQY A;  1EZ3 A;  1KF6 A;  4L0R A;  3ANW B;  4QKN A;  1GQE A;  2H88 A;  1MND A;  3LFM A;  3PUG A;  4DID B;  2A9U A;  4FI5 A;  2WU2 A;  4X20 E;  1VOM A;  4YSZ A;  2LJL A;  5FXV A;  3IF8 B;  1HFA A;  2I0M A;  2B1E A;  1ZP0 A;  2FUP A;  1UUS A; 
#chains in the Genus database with same CATH homology
 3CPZ A;  5JH7 E;  5HXH A;  2CMR A;  2C0S A;  4NUV A;  3B13 A;  5LG4 A;  2Z6E A;  3OKQ A;  3D0T A;  4GIW A;  1VRB A;  2N9D A;  2I59 A;  2CLY B;  1ZV4 X;  4EZ4 A;  2ZM0 A;  1IZN B;  2C5I T;  3GMI A;  2C5J A;  1NWM X;  5JDN A;  4HEA A;  2Y8D A;  2VKJ A;  4E7S A;  5EK2 A;  5LHI B;  4EOZ B;  3WAJ A;  1LVK A;  1NAF A;  3CX7 B;  4GYS A;  4U72 A;  4DBQ A;  1ZHC A;  1WLX A;  3ZMZ B;  3O9X A;  2KZ7 B;  3ZYK A;  5JDM A;  5JRC A;  3C4W A;  4HKA A;  1MMD A;  2DLR A;  2CXF A;  2D0U A;  3PUQ A;  1G8X A;  4UEL A;  3I1A A;  2CXL A;  3PDY A;  4WBO A;  3BQI A;  5EK3 A;  3A5X A;  2DI4 A;  5LA6 E;  2V7L A;  4IE4 A;  3HL6 A;  1IJ5 A;  2ZMA A;  4H9O C;  3N2O A;  3RYC E;  4EXT A;  2X9Y A;  2CCQ A;  3B57 A;  3VKH A;  2H7O A;  2LE8 A;  3P7I A;  2W63 A;  4AKR B;  1BR2 A;  3DJB A;  4ANJ A;  2VKH A;  2CM0 A;  4AQF A;  1QSD A;  3PE0 A;  4O8S A;  1BR4 A;  5ADX L;  5DQV A;  4AKG A;  3TKL B;  4E7Z A;  2WM9 A;  4GK5 E;  3W15 B;  4ASK A;  3KV6 A;  1MIW A;  2A3D A;  3J9X 1;  1Y64 B;  4AKI A;  2DHR A;  1Z0P A;  3ZMV B;  4PJL A;  4P0B A;  5FXW A;  3ETV A;  2EHO B;  3EDV A;  4IHJ E;  3RPU A;  4QHO A;  3ZCJ A;  3R6N A;  2MOZ A;  4AQF C;  3UFE A;  2G0U A;  1HX8 A;  2L8K A;  3K3O A;  4O4J E;  4YLH A;  4IIJ E;  4QXH B;  4ERR A;  4ISS A;  3E08 A;  5LGN B;  2CA5 A;  5TAO A;  3BK9 A;  3KBU A;  5JVD E;  1HCI A;  5L3B B;  4UVB B;  2BZB A;  3KV4 A;  3EUH A;  1QUU A;  2W0G A;  1LKX A;  2UXN B;  2LOS A;  3CQG B;  2WAU A;  1ZEE A;  3UUM A;  5LP6 E;  1X79 A;  3RH3 A;  5LYJ E;  3IHR A;  2W62 A;  4AKL A;  3O1H A;  3UUL A;  3MXZ A;  2KIN B;  4HN9 A;  4BAY B;  1YD8 G;  2KND A;  5F8P A;  3GN5 A;  3AA1 B;  3V5U A;  2VKO A;  3QUJ A;  3CX8 B;  3PUR A;  1MMN A;  3FBZ A;  4DND A;  4L5G A;  2DCF A;  4UV8 B;  3IEE A;  1FEW A;  2E9X B;  4O4I E;  5E0O A;  2X66 A;  4B6X A;  4GYR A;  2PFV A;  4WBN E;  2ODV A;  1WYC A;  4X1I E;  2NOX A;  2DNX A;  2JMK A;  4PJJ A;  2YU1 A;  2XAJ B;  3FHN A;  3SOL A;  3LBX A;  4PW8 A;  5HXR A;  3F31 A;  1LRZ A;  3FXD B;  3Q5X A;  3P8C D;  5FNV E;  4UVA B;  1O3X A;  4IST A;  2H7V C;  4TUY E;  3VU7 H;  4GK0 E;  2Q9Q D;  3FB2 A;  3IBP A;  2VK9 A;  3HKB E;  5LCY A;  2IW5 B;  5LHH B;  5JR9 C;  1UCU A;  4QXB B;  2ZLY A;  2QGS A;  3ZMS B;  1LVF A;  3AVR A;  4EZH A;  2E8I A;  2YU2 A;  5L3D B;  2V7K A;  2X68 A;  2LSY A;  5BMV E;  2RP4 A;  2DWG A;  3CQC B;  4PFP A;  3SWH A;  2X51 A;  4IE6 A;  1MNE A;  3PU8 A;  4DMW A;  4BA9 A;  2LT3 A;  3OJA A;  3PUA A;  4M1P A;  3KV9 A;  2PG8 A;  2LHN A;  3N9Q A;  2C5K T;  3F2E A;  2JQQ A;  5HWY A;  2CWO A;  4A56 A;  2K24 A;  2NW7 A;  3N5L A;  2HPL A;  5JRE A;  1FMW A;  2D0T A;  1BR0 A;  2A72 A;  3HI2 A;  5HXE A;  4V1A v;  2LSK A;  3J7Y q;  3O1J A;  2VAS A;  3ZMT B;  4CXY A;  2PJQ A;  2IAK A;  4AKH A;  4QX7 B;  2KWI B;  4UXN B;  5J1G A;  3KBT A;  5LHG B;  2QA7 A;  2WMO A;  3ZEF B;  2ACX A;  3ONX A;  4H9S E;  5FXX A;  2LSI A;  2YIN A;  4BJN A;  1MIY A;  3F57 A;  3KVB A;  3AA6 B;  3RRW A;  3HR0 A;  3Q5W A;  1SA0 E;  3MAC A;  1US7 B;  4QXC B;  3ESL A;  5LJN A;  4DMV A;  1IAP A;  3N2G E;  3MKD A;  4ZI3 D;  5J2T E;  2KXP B;  4CQI A;  2J1D G;  4JUY A;  5CB4 E;  4U74 A;  2HPJ A;  4UF0 B;  3ZC1 A;  3AB3 B;  5HAX A;  1FIO A;  3CML A;  2BVL A;  1WRD A;  5EZY E;  3LK4 2;  2IC9 A;  2XAH B;  3C64 A;  3CX6 B;  4PK4 A;  5A1L A;  3DTO A;  5AFU L;  5JDH A;  2N1G A;  4ZHQ E;  5LJM A;  5EK4 A;  4J2C A;  3MA9 A;  5DAB A;  4KMC A;  3H3A A;  4WW0 A;  5KX5 E;  2P9B A;  2PBI A;  2X67 A;  3KDS E;  1D0Y A;  5DJQ C;  5GON E;  4O4H E;  1D0X A;  3ZYM A;  4JLE A;  2K5B B;  2XAF B;  4YJ3 E;  3MJX A;  2LSJ A;  4UV9 B;  3AAI A;  1IJ6 A;  1D1C A;  5LNK A;  5HYA A;  2Q9Q A;  2HH7 A;  1D1A A;  3BQL A;  1WR6 A;  1FMV A;  3MZK B;  2ODU A;  3JC6 D;  3M65 A;  1B7T A;  4H9R C;  4YFS A;  3SS1 A;  4XAX B;  4TV9 E;  4ZI2 D;  4XZC A;  4TZ4 C;  2BDE A;  5LOV E;  1D1B A;  3I0Q A;  1G73 A;  4EAH A;  5FXZ A;  5HXC A;  2V7J A;  4EIW A;  3ZMU B;  3N9P A;  4DVD A;  3R84 B;  2Q9Q C;  3Q2M A;  2X9X A;  1HTJ F;  3ANW A;  2NW9 A;  3HKE E;  2XUE A;  3ETU A;  1AJ3 A;  4OYJ A;  5ETW A;  3CVR A;  4IE7 A;  4QWN B;  1ZKE A;  4DO0 A;  1YKH B;  4KUM B;  3ZPO A;  3FXE B;  3AA7 B;  3NZP A;  2VL8 A;  2LSG A;  2EHO D;  3K3N A;  4DBR A;  1V9D A;  2JJ9 A;  1MMA A;  3LK2 B;  5LBQ B;  5JQG E;  3T8O A;  4TN7 B;  3ZC0 A;  4I43 B;  3AAE B;  2NP9 A;  4PJM A;  2MYS A;  3KV5 A;  2XQY A;  4L9I A;  5FY7 A;  3EDU A;  1T98 A;  3C4Z A;  3RC3 A;  2MBG A;  3N9M A;  4H9Q C;  1HS7 A;  2ES0 A;  1H7C A;  3C50 A;  2V7M A;  1UX5 A;  3KVA A;  5IYZ E;  4AI6 A;  2VKD A;  3K3Q C;  3NRY A;  4TV8 E;  4UVC B;  3GN5 B;  2KMF A;  4O2A E;  3RYF E;  4MAL A;  2V7I A;  3OYX A;  3WAK A;  3C51 A;  3LJC A;  3K8P C;  3ZJ2 A;  3UUX B;  3I9Y A;  3UT5 E;  2XHE B;  2JPF A;  2NW8 A;  4ADZ A;  2OA5 A;  3VKG A;  4C91 A;  3H37 A;  5JR9 B;  4IGU A;  4IE5 A;  5L3C B;  4ZI3 C;  4IE0 A;  4MFR A;  2CLY C;  2VB6 A;  3QK6 A;  3N2K E;  4UIG A;  4N78 D;  2YK0 A;  4PFO A;  4CI3 B;  4O2B E;  3ZN1 B;  4CI2 B;  2LEH A;  3Q9D A;  4ILU A;  4X1K E;  4PNI A;  4FJO A;  1CUN A;  1D0Z A;  1KK7 A;  2E9X D;  2VWA A;  3I9W A;  2DWK A;  3L09 A;  3NBX X;  4I55 E;  1E1H B;  4OHF A;  2L9Q A;  5L3G B;  3BQK A;  4H9N C;  3NRX A;  1YW0 A;  3ZYL A;  4CZZ B;  3AAA B;  3DP7 A;  1MMG A;  2D5U A;  3I0O A;  1S94 A;  3UUN A;  1HF8 A;  3OYZ A;  5FP3 A;  3RYH E;  4EYU A;  3KFW X;  4WNK A;  4JEU B;  2A2F X;  2WWU A;  4AQG A;  3ZJ1 A;  5HWX A;  5FYM A;  2W61 A;  3RYI E;  4IDZ A;  5F3J A;  1MIV A;  3GA8 A;  4PK5 A;  5C8Y E;  5L3E B;  2UXX B;  3JC6 C;  1UX4 A;  5JDL A;  4OYK A;  3QC9 A;  2ZM2 A;  3V5S A;  4C90 A;  5FY0 A;  3UTK A;  3L3P A;  5IHY A;  4ZI2 C;  5JDG A;  5L2L A;  3RX6 A;  4YJ2 E;  1BR1 A;  4MLK A;  3RRC A;  3KIN B;  5KDM C;  4UF0 A;  4EB6 E;  5JRC B;  2CE7 A;  2GK9 A;  3O4X E;  2L3L A;  1WYB A;  2EHO A;  1U5P A;  3HKC E;  4CXW A;  4NUU A;  1SHZ C;  3FBL A;  2BVM A;  4I50 E;  3RKO A;  2K9A A;  3CWZ B;  4P09 A;  3C98 B;  4TX5 A;  3LG7 A;  2JMH A;  3N9N A;  5CA1 E;  2NWB A;  2EHO C;  2RA1 A;  2H3R A;  4AXP A;  2WMN A;  4MBQ A;  3PTR B;  3VHL A;  4CXX A;  5LGT B;  2N2N A;  2NTY A;  1HG2 A;  5LXT E;  1OXZ A;  2V26 A;  4HE8 A;  2LM9 A;  3EVY A;  3U3I A;  5LBM A;  4OFZ A;  4ZI7 E;  4Z8X A;  3SRZ A;  4H9P C;  3PU3 A;  2KWH A;  2Y48 B;  4UEM A;  5LGU B;  4PJN A;  2ZM8 A;  2WSS V;  4HFV A;  4PAG A;  4GOU A;  5FMN A;  2CXD A;  4ZS3 A;  3OBV E;  3ZCI A;  1KNZ A;  2X9W A;  4P0A A;  3O1I A;  4O4L E;  5KMG P;  3S4U A;  2E9X A;  3AA0 B;  4X1Y E;  4BJM A;  2Q9Q B;  4PK6 A;  3CQX C;  2XTL A;  5CA0 E;  1HG5 A;  1OWA A;  4KP3 C;  2IC6 A;  2M67 A;  2LOP A;  2NTX A;  4G2A A;  3E0Z A;  2SPC A;  4ZOL E;  4K0U A;  4ZS2 A;  5M4Y A;  2X9H A;  3HKD E;  3E22 E;  4XBF B;  5H6R B;  2V1D B;  2CWY A;  3N9L A;  3PUS A;  4JEH B;  1EZ3 A;  2Y6X A;  3ZLI A;  2LHR A;  2E9X C;  2X0L B;  5DQW A;  4I4T E;  4L0R A;  3U78 A;  5L3F B;  2KLQ A;  4CI1 B;  3ANW B;  2CEA A;  2KT9 A;  4QKN A;  4MHC A;  1MND A;  2XAQ B;  3LFM A;  3NZQ A;  3PUG A;  5JDF A;  2K48 A;  4H63 V;  3AVS A;  3WI3 A;  5JDQ A;  4FI5 A;  3RC8 A;  5H6Q B;  4X20 E;  1VOM A;  4EYY R;  2JRK A;  3ZN0 B;  3N9O A;  4YHJ A;  1YKE B;  2D2S A;  5JR9 A;  3LK3 B;  2LJL A;  5FXV A;  3CKD A;  3MK7 C;  4G63 A;  5HXS A;  3IF8 B;  1HFA A;  2MTQ A;  3HA4 A;  4OK0 A;  4HTE A;  5FY1 A;  2B1E A;  5J2U E;  2YEV C;  2WBL A;  3C4X A;  4KBM B;  4QX8 B;  1U4Q A;  3GWH A;  2XAG B;  3LBX B;  1S35 A;  4F6R C;  4HGA A;  2W00 A;  2XAS B;  4H63 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...