2I59A

Solution structure of rgs10
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
138
structure length
138
Chain Sequence
SMQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of G-protein signaling 10
publication title Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 42
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00615 RGS Regulator of G protein signaling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2i59A00
3C51A 3C50A 3C4XA 1SHZC 3CX7B 2DLRA 2I59A 3C4ZA 3CX8B 1IAPA 3QC9A 4WBOA 4GOUA 3CX6B 2A72A 3AB3B 4IGUA 4L9IA 2ACXA 2ES0A 3T8OA 3C4WA 4WNKA 4PNIA 1HTJF 1ZV4X 4YHJA 2PBIA
chains in the Genus database with same CATH superfamily
5HAXA 2YOEA 2VB6A 1E1HB 5C8YE 2IC9A 3SRZA 3UULA 2XTLA 1XMQT 4HWDA 5AQGB 2V7JA 4QWNB 4HWCA 4WYVA 2YU1A 4DR3T 5ABEA 2J1DG 4IDPA 3CX8B 2DWGA 5KMGP 3CK6A 5LMUT 4CN4A 2BBJA 1WYCA 4B3RT 3U78A 4JLEA 4KMCA 4ZI3C 2CHNA 2VKOA 3N9OA 5FVLA 1SHZC 3NWIA 5IYZE 5BMVE 3UUBA 2X51A 4NIQA 2JIWA 2VKJA 5JRCB 2BKOA 5HXHA 3ZYMA 4GK0E 3ZT6A 2D9DA 3E08A 2LJLA 5L3CB 4PK4A 4JI3T 1SA0E 2A3DA 2YKSA 1WCRA 4AISA 5LJNA 4CN1A 3AB3B 2CXFA 4ILBA 2M6IA 4F6RC 4X20E 3O1IA 5FXZA 4JI2T 4DMWA 4HEAA 3ZCIA 2HN2A 4YSXA 4LFCT 5HXRA 1JNRA 4LF9T 2V5CA 3H3AA 2IIUA 1SUMB 4HE8A 3ZMTB 3KDSE 5HXCA 2XUEA 4ZS2A 4ZOLE 3CWZB 3RPUA 1D1CA 5EK4A 2WDQA 2KWIB 3ZC0A 1EZ3A 4ILAA 4F8HA 3AEGA 2J47A 2ZMAA 2CWOA 4EAHA 4MBQA 4JEUB 2NOXA 2K5BB 4CI3B 1CUNA 3GA8A 3EABA 2OA5A 2NW7A 4HFHA 4HKAA 3ZJ1A 4H9QC 2J62A 3LG7A 4MHCA 2VKDA 3K8PC 3MA9A 4PJJA 4B3TT 3TLUA 5KX5E 4DIDB 5F8PA 3HKCE 4UF0B 3OYZA 2LOSA 5HYAA 3GN5B 4HWIB 2LT3A 1ZKEA 1W9RA 4HGAA 2UXBT 3ZYKA 4YT0A 3P4QA 2QRXA 2ZM2A 1YKHB 2YN6A 1IBKT 3ZPOA 4U2YA 4O2BE 2D0TA 1KNZA 4EV6A 1E7PA 2X9YA 4ASKA 3OYXA 5DQVA 2UXNB 2NP9A 3C4WA 3RKGA 3EDVA 2LRLA 5JR9B 4DV5T 4I0UA 5L3DB 3FZHB 5JTGA 5AQPB 4GIWA 1D0XA 1ZP0A 3ANWA 5AQQB 1I94T 4DV0T 3Q5EA 5TAOA 5FXWA 5IWAT 4IGUA 4GK5E 1MMNA 3RF1A 3MKDA 3FB2A 1IZNB 3I0OA 2X0LB 2WZHA 5JDNA 5J2TE 3P4PA 4U31A 4GKKT 4WBNE 3PU3A 5FVKA 4FI5A 4YSYA 1OWAA 2N9DA 3U3IA 2JQHA 2PTFA 1UCUA 2UXCT 2H3RA 2Y48B 3Q9DA 4EGWA 5C3JA 2VL0A 1IBMT 1BR0A 3ZC1A 4IDQA 5ABGA 4X5TA 3AE8A 4IREA 3LSVA 5LG4A 3QOFA 3ZSTA 2QVAA 5J2UE 2BG9A 1I6ZA 1MMAA 2VWAA 4AXPA 5AQFB 4DR1T 1KEYA 4TWHA 5LNKA 2LHNA 4O4LE 1Y01A 4IDZA 4UVCB 3Q5WA 4H9PC 4GKJT 5ABFA 4ZZCA 4ZEYA 1X9BA 1OXZA 3JC6C 5HCMA 3Q5XA 3PUZF 2Z6EA 4IIJE 5FKYA 2E8IA 3ZMSB 5KDMC 5C2TA 2Q9QD 3I1AA 3RYFE 2PFVA 1OEDE 3LBXA 3RIUA 5HCJA 5JDFA 3T1HT 2EHOA 2E2AA 4QXBB 5ETWA 1HNXT 3RHWA 4CQIA 4PK5A 3B57A 2XJ7A 2XAFB 3KV6A 3UQ7A 2LLYA 2SPCA 2W67A 1NWMX 5ADXL 3AE3A 2WWUA 5CA0E 5AFUL 2DHRA 1L0VA 2XQ9A 5JR9C 4OHFA 5FYMA 2LSGA 4TWDA 1WYBA 2IHR1 3F31A 4U7YA 5AQUB 4I50E 3AA7B 3O1HA 4DMVA 3LK42 1HNZT 3BQKA 3TLSA 3SFEA 2V26A 5JVDE 3VHLA 2X66A 5IUXA 4QKNA 4HFCA 4DR2T 3PUWF 3UTKA 4A97A 4L5GA 1MMDA 4U74A 3ZSSA 2N1GA 5F3JA 3CIRA 4HFVA 1N32T 2K24A 4I43B 2E9XA 4P0BA 3DTOA 4LFAT 5AQJB 4EB6E 2CXDA 1G8XA 4LF5T 3CKDA 2XQ8A 2RA1A 2H7VC 4IE7A 3Q5DA 4AKRB 3JAEA 4V1Av 2K3WA 4DUZT 3A5XA 3QB5A 4ZZBA 4CXWA 2XY8B 1KF6A 2LSIA 4L0RA 2LKGA 3DP7A 2ACZA 3RKOA 3C64A 3RQUA 5A1LA 3PUVF 4DVDA 1T7SA 4WBOA 4DR6T 2YU2A 4C90A 2KWHA 3LK3B 2IW5B 1IJ6A 4EZHA 2PJQA 4O4HE 3MK7C 2WU5A 3T1YT 1BR4A 4XZCA 4PJLA 2JMKA 2KINB 3O9XA 4MFRA 3WAKA 2HPJA 1N33T 3P7IA 2JMHA 2LEHA 4LMKA 3L39A 4AQFC 2F4VT 2WDRA 2W61A 3MJXA 3WAJA 3TLVA 3ZN1B 2ES0A 4YTNA 5JDQA 4ISTA 3OJAA 2VQET 3IA3A 3P8CD 3CQCB 1NENA 4KI0F 3AAIA 1MIYA 4DR7T 4TUYE 2WB5A 1IAPA 2LE8A 4OYJA 2AE9A 2JRKA 4PW8A 1YQ4A 2A9UA 4KX6A 1G73A 5LYJE 2W66A 3AE6A 1WLXA 2YDSA 2VURA 4OX9T 2KMFA 4JI5T 2MTQA 4ILUA 4YTMA 3BK9A 1Z0PA 2XQ5A 4U33A 4YJ2E 1J5ET 5HEUA 1WR0A 2ZM0A 4FJOA 2XSAA 3FBLA 4GYSA 5JREA 2B76A 5AQVB 4AI6A 3ETVA 1S94A 4DUYT 2XM1A 4AIUA 1XNRT 3CMLA 2FJDA 5FY1A 1V9DA 4YTPA 1XMOT 1MIWA 1LVKA 3N2KE 4X1YE 2E5LT 1QSDA 5HEOA 3I9YA 1FJGT 1B7TA 2XAJB 2XZEA 2XPKA 4QHOA 2IUBA 3FZMB 3AEAA 5JH7E 3MXZA 2VQFT 2YDRA 2D0UA 3CX6B 2WU2A 3KVAA 4BJNA 3AVRA 2W00A 3PDYA 5HXEA 2HHHT 2GK9A 3ZYLA 1HX1B 4M1PA 2NW9A 1FMWA 1KK7A 4LFBT 2YEVC 2YINA 4IE6A 2WCAA 3LJCA 4GOUA 2C0SA 1UGOA 1W0AA 3I9WA 4DO0A 5JDMA 2D2SA 3A8YC 3ONLC 5HWXA 5LP6E 3C51A 1Y64B 5M4YA 2NW8A 4LF8T 5LHIB 2CCQA 3BQIA 1WR6A 3AECA 5L3FB 4TWFA 4YY3T 1XDPA 3RC8A 1VCSA 3AXJB 5ABHA 2BDEA 4HFDA 5LG3A 1D0YA 4PJNA 3AVSA 4PJMA 3P4WA 5J0ZA 4QH4A 2MBGA 5AQIB 5AQSB 2J4GA 3OBVE 3UFEA 1UUSA 3GWHA 2EHOD 3EVYA 3N2OA 3P4RA 3VR9A 3PUQA 3PV0F 2V6XA 2LKHA 5AQTB 2XASB 3ONJA 4DBQA 4CXYA 3AE1A 3VR8A 4ZHQE 1KFYA 1NAFA 1VRBA 2LHRA 3F2EA 3OKQA 3T8OA 5FP3A 3IHRA 4UXNB 2N2NA 1HTJF 3FZLB 3CQXC 2WP9A 4ZI2D 4XBFB 2WMNA 1ZEEA 3PUAA 3CPZA 2IMLA 4KHZF 4X66T 1YKEB 2I6HA 3NVOA 3RYIE 3S4UA 2BG9E 2IC6A 3J9X1 3RH3A 2A2FX 2JQKA 3W15B 1YW0A 2LM2A 3LDQB 4HTEA 2E9XD 5EK2A 5JRCA 5L3BB 2CRBA 2ZM8A 2JQ9A 2K9AA 3QC9A 2CPTA 4YJ3E 3AEDA 3ZEFB 3SOLA 4TZ4C 1OEDB 5L2LA 1YD8G 1LRZA 3UT5E 2V7IA 3AA6B 5BR8T 5LGTB 5CJ5A 5JDGA 3PU8A 2LOPA 3BQLA 1HF8A 3ZMVB 2HPLA 2V1DB 3AA0B 2WDVA 3NKZA 2YDQA 1HG5A 4QH1A 1XWMA 4E7ZA 1LKXA 4UR9A 4GYRA 3SS1A 4HN9A 3ZN0B 3M3ZB 4PK6A 2W63A 2BG9C 1FMVA 3RQWA 4JI6T 3AEBA 3EI0A 5L3GB 5AQKB 5KXJA 2BKPA 3RC3A 2G0UA 4KBMB 2BVMA 4IE4A 2FUPA 3G06A 5FNVE 1IJ5A 4LMJA 2CE7A 4I4TE 3MZKB 4JEHB 1FEWA 2M6BA 5AQRB 4CI1B 2UXDT 4KP3C 1BR2A 2NWBA 4TN7B 3QB5K 5L3EB 2V5DA 4YHJA 2V6YB 3HKEE 1HR0T 2I59A 5AQNB 1QUUA 4DR5T 3FZKB 3EHZA 2BBHA 2CXLA 4EYUA 3X1DA 4UF0A 2Q9QB 3GN5A 1DU2A 2QGSA 3RIUC 5LJMA 5F5WA 2C5IT 1WRDA 4YSZA 4DV7T 4TNVA 2HH7A 1HS7A 2HN1A 3AE4A 1NEKA 3B5MA 4PFOA 2W4XA 3QUJA 2Y6XA 2KLQA 2W62A 4TV8E 5H6QB 1YQ3A 3KV9A 3N2GE 2C5JA 4U2ZA 5FXXA 4ISSA 4U7IA 5JR9A 1MMGA 2CWYA 4HFBA 2DWKA 2E5VA 4ZI3D 4QX8B 2C5KT 4UEMA 4B3MT 3ZMUB 3J7Yq 2NTYA 4AQYT 3N9MA 1OEDC 2VKHA 4I55E 4HWHA 2KZ7B 2P9BA 3ZLIA 4U3CA 2ZM6T 1HNWT 3H3MA 2KXPB 2XQ6A 3C98B 3TLTA 2XQ4A 1J5WA 2MAWA 3N5LA 1GQEA 5DQWA 4QXCB 4Z8XA 3FXDB 5GONE 2ACXA 3PJAA 4A5XA 2K48A 3RX6A 1T98A 3PUSA 3IBPA 4UELA 4IDOA 3UFGA 2B1EA 4KUMB 4NUUA 2QA7A 2LRKA 4IT4A 3ZCJA 1IBLT 1KNPA 4L9IA 3VKGA 5LHGB 4E7SA 1UX4A 2X9WA 4OK0A 2X67A 4H9RC 2UUBT 4DV3T 5LXTE 2WMOA 4AKGA 1HX8A 1O3XA 3VRAA 2LSYA 2H88A 3UUNA 4LF7T 4JBWF 4JI1T 2XQYA 2H7OA 3D0TA 3AE5A 1US7B 3C50A 2Q9QC 4JI7T 2XQ7A 3NZQA 4WW0A 2VL8A 3V5SA 2WBLA 4K0KT 4LF6T 3OVUA 2WWVA 4X62T 4JV5T 2FJEA 5LBQB 5E0OA 1XDOA 2XQ3A 1ZHCA 3A7MA 3ZMZB 2VK9A 4H9NC 4OYKA 4WNKA 3ABVA 5LMNT 3VRBA 5LOVE 3GMIA 5AQHB 3K3OA 4BAYB 1MIVA 5JDHA 4ZXLA 1M7KA 1VCTA 3Q2MA 3SFDA 5HEGA 3RLFF 3ANWB 2ODUA 2L8KA 4CN6A 2XSBA 3K3NA 4CXXA 5LHHB 4COFA 4EZ4A 5L4EA 3ETUA 4HFEA 4BA9A 1D0ZA 2VVSA 1UX5A 2Y8DA 4H9OC 4IHJE 4DNDA 4XAXB 2MYSA 2KNDA 3PUYF 1QLBA 3RRWA 4O2AE 3RIAA 1KNRA 3HKDE 5LGNB 4IDNA 1UURA 3M65A 4UVAB 1HG2A 4EEDA 2MOZA 3DJBA 4PFPA 2XHEB 5CB4E 3PJAJ 4EXTA 3K3QC 3OPCA 4CZZB 5CGMA 1E2AA 5DABA 4ZS3A 3AA1B 3JAFA 2YK0A 3ESLA 3PURA 4MALA 5L4HA 4Z91A 2BG9B 2VASA 4JI0T 1T72A 4IE0A 3UU6A 4QX7B 2FJBA 2WSSV 2WZIA 1MNEA 4YLHA 4A56A 2DI4A 4DV2T 1HCIA 2W0GA 3B13A 5ABFB 4ANJA 2WM9A 5LB7B 4P1NA 2BVLA 3KV5A 1MNDA 4OFZA 2QYWA 5AQLB 3C4XA 2UUAT 5L47A 2V8SV 3JC6D 2XAQB 1H7CA 4U72A 2CA5A 5FY7A 3UUMA 3HKBE 3QK6A 3FZFB 2CM0A 2BKNA 4P0AA 1ZV4X 3R84B 3LBXB 2WS3A 2EHOB 4AKLA 4DV1T 3C4ZA 2CMRA 2BZBA 3CVRA 3VU7H 2WAUA 3EUHA 4X1KE 4NPPA 5CA1E 5FL1A 3AEEA 1U4QA 2PBIA 3K1SA 3F57A 4G2AA 3AE2A 4NXNT 2NTXA 2DLRA 2X68A 4X64T 4DV4T 1S35A 4AKIA 2V7LA 3R6NA 1XZYA 3UQ4A 3E0ZA 4HWFA 4TNWA 3UUXB 3IEEA 1U5PA 3V5UA 2V7MA 2KT9A 2L3LA 2CEAA 3EDUA 2M67A 3AEFA 3AE9A 1D1BA 2RPAA 2E9XB 4YXDA 4QH5A 3UU3A 5LBMA 2D5UA 1M62A 2W2UA 4UIGA 2X0HA 2V7KA 3NRXA 3L3PA 4H63V 3HR0A 5AQOB 5DJQC 5LGUB 4H9SE 1R8IA 4JUYA 2NR4A 2I0MA 2JQQA 3UU4A 3MACA 5HXSA 2AXDS 4KHPT 3KBUA 2X0YA 2CLYB 4EIWA 3HI2A 4ZI7E 2LSKA 3L09A 5FMNA 1LVFA 1T8BA 3JADA 5EZYE 3RYHE 3I0QA 2LSJA 4YHHT 4EOZB 4NUVA 3ZT5A 5IHYA 2LM9A 3PTRB 1JNZA 2RP4A 3ZT7A 4MLKA 4A98A 4JYAT 1VOMA 5HWYA 3O4XE 4C91A 3CQGB 4EEBA 2A72A 2BS2A 2FJAA 3UU5A 4O8SA 4QXHB 4HFIA 3HL6A 2CBJA 4TX5A 2UUCT 4WZXA 3RIFA 2FBWA 3AXJA 2XM2A 5H6RB 4LF4T 1UK5A 4DV6T 4IL4A 3HA4A 3LK2B 1W09A 3FHNA 3FBZA 3RGLA 2ZLYA 4BJMA 3KV4A 4PNIA 2EHOC 3EAMA 2WQYA 5HEHA 2KSRA 2DL1A 1D1AA 3SWHA 2ODVA 4H63H 3WI3A 2DCFA 3ONXA 3CX7B 3L8RA 3PUGA 4JI8T 3NRYA 4J2CA 3KFWX 3N9NA 4Q25A 2XAHB 5LA6E 3AE7A 1X79A 4X65T 3N9QA 2PG8A 4DR4T 4DBRA 1N36T 1FIOA 4ZI2C 1YXRA 2UXXB 1WFDA 3IF8B 5EK3A 2WY2A 5JDLA 4O4IE 3LFMA 5CFBA 2DNXA 5FY0A 2XAGB 2R6GF 3RI5A 2CHOA 2MPKA 5LCYA 4CI2B 5AQMB 3H37A 1ZOYA 5HEJA 2E9XC 1N34T 1HFAA 3P50A 1Z8UA 5JQGE 5FL0A 5J1GA 3TLWA 4AKHA 3AAAB 4LMLA 5FXVA 4IE5A 2OV9A 4NXMT 4ILCA 1OEDA 4UV8B 2BS4A 2VVNA 3O1JA 4ADZA 4Z90A 4IL9A 1BR1A 3PUXF 2CLYC 4JI4T 2X9XA 3KINB 3FXEB 2IDOB 1CHUA 2L9QA 4P09A 2IAKA 3PE0A 4YFSA 2X9HA 4B6XA 3NBXX 4G63A 4B3ST 3ZJ2A 1XNQT 2JPFA 3AAEB 2BS3A 3E22E 3VKHA 3OTOT 4TV9E 1W0BA 2UU9T 4AQGA 2CBIA 3RRCA 2H89A 4UV9B 3KBTA 3UU8A 3P4SA 3TKLB 3N9PA 4K0UA 1J1JA 4AQFA 3ZKRA 3RYCE 3NZPA 1AJ3A 4O4JE 2OLTA 2V6YA 4UVBB 4EYYR 1SE7A 3KVBA 2XQAA 3N9LA 4PAGA 4ERRA 3JCFA 2JJ9A 2Q9QA 3QNUA 4N78D 4X1IE
chains in the Genus database with same CATH topology
5LGTB 3BQKA 5HAXA 2VB6A 1E1HB 5JDGA 5C8YE 2IC9A 3SRZA 3UULA 1HCIA 2V26A 2XTLA 5JVDE 3PU8A 2LOPA 3BQLA 3VHLA 1HF8A 3ZMVB 2HPLA 2V1DB 2X66A 3AA0B 4QKNA 2W0GA 3UTKA 3B13A 4L5GA 1HG5A 4E7ZA 1LKXA 1MMDA 4U74A 2V7JA 2N1GA 5F3JA 4GYRA 4QWNB 4ANJA 4HFVA 3SS1A 2WM9A 4HN9A 3ZN0B 2BVLA 3KV5A 2YU1A 1MNDA 4OFZA 2K24A 4I43B 4PK6A 2J1DG 2E9XA 2W63A 4P0BA 3DTOA 3C4XA 4EB6E 2CXDA 1G8XA 3CKDA 2RA1A 1FMVA 2H7VC 3JC6D 2XAQB 3CX8B 1H7CA 2DWGA 5KMGP 5L3GB 4U72A 2CA5A 4IE7A 4AKRB 5FY7A 3RC3A 2G0UA 3HKBE 3UUMA 4KBMB 4V1Av 1WYCA 2BVMA 3QK6A 3A5XA 3U78A 2CM0A 4JLEA 4IE4A 4P0AA 1ZV4X 4KMCA 4CXWA 4ZI3C 3R84B 2VKOA 3N9OA 1IJ5A 5FNVE 2LSIA 3LBXB 2CE7A 4I4TE 2EHOB 4L0RA 4AKLA 1SHZC 3MZKB 4JEHB 3DP7A 5IYZE 3C4ZA 2CMRA 1FEWA 3RKOA 3C64A 2BZBA 4CI1B 5A1LA 3CVRA 4DVDA 3VU7H 5BMVE 4WBOA 4KP3C 2WAUA 3EUHA 1BR2A 2NWBA 2X51A 2YU2A 4X1KE 4TN7B 2VKJA 5L3EB 5CA1E 4C90A 2KWHA 5JRCB 3LK3B 2IW5B 1IJ6A 1U4QA 4YHJA 4EZHA 5HXHA 2PBIA 2PJQA 4O4HE 3MK7C 3F57A 4G2AA 3ZYMA 2NTXA 3HKEE 1BR4A 4GK0E 4XZCA 4PJLA 3E08A 2LJLA 5L3CB 2DLRA 4PK4A 2I59A 1SA0E 1QUUA 2A3DA 2X68A 1S35A 4AKIA 2JMKA 2CXLA 2KINB 2V7LA 3O9XA 4EYUA 5LJNA 4UF0A 4MFRA 2Q9QB 3WAKA 3R6NA 3AB3B 3GN5A 2CXFA 2HPJA 3E0ZA 2QGSA 3P7IA 5LJMA 2JMHA 2LEHA 2C5IT 3UUXB 1WRDA 3IEEA 1U5PA 4F6RC 4X20E 3V5UA 2V7MA 3O1IA 5FXZA 4DMWA 4HEAA 2KT9A 3ZCIA 2L3LA 2CEAA 3EDUA 4AQFC 5HXRA 2HH7A 1HS7A 3H3AA 2M67A 4PFOA 4HE8A 3ZMTB 2W61A 3MJXA 3KDSE 3QUJA 3WAJA 1D1BA 2Y6XA 5HXCA 2XUEA 2KLQA 2W62A 4TV8E 5H6QB 3ZN1B 4ZS2A 2E9XB 3KV9A 2ES0A 3N2GE 5JDQA 4ZOLE 4ISTA 3CWZB 5LBMA 3OJAA 2D5UA 3RPUA 1D1CA 2C5JA 5EK4A 5FXXA 3P8CD 2KWIB 3CQCB 3ZC0A 1EZ3A 4ISSA 3AAIA 4UIGA 2V7KA 3NRXA 3L3PA 4H63V 5JR9A 1MMGA 2CWYA 3HR0A 1MIYA 2ZMAA 4TUYE 2CWOA 5DJQC 4EAHA 4MBQA 2DWKA 1IAPA 2LE8A 4H9SE 4JEUB 5LGUB 4JUYA 2JQQA 4OYJA 2JRKA 2NOXA 4PW8A 3MACA 5HXSA 4ZI3D 2K5BB 4QX8B 1G73A 2C5KT 4CI3B 3KBUA 4UEMA 1CUNA 5LYJE 3ZMUB 3GA8A 2CLYB 3J7Yq 2OA5A 2NTYA 2NW7A 4EIWA 3HI2A 4HKAA 3ZJ1A 4ZI7E 1WLXA 2LSKA 4H9QC 3N9MA 3LG7A 2VKHA 3L09A 4I55E 4MHCA 5FMNA 1LVFA 2VKDA 2KZ7B 3K8PC 2KMFA 2MTQA 2P9BA 4ILUA 5EZYE 3MA9A 3RYHE 3I0QA 2LSJA 3BK9A 4PJJA 3ZLIA 1Z0PA 4EOZB 4NUVA 4YJ2E 5KX5E 5IHYA 5F8PA 2KXPB 2LM9A 2ZM0A 3PTRB 3HKCE 4UF0B 3C98B 4FJOA 3OYZA 2LOSA 2RP4A 5HYAA 3GN5B 4MLKA 3N5LA 3FBLA 1VOMA 4GYSA 2LT3A 5HWYA 5JREA 1ZKEA 3O4XE 5DQWA 4HGAA 4C91A 4QXCB 4Z8XA 3CQGB 3ZYKA 2A72A 3FXDB 4AI6A 5GONE 2ACXA 3ETVA 4O8SA 1S94A 4QXHB 2ZM2A 1YKHB 3HL6A 4TX5A 2K48A 3CMLA 3RX6A 3ZPOA 1T98A 3PUSA 5FY1A 1V9DA 3IBPA 4O2BE 4UELA 5H6RB 2D0TA 1KNZA 1MIWA 1LVKA 3N2KE 2B1EA 4KUMB 4NUUA 2QA7A 4X1YE 3HA4A 3LK2B 1QSDA 3ZCJA 2X9YA 3FHNA 3FBZA 4ASKA 2ZLYA 3OYXA 5DQVA 2UXNB 2NP9A 4BJMA 4L9IA 3KV4A 3VKGA 3I9YA 3C4WA 5LHGB 4E7SA 1UX4A 3EDVA 4PNIA 2EHOC 2X9WA 5JR9B 4OK0A 2X67A 1B7TA 1D1AA 2XAJB 3SWHA 5L3DB 2ODVA 4H63H 3WI3A 2DCFA 4QHOA 4GIWA 1D0XA 3ANWA 4H9RC 3ONXA 3CX7B 4A56A 3PUGA 5JH7E 3MXZA 3NRYA 4J2CA 5LXTE 2WMOA 5TAOA 4AKGA 3KFWX 3N9NA 1HX8A 5FXWA 2D0UA 3CX6B 1O3XA 3KVAA 4IGUA 4BJNA 2XAHB 5LA6E 3AVRA 2W00A 4GK5E 1MMNA 2LSYA 1X79A 3MKDA 3FB2A 3UUNA 1IZNB 2XQYA 3I0OA 3PDYA 3N9QA 2H7OA 2X0LB 5HXEA 2PG8A 2GK9A 3ZYLA 4DBRA 5JDNA 3D0TA 1FIOA 1US7B 4M1PA 2NW9A 3C50A 2Q9QC 1FMWA 4ZI2C 5J2TE 1KK7A 4WBNE 3PU3A 2YEVC 4WW0A 3NZQA 2YINA 2UXXB 4IE6A 3LJCA 3IF8B 4FI5A 2VL8A 4GOUA 2C0SA 5EK3A 3V5SA 5JDLA 4O4IE 3LFMA 3I9WA 2WBLA 2DNXA 4DO0A 5JDMA 1OWAA 2D2SA 2N9DA 5FY0A 3U3IA 2XAGB 1UCUA 5HWXA 5LCYA 5LP6E 3C51A 1Y64B 4CI2B 2H3RA 3H37A 5M4YA 2Y48B 2NW8A 3Q9DA 5LHIB 2CCQA 2E9XC 3BQIA 1HFAA 5LBQB 5JQGE 5E0OA 1WR6A 5L3FB 1BR0A 3RC8A 5J1GA 3ZC1A 1ZHCA 4AKHA 3AAAB 2VK9A 4H9NC 2BDEA 4OYKA 5FXVA 4IE5A 4WNKA 3ZMZB 5LG4A 1D0YA 5LOVE 3GMIA 3K3OA 4BAYB 4PJNA 3AVSA 1MIVA 5J2UE 4PJMA 4UV8B 5JDHA 1MMAA 2VWAA 4AXPA 2MBGA 3Q2MA 3OBVE 3O1JA 3UFEA 4ADZA 1BR1A 3GWHA 2CLYC 2EHOD 5LNKA 3ANWB 3EVYA 2LHNA 4O4LE 3N2OA 4IDZA 2ODUA 2L8KA 2X9XA 3KINB 4UVCB 3FXEB 3PUQA 3Q5WA 4H9PC 2L9QA 4P09A 2IAKA 3K3NA 3PE0A 4YFSA 4CXXA 5LHHB 2XASB 2X9HA 4DBQA 4CXYA 4EZ4A 4B6XA 1OXZA 3ETUA 3JC6C 4BA9A 3Q5XA 4ZHQE 3NBXX 4G63A 1NAFA 1D0ZA 1VRBA 2LHRA 3F2EA 3OKQA 3T8OA 2Y8DA 1UX5A 2Z6EA 3IHRA 2JPFA 3AAEB 4IIJE 5FP3A 3ZJ2A 4H9OC 2E8IA 3ZMSB 4IHJE 4UXNB 3E22E 2N2NA 1HTJF 4XAXB 2MYSA 4DNDA 5KDMC 3VKHA 3CQXC 4TV9E 2KNDA 2Q9QD 4ZI2D 4XBFB 2WMNA 3I1AA 4AQGA 1ZEEA 3RRWA 3PUAA 3CPZA 4O2AE 3RRCA 4UV9B 1YKEB 3KBTA 3RYFE 2PFVA 3HKDE 3TKLB 3RYIE 3S4UA 5LGNB 3LBXA 2IC6A 5JDFA 3M65A 3N9PA 4UVAB 2EHOA 1HG2A 3J9X1 3RH3A 2A2FX 2MOZA 4QXBB 4K0UA 3W15B 3DJBA 4PFPA 5ETWA 1YW0A 2XHEB 4AQFA 4CQIA 4PK5A 3B57A 4HTEA 5CB4E 2XAFB 4EXTA 3KV6A 2E9XD 3K3QC 5EK2A 5JRCA 3RYCE 2SPCA 3NZPA 5L3BB 1NWMX 1AJ3A 5ADXL 2WWUA 5DABA 4ZS3A 4CZZB 5CA0E 5AFUL 2ZM8A 3AA1B 4O4JE 2K9AA 2DHRA 3QC9A 4UVBB 4YJ3E 4EYYR 5JR9C 3ZEFB 2YK0A 3ESLA 3KVBA 3PURA 4MALA 4OHFA 4TZ4C 5FYMA 3SOLA 2LSGA 5L2LA 2VASA 1WYBA 1YD8G 3F31A 3N9LA 4IE0A 1LRZA 3UT5E 4QX7B 2V7IA 2WSSV 3AA6B 4I50E 1MNEA 3AA7B 4PAGA 4ERRA 3O1HA 2JJ9A 2Q9QA 4YLHA 4DMVA 2DI4A 4N78D 3LK42 4X1IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C51 A;  3C50 A;  3C4X A;  1SHZ C;  3CX7 B;  2DLR A;  2I59 A;  3C4Z A;  3CX8 B;  1IAP A;  3QC9 A;  4WBO A;  4GOU A;  3CX6 B;  2A72 A;  3AB3 B;  4IGU A;  4L9I A;  2ACX A;  2ES0 A;  3T8O A;  3C4W A;  4WNK A;  4PNI A;  1HTJ F;  1ZV4 X;  4YHJ A;  2PBI A; 
#chains in the Genus database with same CATH topology
 5HAX A;  2YOE A;  2VB6 A;  1E1H B;  5C8Y E;  2IC9 A;  3SRZ A;  3UUL A;  2XTL A;  1XMQ T;  4HWD A;  5AQG B;  2V7J A;  4QWN B;  4HWC A;  4WYV A;  2YU1 A;  4DR3 T;  5ABE A;  2J1D G;  4IDP A;  3CX8 B;  2DWG A;  5KMG P;  3CK6 A;  5LMU T;  4CN4 A;  2BBJ A;  1WYC A;  4B3R T;  3U78 A;  4JLE A;  4KMC A;  4ZI3 C;  2CHN A;  2VKO A;  3N9O A;  5FVL A;  1SHZ C;  3NWI A;  5IYZ E;  5BMV E;  3UUB A;  2X51 A;  4NIQ A;  2JIW A;  2VKJ A;  5JRC B;  2BKO A;  5HXH A;  3ZYM A;  4GK0 E;  3ZT6 A;  2D9D A;  3E08 A;  2LJL A;  5L3C B;  4PK4 A;  4JI3 T;  1SA0 E;  2A3D A;  2YKS A;  1WCR A;  4AIS A;  5LJN A;  4CN1 A;  3AB3 B;  2CXF A;  4ILB A;  2M6I A;  4F6R C;  4X20 E;  3O1I A;  5FXZ A;  4JI2 T;  4DMW A;  4HEA A;  3ZCI A;  2HN2 A;  4YSX A;  4LFC T;  5HXR A;  1JNR A;  4LF9 T;  2V5C A;  3H3A A;  2IIU A;  1SUM B;  4HE8 A;  3ZMT B;  3KDS E;  5HXC A;  2XUE A;  4ZS2 A;  4ZOL E;  3CWZ B;  3RPU A;  1D1C A;  5EK4 A;  2WDQ A;  2KWI B;  3ZC0 A;  1EZ3 A;  4ILA A;  4F8H A;  3AEG A;  2J47 A;  2ZMA A;  2CWO A;  4EAH A;  4MBQ A;  4JEU B;  2NOX A;  2K5B B;  4CI3 B;  1CUN A;  3GA8 A;  3EAB A;  2OA5 A;  2NW7 A;  4HFH A;  4HKA A;  3ZJ1 A;  4H9Q C;  2J62 A;  3LG7 A;  4MHC A;  2VKD A;  3K8P C;  3MA9 A;  4PJJ A;  4B3T T;  3TLU A;  5KX5 E;  4DID B;  5F8P A;  3HKC E;  4UF0 B;  3OYZ A;  2LOS A;  5HYA A;  3GN5 B;  4HWI B;  2LT3 A;  1ZKE A;  1W9R A;  4HGA A;  2UXB T;  3ZYK A;  4YT0 A;  3P4Q A;  2QRX A;  2ZM2 A;  1YKH B;  2YN6 A;  1IBK T;  3ZPO A;  4U2Y A;  4O2B E;  2D0T A;  1KNZ A;  4EV6 A;  1E7P A;  2X9Y A;  4ASK A;  3OYX A;  5DQV A;  2UXN B;  2NP9 A;  3C4W A;  3RKG A;  3EDV A;  2LRL A;  5JR9 B;  4DV5 T;  4I0U A;  5L3D B;  3FZH B;  5JTG A;  5AQP B;  4GIW A;  1D0X A;  1ZP0 A;  3ANW A;  5AQQ B;  1I94 T;  4DV0 T;  3Q5E A;  5TAO A;  5FXW A;  5IWA T;  4IGU A;  4GK5 E;  1MMN A;  3RF1 A;  3MKD A;  3FB2 A;  1IZN B;  3I0O A;  2X0L B;  2WZH A;  5JDN A;  5J2T E;  3P4P A;  4U31 A;  4GKK T;  4WBN E;  3PU3 A;  5FVK A;  4FI5 A;  4YSY A;  1OWA A;  2N9D A;  3U3I A;  2JQH A;  2PTF A;  1UCU A;  2UXC T;  2H3R A;  2Y48 B;  3Q9D A;  4EGW A;  5C3J A;  2VL0 A;  1IBM T;  1BR0 A;  3ZC1 A;  4IDQ A;  5ABG A;  4X5T A;  3AE8 A;  4IRE A;  3LSV A;  5LG4 A;  3QOF A;  3ZST A;  2QVA A;  5J2U E;  2BG9 A;  1I6Z A;  1MMA A;  2VWA A;  4AXP A;  5AQF B;  4DR1 T;  1KEY A;  4TWH A;  5LNK A;  2LHN A;  4O4L E;  1Y01 A;  4IDZ A;  4UVC B;  3Q5W A;  4H9P C;  4GKJ T;  5ABF A;  4ZZC A;  4ZEY A;  1X9B A;  1OXZ A;  3JC6 C;  5HCM A;  3Q5X A;  3PUZ F;  2Z6E A;  4IIJ E;  5FKY A;  2E8I A;  3ZMS B;  5KDM C;  5C2T A;  2Q9Q D;  3I1A A;  3RYF E;  2PFV A;  1OED E;  3LBX A;  3RIU A;  5HCJ A;  5JDF A;  3T1H T;  2EHO A;  2E2A A;  4QXB B;  5ETW A;  1HNX T;  3RHW A;  4CQI A;  4PK5 A;  3B57 A;  2XJ7 A;  2XAF B;  3KV6 A;  3UQ7 A;  2LLY A;  2SPC A;  2W67 A;  1NWM X;  5ADX L;  3AE3 A;  2WWU A;  5CA0 E;  5AFU L;  2DHR A;  1L0V A;  2XQ9 A;  5JR9 C;  4OHF A;  5FYM A;  2LSG A;  4TWD A;  1WYB A;  2IHR 1;  3F31 A;  4U7Y A;  5AQU B;  4I50 E;  3AA7 B;  3O1H A;  4DMV A;  3LK4 2;  1HNZ T;  3BQK A;  3TLS A;  3SFE A;  2V26 A;  5JVD E;  3VHL A;  2X66 A;  5IUX A;  4QKN A;  4HFC A;  4DR2 T;  3PUW F;  3UTK A;  4A97 A;  4L5G A;  1MMD A;  4U74 A;  3ZSS A;  2N1G A;  5F3J A;  3CIR A;  4HFV A;  1N32 T;  2K24 A;  4I43 B;  2E9X A;  4P0B A;  3DTO A;  4LFA T;  5AQJ B;  4EB6 E;  2CXD A;  1G8X A;  4LF5 T;  3CKD A;  2XQ8 A;  2RA1 A;  2H7V C;  4IE7 A;  3Q5D A;  4AKR B;  3JAE A;  4V1A v;  2K3W A;  4DUZ T;  3A5X A;  3QB5 A;  4ZZB A;  4CXW A;  2XY8 B;  1KF6 A;  2LSI A;  4L0R A;  2LKG A;  3DP7 A;  2ACZ A;  3RKO A;  3C64 A;  3RQU A;  5A1L A;  3PUV F;  4DVD A;  1T7S A;  4WBO A;  4DR6 T;  2YU2 A;  4C90 A;  2KWH A;  3LK3 B;  2IW5 B;  1IJ6 A;  4EZH A;  2PJQ A;  4O4H E;  3MK7 C;  2WU5 A;  3T1Y T;  1BR4 A;  4XZC A;  4PJL A;  2JMK A;  2KIN B;  3O9X A;  4MFR A;  3WAK A;  2HPJ A;  1N33 T;  3P7I A;  2JMH A;  2LEH A;  4LMK A;  3L39 A;  4AQF C;  2F4V T;  2WDR A;  2W61 A;  3MJX A;  3WAJ A;  3TLV A;  3ZN1 B;  2ES0 A;  4YTN A;  5JDQ A;  4IST A;  3OJA A;  2VQE T;  3IA3 A;  3P8C D;  3CQC B;  1NEN A;  4KI0 F;  3AAI A;  1MIY A;  4DR7 T;  4TUY E;  2WB5 A;  1IAP A;  2LE8 A;  4OYJ A;  2AE9 A;  2JRK A;  4PW8 A;  1YQ4 A;  2A9U A;  4KX6 A;  1G73 A;  5LYJ E;  2W66 A;  3AE6 A;  1WLX A;  2YDS A;  2VUR A;  4OX9 T;  2KMF A;  4JI5 T;  2MTQ A;  4ILU A;  4YTM A;  3BK9 A;  1Z0P A;  2XQ5 A;  4U33 A;  4YJ2 E;  1J5E T;  5HEU A;  1WR0 A;  2ZM0 A;  4FJO A;  2XSA A;  3FBL A;  4GYS A;  5JRE A;  2B76 A;  5AQV B;  4AI6 A;  3ETV A;  1S94 A;  4DUY T;  2XM1 A;  4AIU A;  1XNR T;  3CML A;  2FJD A;  5FY1 A;  1V9D A;  4YTP A;  1XMO T;  1MIW A;  1LVK A;  3N2K E;  4X1Y E;  2E5L T;  1QSD A;  5HEO A;  3I9Y A;  1FJG T;  1B7T A;  2XAJ B;  2XZE A;  2XPK A;  4QHO A;  2IUB A;  3FZM B;  3AEA A;  5JH7 E;  3MXZ A;  2VQF T;  2YDR A;  2D0U A;  3CX6 B;  2WU2 A;  3KVA A;  4BJN A;  3AVR A;  2W00 A;  3PDY A;  5HXE A;  2HHH T;  2GK9 A;  3ZYL A;  1HX1 B;  4M1P A;  2NW9 A;  1FMW A;  1KK7 A;  4LFB T;  2YEV C;  2YIN A;  4IE6 A;  2WCA A;  3LJC A;  4GOU A;  2C0S A;  1UGO A;  1W0A A;  3I9W A;  4DO0 A;  5JDM A;  2D2S A;  3A8Y C;  3ONL C;  5HWX A;  5LP6 E;  3C51 A;  1Y64 B;  5M4Y A;  2NW8 A;  4LF8 T;  5LHI B;  2CCQ A;  3BQI A;  1WR6 A;  3AEC A;  5L3F B;  4TWF A;  4YY3 T;  1XDP A;  3RC8 A;  1VCS A;  3AXJ B;  5ABH A;  2BDE A;  4HFD A;  5LG3 A;  1D0Y A;  4PJN A;  3AVS A;  4PJM A;  3P4W A;  5J0Z A;  4QH4 A;  2MBG A;  5AQI B;  5AQS B;  2J4G A;  3OBV E;  3UFE A;  1UUS A;  3GWH A;  2EHO D;  3EVY A;  3N2O A;  3P4R A;  3VR9 A;  3PUQ A;  3PV0 F;  2V6X A;  2LKH A;  5AQT B;  2XAS B;  3ONJ A;  4DBQ A;  4CXY A;  3AE1 A;  3VR8 A;  4ZHQ E;  1KFY A;  1NAF A;  1VRB A;  2LHR A;  3F2E A;  3OKQ A;  3T8O A;  5FP3 A;  3IHR A;  4UXN B;  2N2N A;  1HTJ F;  3FZL B;  3CQX C;  2WP9 A;  4ZI2 D;  4XBF B;  2WMN A;  1ZEE A;  3PUA A;  3CPZ A;  2IML A;  4KHZ F;  4X66 T;  1YKE B;  2I6H A;  3NVO A;  3RYI E;  3S4U A;  2BG9 E;  2IC6 A;  3J9X 1;  3RH3 A;  2A2F X;  2JQK A;  3W15 B;  1YW0 A;  2LM2 A;  3LDQ B;  4HTE A;  2E9X D;  5EK2 A;  5JRC A;  5L3B B;  2CRB A;  2ZM8 A;  2JQ9 A;  2K9A A;  3QC9 A;  2CPT A;  4YJ3 E;  3AED A;  3ZEF B;  3SOL A;  4TZ4 C;  1OED B;  5L2L A;  1YD8 G;  1LRZ A;  3UT5 E;  2V7I A;  3AA6 B;  5BR8 T;  5LGT B;  5CJ5 A;  5JDG A;  3PU8 A;  2LOP A;  3BQL A;  1HF8 A;  3ZMV B;  2HPL A;  2V1D B;  3AA0 B;  2WDV A;  3NKZ A;  2YDQ A;  1HG5 A;  4QH1 A;  1XWM A;  4E7Z A;  1LKX A;  4UR9 A;  4GYR A;  3SS1 A;  4HN9 A;  3ZN0 B;  3M3Z B;  4PK6 A;  2W63 A;  2BG9 C;  1FMV A;  3RQW A;  4JI6 T;  3AEB A;  3EI0 A;  5L3G B;  5AQK B;  5KXJ A;  2BKP A;  3RC3 A;  2G0U A;  4KBM B;  2BVM A;  4IE4 A;  2FUP A;  3G06 A;  5FNV E;  1IJ5 A;  4LMJ A;  2CE7 A;  4I4T E;  3MZK B;  4JEH B;  1FEW A;  2M6B A;  5AQR B;  4CI1 B;  2UXD T;  4KP3 C;  1BR2 A;  2NWB A;  4TN7 B;  3QB5 K;  5L3E B;  2V5D A;  4YHJ A;  2V6Y B;  3HKE E;  1HR0 T;  2I59 A;  5AQN B;  1QUU A;  4DR5 T;  3FZK B;  3EHZ A;  2BBH A;  2CXL A;  4EYU A;  3X1D A;  4UF0 A;  2Q9Q B;  3GN5 A;  1DU2 A;  2QGS A;  3RIU C;  5LJM A;  5F5W A;  2C5I T;  1WRD A;  4YSZ A;  4DV7 T;  4TNV A;  2HH7 A;  1HS7 A;  2HN1 A;  3AE4 A;  1NEK A;  3B5M A;  4PFO A;  2W4X A;  3QUJ A;  2Y6X A;  2KLQ A;  2W62 A;  4TV8 E;  5H6Q B;  1YQ3 A;  3KV9 A;  3N2G E;  2C5J A;  4U2Z A;  5FXX A;  4ISS A;  4U7I A;  5JR9 A;  1MMG A;  2CWY A;  4HFB A;  2DWK A;  2E5V A;  4ZI3 D;  4QX8 B;  2C5K T;  4UEM A;  4B3M T;  3ZMU B;  3J7Y q;  2NTY A;  4AQY T;  3N9M A;  1OED C;  2VKH A;  4I55 E;  4HWH A;  2KZ7 B;  2P9B A;  3ZLI A;  4U3C A;  2ZM6 T;  1HNW T;  3H3M A;  2KXP B;  2XQ6 A;  3C98 B;  3TLT A;  2XQ4 A;  1J5W A;  2MAW A;  3N5L A;  1GQE A;  5DQW A;  4QXC B;  4Z8X A;  3FXD B;  5GON E;  2ACX A;  3PJA A;  4A5X A;  2K48 A;  3RX6 A;  1T98 A;  3PUS A;  3IBP A;  4UEL A;  4IDO A;  3UFG A;  2B1E A;  4KUM B;  4NUU A;  2QA7 A;  2LRK A;  4IT4 A;  3ZCJ A;  1IBL T;  1KNP A;  4L9I A;  3VKG A;  5LHG B;  4E7S A;  1UX4 A;  2X9W A;  4OK0 A;  2X67 A;  4H9R C;  2UUB T;  4DV3 T;  5LXT E;  2WMO A;  4AKG A;  1HX8 A;  1O3X A;  3VRA A;  2LSY A;  2H88 A;  3UUN A;  4LF7 T;  4JBW F;  4JI1 T;  2XQY A;  2H7O A;  3D0T A;  3AE5 A;  1US7 B;  3C50 A;  2Q9Q C;  4JI7 T;  2XQ7 A;  3NZQ A;  4WW0 A;  2VL8 A;  3V5S A;  2WBL A;  4K0K T;  4LF6 T;  3OVU A;  2WWV A;  4X62 T;  4JV5 T;  2FJE A;  5LBQ B;  5E0O A;  1XDO A;  2XQ3 A;  1ZHC A;  3A7M A;  3ZMZ B;  2VK9 A;  4H9N C;  4OYK A;  4WNK A;  3ABV A;  5LMN T;  3VRB A;  5LOV E;  3GMI A;  5AQH B;  3K3O A;  4BAY B;  1MIV A;  5JDH A;  4ZXL A;  1M7K A;  1VCT A;  3Q2M A;  3SFD A;  5HEG A;  3RLF F;  3ANW B;  2ODU A;  2L8K A;  4CN6 A;  2XSB A;  3K3N A;  4CXX A;  5LHH B;  4COF A;  4EZ4 A;  5L4E A;  3ETU A;  4HFE A;  4BA9 A;  1D0Z A;  2VVS A;  1UX5 A;  2Y8D A;  4H9O C;  4IHJ E;  4DND A;  4XAX B;  2MYS A;  2KND A;  3PUY F;  1QLB A;  3RRW A;  4O2A E;  3RIA A;  1KNR A;  3HKD E;  5LGN B;  4IDN A;  1UUR A;  3M65 A;  4UVA B;  1HG2 A;  4EED A;  2MOZ A;  3DJB A;  4PFP A;  2XHE B;  5CB4 E;  3PJA J;  4EXT A;  3K3Q C;  3OPC A;  4CZZ B;  5CGM A;  1E2A A;  5DAB A;  4ZS3 A;  3AA1 B;  3JAF A;  2YK0 A;  3ESL A;  3PUR A;  4MAL A;  5L4H A;  4Z91 A;  2BG9 B;  2VAS A;  4JI0 T;  1T72 A;  4IE0 A;  3UU6 A;  4QX7 B;  2FJB A;  2WSS V;  2WZI A;  1MNE A;  4YLH A;  4A56 A;  2DI4 A;  4DV2 T;  1HCI A;  2W0G A;  3B13 A;  5ABF B;  4ANJ A;  2WM9 A;  5LB7 B;  4P1N A;  2BVL A;  3KV5 A;  1MND A;  4OFZ A;  2QYW A;  5AQL B;  3C4X A;  2UUA T;  5L47 A;  2V8S V;  3JC6 D;  2XAQ B;  1H7C A;  4U72 A;  2CA5 A;  5FY7 A;  3UUM A;  3HKB E;  3QK6 A;  3FZF B;  2CM0 A;  2BKN A;  4P0A A;  1ZV4 X;  3R84 B;  3LBX B;  2WS3 A;  2EHO B;  4AKL A;  4DV1 T;  3C4Z A;  2CMR A;  2BZB A;  3CVR A;  3VU7 H;  2WAU A;  3EUH A;  4X1K E;  4NPP A;  5CA1 E;  5FL1 A;  3AEE A;  1U4Q A;  2PBI A;  3K1S A;  3F57 A;  4G2A A;  3AE2 A;  4NXN T;  2NTX A;  2DLR A;  2X68 A;  4X64 T;  4DV4 T;  1S35 A;  4AKI A;  2V7L A;  3R6N A;  1XZY A;  3UQ4 A;  3E0Z A;  4HWF A;  4TNW A;  3UUX B;  3IEE A;  1U5P A;  3V5U A;  2V7M A;  2KT9 A;  2L3L A;  2CEA A;  3EDU A;  2M67 A;  3AEF A;  3AE9 A;  1D1B A;  2RPA A;  2E9X B;  4YXD A;  4QH5 A;  3UU3 A;  5LBM A;  2D5U A;  1M62 A;  2W2U A;  4UIG A;  2X0H A;  2V7K A;  3NRX A;  3L3P A;  4H63 V;  3HR0 A;  5AQO B;  5DJQ C;  5LGU B;  4H9S E;  1R8I A;  4JUY A;  2NR4 A;  2I0M A;  2JQQ A;  3UU4 A;  3MAC A;  5HXS A;  2AXD S;  4KHP T;  3KBU A;  2X0Y A;  2CLY B;  4EIW A;  3HI2 A;  4ZI7 E;  2LSK A;  3L09 A;  5FMN A;  1LVF A;  1T8B A;  3JAD A;  5EZY E;  3RYH E;  3I0Q A;  2LSJ A;  4YHH T;  4EOZ B;  4NUV A;  3ZT5 A;  5IHY A;  2LM9 A;  3PTR B;  1JNZ A;  2RP4 A;  3ZT7 A;  4MLK A;  4A98 A;  4JYA T;  1VOM A;  5HWY A;  3O4X E;  4C91 A;  3CQG B;  4EEB A;  2A72 A;  2BS2 A;  2FJA A;  3UU5 A;  4O8S A;  4QXH B;  4HFI A;  3HL6 A;  2CBJ A;  4TX5 A;  2UUC T;  4WZX A;  3RIF A;  2FBW A;  3AXJ A;  2XM2 A;  5H6R B;  4LF4 T;  1UK5 A;  4DV6 T;  4IL4 A;  3HA4 A;  3LK2 B;  1W09 A;  3FHN A;  3FBZ A;  3RGL A;  2ZLY A;  4BJM A;  3KV4 A;  4PNI A;  2EHO C;  3EAM A;  2WQY A;  5HEH A;  2KSR A;  2DL1 A;  1D1A A;  3SWH A;  2ODV A;  4H63 H;  3WI3 A;  2DCF A;  3ONX A;  3CX7 B;  3L8R A;  3PUG A;  4JI8 T;  3NRY A;  4J2C A;  3KFW X;  3N9N A;  4Q25 A;  2XAH B;  5LA6 E;  3AE7 A;  1X79 A;  4X65 T;  3N9Q A;  2PG8 A;  4DR4 T;  4DBR A;  1N36 T;  1FIO A;  4ZI2 C;  1YXR A;  2UXX B;  1WFD A;  3IF8 B;  5EK3 A;  2WY2 A;  5JDL A;  4O4I E;  3LFM A;  5CFB A;  2DNX A;  5FY0 A;  2XAG B;  2R6G F;  3RI5 A;  2CHO A;  2MPK A;  5LCY A;  4CI2 B;  5AQM B;  3H37 A;  1ZOY A;  5HEJ A;  2E9X C;  1N34 T;  1HFA A;  3P50 A;  1Z8U A;  5JQG E;  5FL0 A;  5J1G A;  3TLW A;  4AKH A;  3AAA B;  4LML A;  5FXV A;  4IE5 A;  2OV9 A;  4NXM T;  4ILC A;  1OED A;  4UV8 B;  2BS4 A;  2VVN A;  3O1J A;  4ADZ A;  4Z90 A;  4IL9 A;  1BR1 A;  3PUX F;  2CLY C;  4JI4 T;  2X9X A;  3KIN B;  3FXE B;  2IDO B;  1CHU A;  2L9Q A;  4P09 A;  2IAK A;  3PE0 A;  4YFS A;  2X9H A;  4B6X A;  3NBX X;  4G63 A;  4B3S T;  3ZJ2 A;  1XNQ T;  2JPF A;  3AAE B;  2BS3 A;  3E22 E;  3VKH A;  3OTO T;  4TV9 E;  1W0B A;  2UU9 T;  4AQG A;  2CBI A;  3RRC A;  2H89 A;  4UV9 B;  3KBT A;  3UU8 A;  3P4S A;  3TKL B;  3N9P A;  4K0U A;  1J1J A;  4AQF A;  3ZKR A;  3RYC E;  3NZP A;  1AJ3 A;  4O4J E;  2OLT A;  2V6Y A;  4UVB B;  4EYY R;  1SE7 A;  3KVB A;  2XQA A;  3N9L A;  4PAG A;  4ERR A;  3JCF A;  2JJ9 A;  2Q9Q A;  3QNU A;  4N78 D;  4X1I E; 
#chains in the Genus database with same CATH homology
 5LGT B;  3BQK A;  5HAX A;  2VB6 A;  1E1H B;  5JDG A;  5C8Y E;  2IC9 A;  3SRZ A;  3UUL A;  1HCI A;  2V26 A;  2XTL A;  5JVD E;  3PU8 A;  2LOP A;  3BQL A;  3VHL A;  1HF8 A;  3ZMV B;  2HPL A;  2V1D B;  2X66 A;  3AA0 B;  4QKN A;  2W0G A;  3UTK A;  3B13 A;  4L5G A;  1HG5 A;  4E7Z A;  1LKX A;  1MMD A;  4U74 A;  2V7J A;  2N1G A;  5F3J A;  4GYR A;  4QWN B;  4ANJ A;  4HFV A;  3SS1 A;  2WM9 A;  4HN9 A;  3ZN0 B;  2BVL A;  3KV5 A;  2YU1 A;  1MND A;  4OFZ A;  2K24 A;  4I43 B;  4PK6 A;  2J1D G;  2E9X A;  2W63 A;  4P0B A;  3DTO A;  3C4X A;  4EB6 E;  2CXD A;  1G8X A;  3CKD A;  2RA1 A;  1FMV A;  2H7V C;  3JC6 D;  2XAQ B;  3CX8 B;  1H7C A;  2DWG A;  5KMG P;  5L3G B;  4U72 A;  2CA5 A;  4IE7 A;  4AKR B;  5FY7 A;  3RC3 A;  2G0U A;  3HKB E;  3UUM A;  4KBM B;  4V1A v;  1WYC A;  2BVM A;  3QK6 A;  3A5X A;  3U78 A;  2CM0 A;  4JLE A;  4IE4 A;  4P0A A;  1ZV4 X;  4KMC A;  4CXW A;  4ZI3 C;  3R84 B;  2VKO A;  3N9O A;  1IJ5 A;  5FNV E;  2LSI A;  3LBX B;  2CE7 A;  4I4T E;  2EHO B;  4L0R A;  4AKL A;  1SHZ C;  3MZK B;  4JEH B;  3DP7 A;  5IYZ E;  3C4Z A;  2CMR A;  1FEW A;  3RKO A;  3C64 A;  2BZB A;  4CI1 B;  5A1L A;  3CVR A;  4DVD A;  3VU7 H;  5BMV E;  4WBO A;  4KP3 C;  2WAU A;  3EUH A;  1BR2 A;  2NWB A;  2X51 A;  2YU2 A;  4X1K E;  4TN7 B;  2VKJ A;  5L3E B;  5CA1 E;  4C90 A;  2KWH A;  5JRC B;  3LK3 B;  2IW5 B;  1IJ6 A;  1U4Q A;  4YHJ A;  4EZH A;  5HXH A;  2PBI A;  2PJQ A;  4O4H E;  3MK7 C;  3F57 A;  4G2A A;  3ZYM A;  2NTX A;  3HKE E;  1BR4 A;  4GK0 E;  4XZC A;  4PJL A;  3E08 A;  2LJL A;  5L3C B;  2DLR A;  4PK4 A;  2I59 A;  1SA0 E;  1QUU A;  2A3D A;  2X68 A;  1S35 A;  4AKI A;  2JMK A;  2CXL A;  2KIN B;  2V7L A;  3O9X A;  4EYU A;  5LJN A;  4UF0 A;  4MFR A;  2Q9Q B;  3WAK A;  3R6N A;  3AB3 B;  3GN5 A;  2CXF A;  2HPJ A;  3E0Z A;  2QGS A;  3P7I A;  5LJM A;  2JMH A;  2LEH A;  2C5I T;  3UUX B;  1WRD A;  3IEE A;  1U5P A;  4F6R C;  4X20 E;  3V5U A;  2V7M A;  3O1I A;  5FXZ A;  4DMW A;  4HEA A;  2KT9 A;  3ZCI A;  2L3L A;  2CEA A;  3EDU A;  4AQF C;  5HXR A;  2HH7 A;  1HS7 A;  3H3A A;  2M67 A;  4PFO A;  4HE8 A;  3ZMT B;  2W61 A;  3MJX A;  3KDS E;  3QUJ A;  3WAJ A;  1D1B A;  2Y6X A;  5HXC A;  2XUE A;  2KLQ A;  2W62 A;  4TV8 E;  5H6Q B;  3ZN1 B;  4ZS2 A;  2E9X B;  3KV9 A;  2ES0 A;  3N2G E;  5JDQ A;  4ZOL E;  4IST A;  3CWZ B;  5LBM A;  3OJA A;  2D5U A;  3RPU A;  1D1C A;  2C5J A;  5EK4 A;  5FXX A;  3P8C D;  2KWI B;  3CQC B;  3ZC0 A;  1EZ3 A;  4ISS A;  3AAI A;  4UIG A;  2V7K A;  3NRX A;  3L3P A;  4H63 V;  5JR9 A;  1MMG A;  2CWY A;  3HR0 A;  1MIY A;  2ZMA A;  4TUY E;  2CWO A;  5DJQ C;  4EAH A;  4MBQ A;  2DWK A;  1IAP A;  2LE8 A;  4H9S E;  4JEU B;  5LGU B;  4JUY A;  2JQQ A;  4OYJ A;  2JRK A;  2NOX A;  4PW8 A;  3MAC A;  5HXS A;  4ZI3 D;  2K5B B;  4QX8 B;  1G73 A;  2C5K T;  4CI3 B;  3KBU A;  4UEM A;  1CUN A;  5LYJ E;  3ZMU B;  3GA8 A;  2CLY B;  3J7Y q;  2OA5 A;  2NTY A;  2NW7 A;  4EIW A;  3HI2 A;  4HKA A;  3ZJ1 A;  4ZI7 E;  1WLX A;  2LSK A;  4H9Q C;  3N9M A;  3LG7 A;  2VKH A;  3L09 A;  4I55 E;  4MHC A;  5FMN A;  1LVF A;  2VKD A;  2KZ7 B;  3K8P C;  2KMF A;  2MTQ A;  2P9B A;  4ILU A;  5EZY E;  3MA9 A;  3RYH E;  3I0Q A;  2LSJ A;  3BK9 A;  4PJJ A;  3ZLI A;  1Z0P A;  4EOZ B;  4NUV A;  4YJ2 E;  5KX5 E;  5IHY A;  5F8P A;  2KXP B;  2LM9 A;  2ZM0 A;  3PTR B;  3HKC E;  4UF0 B;  3C98 B;  4FJO A;  3OYZ A;  2LOS A;  2RP4 A;  5HYA A;  3GN5 B;  4MLK A;  3N5L A;  3FBL A;  1VOM A;  4GYS A;  2LT3 A;  5HWY A;  5JRE A;  1ZKE A;  3O4X E;  5DQW A;  4HGA A;  4C91 A;  4QXC B;  4Z8X A;  3CQG B;  3ZYK A;  2A72 A;  3FXD B;  4AI6 A;  5GON E;  2ACX A;  3ETV A;  4O8S A;  1S94 A;  4QXH B;  2ZM2 A;  1YKH B;  3HL6 A;  4TX5 A;  2K48 A;  3CML A;  3RX6 A;  3ZPO A;  1T98 A;  3PUS A;  5FY1 A;  1V9D A;  3IBP A;  4O2B E;  4UEL A;  5H6R B;  2D0T A;  1KNZ A;  1MIW A;  1LVK A;  3N2K E;  2B1E A;  4KUM B;  4NUU A;  2QA7 A;  4X1Y E;  3HA4 A;  3LK2 B;  1QSD A;  3ZCJ A;  2X9Y A;  3FHN A;  3FBZ A;  4ASK A;  2ZLY A;  3OYX A;  5DQV A;  2UXN B;  2NP9 A;  4BJM A;  4L9I A;  3KV4 A;  3VKG A;  3I9Y A;  3C4W A;  5LHG B;  4E7S A;  1UX4 A;  3EDV A;  4PNI A;  2EHO C;  2X9W A;  5JR9 B;  4OK0 A;  2X67 A;  1B7T A;  1D1A A;  2XAJ B;  3SWH A;  5L3D B;  2ODV A;  4H63 H;  3WI3 A;  2DCF A;  4QHO A;  4GIW A;  1D0X A;  3ANW A;  4H9R C;  3ONX A;  3CX7 B;  4A56 A;  3PUG A;  5JH7 E;  3MXZ A;  3NRY A;  4J2C A;  5LXT E;  2WMO A;  5TAO A;  4AKG A;  3KFW X;  3N9N A;  1HX8 A;  5FXW A;  2D0U A;  3CX6 B;  1O3X A;  3KVA A;  4IGU A;  4BJN A;  2XAH B;  5LA6 E;  3AVR A;  2W00 A;  4GK5 E;  1MMN A;  2LSY A;  1X79 A;  3MKD A;  3FB2 A;  3UUN A;  1IZN B;  2XQY A;  3I0O A;  3PDY A;  3N9Q A;  2H7O A;  2X0L B;  5HXE A;  2PG8 A;  2GK9 A;  3ZYL A;  4DBR A;  5JDN A;  3D0T A;  1FIO A;  1US7 B;  4M1P A;  2NW9 A;  3C50 A;  2Q9Q C;  1FMW A;  4ZI2 C;  5J2T E;  1KK7 A;  4WBN E;  3PU3 A;  2YEV C;  4WW0 A;  3NZQ A;  2YIN A;  2UXX B;  4IE6 A;  3LJC A;  3IF8 B;  4FI5 A;  2VL8 A;  4GOU A;  2C0S A;  5EK3 A;  3V5S A;  5JDL A;  4O4I E;  3LFM A;  3I9W A;  2WBL A;  2DNX A;  4DO0 A;  5JDM A;  1OWA A;  2D2S A;  2N9D A;  5FY0 A;  3U3I A;  2XAG B;  1UCU A;  5HWX A;  5LCY A;  5LP6 E;  3C51 A;  1Y64 B;  4CI2 B;  2H3R A;  3H37 A;  5M4Y A;  2Y48 B;  2NW8 A;  3Q9D A;  5LHI B;  2CCQ A;  2E9X C;  3BQI A;  1HFA A;  5LBQ B;  5JQG E;  5E0O A;  1WR6 A;  5L3F B;  1BR0 A;  3RC8 A;  5J1G A;  3ZC1 A;  1ZHC A;  4AKH A;  3AAA B;  2VK9 A;  4H9N C;  2BDE A;  4OYK A;  5FXV A;  4IE5 A;  4WNK A;  3ZMZ B;  5LG4 A;  1D0Y A;  5LOV E;  3GMI A;  3K3O A;  4BAY B;  4PJN A;  3AVS A;  1MIV A;  5J2U E;  4PJM A;  4UV8 B;  5JDH A;  1MMA A;  2VWA A;  4AXP A;  2MBG A;  3Q2M A;  3OBV E;  3O1J A;  3UFE A;  4ADZ A;  1BR1 A;  3GWH A;  2CLY C;  2EHO D;  5LNK A;  3ANW B;  3EVY A;  2LHN A;  4O4L E;  3N2O A;  4IDZ A;  2ODU A;  2L8K A;  2X9X A;  3KIN B;  4UVC B;  3FXE B;  3PUQ A;  3Q5W A;  4H9P C;  2L9Q A;  4P09 A;  2IAK A;  3K3N A;  3PE0 A;  4YFS A;  4CXX A;  5LHH B;  2XAS B;  2X9H A;  4DBQ A;  4CXY A;  4EZ4 A;  4B6X A;  1OXZ A;  3ETU A;  3JC6 C;  4BA9 A;  3Q5X A;  4ZHQ E;  3NBX X;  4G63 A;  1NAF A;  1D0Z A;  1VRB A;  2LHR A;  3F2E A;  3OKQ A;  3T8O A;  2Y8D A;  1UX5 A;  2Z6E A;  3IHR A;  2JPF A;  3AAE B;  4IIJ E;  5FP3 A;  3ZJ2 A;  4H9O C;  2E8I A;  3ZMS B;  4IHJ E;  4UXN B;  3E22 E;  2N2N A;  1HTJ F;  4XAX B;  2MYS A;  4DND A;  5KDM C;  3VKH A;  3CQX C;  4TV9 E;  2KND A;  2Q9Q D;  4ZI2 D;  4XBF B;  2WMN A;  3I1A A;  4AQG A;  1ZEE A;  3RRW A;  3PUA A;  3CPZ A;  4O2A E;  3RRC A;  4UV9 B;  1YKE B;  3KBT A;  3RYF E;  2PFV A;  3HKD E;  3TKL B;  3RYI E;  3S4U A;  5LGN B;  3LBX A;  2IC6 A;  5JDF A;  3M65 A;  3N9P A;  4UVA B;  2EHO A;  1HG2 A;  3J9X 1;  3RH3 A;  2A2F X;  2MOZ A;  4QXB B;  4K0U A;  3W15 B;  3DJB A;  4PFP A;  5ETW A;  1YW0 A;  2XHE B;  4AQF A;  4CQI A;  4PK5 A;  3B57 A;  4HTE A;  5CB4 E;  2XAF B;  4EXT A;  3KV6 A;  2E9X D;  3K3Q C;  5EK2 A;  5JRC A;  3RYC E;  2SPC A;  3NZP A;  5L3B B;  1NWM X;  1AJ3 A;  5ADX L;  2WWU A;  5DAB A;  4ZS3 A;  4CZZ B;  5CA0 E;  5AFU L;  2ZM8 A;  3AA1 B;  4O4J E;  2K9A A;  2DHR A;  3QC9 A;  4UVB B;  4YJ3 E;  4EYY R;  5JR9 C;  3ZEF B;  2YK0 A;  3ESL A;  3KVB A;  3PUR A;  4MAL A;  4OHF A;  4TZ4 C;  5FYM A;  3SOL A;  2LSG A;  5L2L A;  2VAS A;  1WYB A;  1YD8 G;  3F31 A;  3N9L A;  4IE0 A;  1LRZ A;  3UT5 E;  4QX7 B;  2V7I A;  2WSS V;  3AA6 B;  4I50 E;  1MNE A;  3AA7 B;  4PAG A;  4ERR A;  3O1H A;  2JJ9 A;  2Q9Q A;  4YLH A;  4DMV A;  2DI4 A;  4N78 D;  3LK4 2;  4X1I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...