2I5BA

The crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
269
structure length
269
Chain Sequence
MHKALTIAGSDSSGGAGIQADLKTFQEKNVYGMTALTVIVAMDPNNSWNHQVFPIDTDTIRAQLATITDGIGVDAMKTGMLPTVDIIELAAKTIKEKQLKNVVIDPVMVCKGANEVLYPEHAQALREQLAPLATVITPNLFEASQLSGMDELKTVDDMIEAAKKIHALGAQYVVITGGGKLKHEKAVDVLYDGETAEVLESEMIDTPYTHGAGCTFSAAVTAELAKGAEVKEAIYAAKEFITAAIKESFPLNQYVGPTKHSALRLNQQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of an ADP Complex of Bacillus subtilis Pyridoxal Kinase Provides Evidence for the Parallel Emergence of Enzyme Activity During Evolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Phosphomethylpyrimidine kinase
total genus 88
structure length 269
sequence length 269
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2i5bA00
3I3YA 1WYEA 3GO7A 1VK4A 4EOHA 5F11A 2V78A 2C49A 3NM3A 4K8CA 2PKFA 2HLZA 4PVVA 4UBEA 1LIKA 3PZSA 3RT9A 1VI9A 3EWMA 5TQIA 3RQ5A 3HPDA 3RQ6A 1V1BA 3UMOA 5F0ZA 4U7XA 3RSGA 3DRWA 3K5WA 2VARA 3KEUA 5BYCA 5EY7A 4JKUA 3NL3A 3KZHA 3MBJA 3PL2A 4DC3A 3H74A 5CGEA 2I6AA 1ESQA 1TD2A 1UA4A 2AB8A 2I5BA 3RQHA 3UBOA 5BYEA 4JKSA 5CM5A 3UQ6A 2DDWA 3FHXA 3RS8A 3UQDA 1YHJA 2R3EA 3UMPA 4E3AA 3IKHA 1RFVA 3ZS7A 4S1HA 4K8PA 1RKSA 5C41A 4YL5A 4KAHA 3RQXA 3LJSA 1LIIA 3RSFA 4C5JA 3BF5A 3IQ0A 5C40A 5CGAA 2Q5RA 3LKIA 3RPHA 3GBUA 3KTNA 3RTCA 1GQTA 2AJPA 1V1SA 5BYFA 5C3YA 2DCNA 1VM7A 5TRWA 4E8YA 1RKAA 2ABQA 3B1PA 1LIJA 4YWRA 4GM6A 4LCAA 3IE7A 2JG5A 4S1IA 4E84A 2AJRA 4C5KA 4S1IB 3IH0A 3RQ2A 3RREA 1TZ6A 2DDOA 4WJMA 3W4SA 2F7KA 2HQQA 2RBCA 2HW1A 3B1RA 1RFTA 3RTBA 1TYYA 3RT7A 1RKDA 3N1CA 4DU5A 1TZ3A 4XF7A 4EUMA 4EBUA 3JULA 1RFUA 4XCKA 3NBWA 3DZVA 2QCVA 3IBQA 3K9EA 3RSQA 1YGJA 1DGMA 3RQQA 2PKNA 2I6BA 2XTBA 3RS9A 4K8TA 2YXUA 4C5NA 4LBGA 3RY7A 3RPZA 1LHPA 4N08A 3RRJA 3RTDA 1V19A 4K93A 2AX3A 1C3QA 4KALA 3UQEA 2NWHA 4EN4A 2C4EA 1JXHA 2DDMA 4KANA 3RU3A 1JXIA 3NC2A 4K9CA 3UQ9A 3VASA 3Q92A 3VAQA 4E69A 1BX4A 4E8WA 3NL6A 3RRFA 4C5LA 3RU2A 1LIOA 1UB0A 2PKKA 3NCAA 3NL2A 3RTAA 4O1GA 5B6AA 3B1OA 4JJPA 2F02A 3LOOA 3NM1A 1ESJA 2A9YA 3NBVA 2JGVA 2PKMA 3RRBA 2AFBA 3RQ8A 3RTGA 3NL5A 4S1MA 3QA2A 3QAIA 2QHPA 1GC5A 5EYNA 1LHRA 1YGKA 5BYDA 4K8KA 3KD6A 1U2XA 2ABSA 3IN1A 2R3BA 4K9IA 1L2LA 3BGKA 3CQDA 3B3LA 5C3ZA 4LC4A 3HICA 4XDAA 3RM5A 3RTEA 5COJA 3Q1YA 3OTXA 4O1LA 3B1QA 2FV7A 2JG1A 3MBHA 3FHYA 2A9ZA 4XF6A 3RSSA 4E8ZA 1EKQA 3H49A 3NC9A 4B8RA 3B1NA 1RK2A 2YXTA 3HYOA 1EKKA 4KADA 1V1AA 4N09A 3RO4A 2AA0A 4B8SA 4KBEA 4LBXA 3LHXA 2AWDA 4X8FA 1KYHA 4C5MA 3GO6A
chains in the Genus database with same CATH superfamily
3I3YA 1WYEA 3GO7A 1VK4A 4EOHA 5F11A 2V78A 4QDIA 2C49A 3NM3A 4K8CA 2PKFA 2HLZA 4PVVA 4UBEA 1LIKA 3PZSA 3RT9A 1VI9A 3EWMA 5TQIA 2VTEA 3RQ5A 3HPDA 3RQ6A 1V1BA 3UMOA 4C12A 5F0ZA 4U7XA 3RSGA 3DRWA 3K5WA 2VARA 3KEUA 5BYCA 2AM2A 5EY7A 4JKUA 3NL3A 4CVLA 2Y1OA 1P3DA 2GCAA 3KZHA 3MBJA 3PL2A 4DC3A 4BUBA 2AM1A 3H74A 5CGEA 2I6AA 1ESQA 4XCKA 1TD2A 1UA4A 2AB8A 2I5BA 3RQHA 3UBOA 5BYEA 3ZM6A 4JKSA 5CM5A 3UQ6A 2DDWA 3FHXA 3PYZA 4QF5A 3RS8A 3UQDA 1YHJA 2R3EA 1GG4A 3UMPA 3IKHA 1RFVA 1E0DA 4S1HA 4K8PA 1RKSA 2GCBA 3EAGA 3ZS7A 4YL5A 4KAHA 3RQXA 2Y68A 1LIIA 3LJSA 3RSFA 4C5JA 3BF5A 3IQ0A 5BYDA 5C40A 2GC6A 2Q5RA 3LKIA 3RPHA 5CGAA 3GBUA 2JFGA 3KTNA 3RTCA 1GQTA 2AJPA 2GC5A 1V1SA 5BYFA 5C3YA 2DCNA 1VM7A 5TRWA 4E8YA 1RKAA 2ABQA 3B1PA 1LIJA 4YWRA 4CVKA 4GM6A 4LCAA 4CVMA 3HN7A 1P31A 3IE7A 2JG5A 2Y66A 2Y67A 4S1IA 4E84A 2AJRA 2WTZA 5C41A 4C5KA 4S1IB 3IH0A 3RQ2A 3RREA 1TZ6A 2DDOA 4UAGA 4WJMA 3W4SA 2F7KA 2HQQA 2HW1A 2RBCA 3B1RA 1RFTA 3RTBA 1TYYA 3RT7A 4C5MA 1RKDA 3N1CA 4DU5A 1TZ3A 5A5EA 4XF7A 4EUMA 4EBUA 2JFFA 1RFUA 2UUPA 3JULA 3DZVA 2QCVA 3IBQA 3K9EA 3NBWA 1YGJA 3RSQA 1DGMA 3RQQA 2PKNA 2I6BA 2XTBA 3RS9A 3ZM5A 4K8TA 4BUCA 2YXUA 4C5NA 4LBGA 3RY7A 3RPZA 1LHPA 4N08A 3RRJA 3RTDA 1V19A 4K93A 2AX3A 1C3QA 2UUOA 3QCZA 4KALA 2NWHA 2WJPA 3HJ6A 3UQEA 4EN4A 2C4EA 3NRSA 1JXHA 2DDMA 4KANA 3RU3A 1JXIA 3NC2A 4K9CA 3UQ9A 3VASA 3Q92A 3VAQA 4C13A 4E69A 1BX4A 4E8WA 1E8CA 2VTDA 1W78A 3NL6A 3RRFA 5A5FA 4C5LA 4ZIYA 1GQQA 1LIOA 1UB0A 2PKKA 1UAGA 3NCAA 3NL2A 3RTAA 3RU2A 3LK7A 4O1GA 1EEHA 3B1OA 5B6AA 4JJPA 2F02A 3LOOA 3NM1A 1ESJA 2VOSA 4E3AA 2A9YA 3NBVA 2JGVA 2PKMA 3RRBA 2AFBA 2XPCA 2F00A 3RQ8A 3RTGA 3NL5A 4S1MA 3QA2A 3QAIA 2QHPA 1GC5A 5EYNA 1LHRA 1YGKA 3UAGA 4K8KA 1FGSA 1O5ZA 1U2XA 2ABSA 3IN1A 2R3BA 3KD6A 4K9IA 1L2LA 3BGKA 3CQDA 1GQYA 2UAGA 3B3LA 5C3ZA 4LC4A 2VORA 3HICA 4XDAA 3RM5A 3RTEA 5COJA 3Q1YA 3OTXA 4O1LA 4B8SA 2XJAA 3B1QA 3ZL8A 2FV7A 1J6UA 2JG1A 3MBHA 3FHYA 3RO4A 2A9ZA 4XF6A 3RSSA 4E8ZA 1EKQA 3H49A 3NC9A 4B8RA 3B1NA 1RK2A 2YXTA 3HYOA 1EKKA 1W7KA 1V1AA 2X5OA 1JBVA 2AA0A 3N2AA 4KADA 4N09A 2JFHA 4KBEA 4LBXA 3LHXA 2AWDA 4X8FA 1KYHA 4HV4A 1JBWA 3GO6A
chains in the Genus database with same CATH topology
3I3YA 1WYEA 3GO7A 1VK4A 4EOHA 5F11A 2V78A 2C49A 3NM3A 4K8CA 2PKFA 2HLZA 4PVVA 4UBEA 1LIKA 3PZSA 3RT9A 1VI9A 3EWMA 5TQIA 3RQ5A 3HPDA 3RQ6A 1V1BA 3UMOA 5F0ZA 4U7XA 3RSGA 3DRWA 3K5WA 2VARA 3KEUA 5BYCA 5EY7A 4JKUA 3NL3A 3KZHA 3MBJA 3PL2A 4DC3A 3H74A 5CGEA 2I6AA 1ESQA 1TD2A 1UA4A 2AB8A 2I5BA 3RQHA 3UBOA 5BYEA 4JKSA 5CM5A 3UQ6A 2DDWA 3FHXA 3RS8A 3UQDA 1YHJA 2R3EA 3UMPA 4E3AA 3IKHA 1RFVA 3ZS7A 4S1HA 4K8PA 1RKSA 5C41A 4YL5A 4KAHA 3RQXA 3LJSA 1LIIA 3RSFA 4C5JA 3BF5A 3IQ0A 5C40A 5CGAA 2Q5RA 3LKIA 3RPHA 3GBUA 3KTNA 3RTCA 1GQTA 2AJPA 1V1SA 5BYFA 5C3YA 2DCNA 1VM7A 5TRWA 4E8YA 1RKAA 2ABQA 3B1PA 1LIJA 4YWRA 4GM6A 4LCAA 3IE7A 2JG5A 4S1IA 4E84A 2AJRA 4C5KA 4S1IB 3IH0A 3RQ2A 3RREA 1TZ6A 2DDOA 4WJMA 3W4SA 2F7KA 2HQQA 2RBCA 2HW1A 3B1RA 1RFTA 3RTBA 1TYYA 3RT7A 1RKDA 3N1CA 4DU5A 1TZ3A 4XF7A 4EUMA 4EBUA 3JULA 1RFUA 4XCKA 3NBWA 3DZVA 2QCVA 3IBQA 3K9EA 3RSQA 1YGJA 1DGMA 3RQQA 2PKNA 2I6BA 2XTBA 3RS9A 4K8TA 2YXUA 4C5NA 4LBGA 3RY7A 3RPZA 1LHPA 4N08A 3RRJA 3RTDA 1V19A 4K93A 2AX3A 1C3QA 4KALA 3UQEA 2NWHA 3HJ6A 4EN4A 2C4EA 1JXHA 2DDMA 4KANA 3RU3A 1JXIA 3NC2A 4K9CA 3UQ9A 3VASA 3Q92A 3VAQA 4E69A 1BX4A 4E8WA 3NL6A 3RRFA 4C5LA 3RU2A 1LIOA 1UB0A 2PKKA 3NCAA 3NL2A 3RTAA 4O1GA 5B6AA 3B1OA 4JJPA 2F02A 3LOOA 3NM1A 1ESJA 2A9YA 3NBVA 2JGVA 2PKMA 3RRBA 2AFBA 3RQ8A 3RTGA 3NL5A 4S1MA 3QA2A 3QAIA 2QHPA 1GC5A 5EYNA 1LHRA 1YGKA 5BYDA 4K8KA 3KD6A 1U2XA 2ABSA 3IN1A 2R3BA 4K9IA 1L2LA 3BGKA 3CQDA 3B3LA 5C3ZA 4LC4A 3HICA 4XDAA 3RM5A 3RTEA 5COJA 3Q1YA 3OTXA 4O1LA 3B1QA 2FV7A 2JG1A 3MBHA 3FHYA 2A9ZA 4XF6A 3RSSA 4E8ZA 1EKQA 3H49A 3NC9A 4B8RA 3B1NA 1RK2A 2YXTA 3HYOA 1EKKA 4KADA 1V1AA 4N09A 3RO4A 2AA0A 4B8SA 4KBEA 4LBXA 3LHXA 2AWDA 4X8FA 1KYHA 4C5MA 3GO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3Y A;  1WYE A;  3GO7 A;  1VK4 A;  4EOH A;  5F11 A;  2V78 A;  2C49 A;  3NM3 A;  4K8C A;  2PKF A;  2HLZ A;  4PVV A;  4UBE A;  1LIK A;  3PZS A;  3RT9 A;  1VI9 A;  3EWM A;  5TQI A;  3RQ5 A;  3HPD A;  3RQ6 A;  1V1B A;  3UMO A;  5F0Z A;  4U7X A;  3RSG A;  3DRW A;  3K5W A;  2VAR A;  3KEU A;  5BYC A;  5EY7 A;  4JKU A;  3NL3 A;  3KZH A;  3MBJ A;  3PL2 A;  4DC3 A;  3H74 A;  5CGE A;  2I6A A;  1ESQ A;  1TD2 A;  1UA4 A;  2AB8 A;  2I5B A;  3RQH A;  3UBO A;  5BYE A;  4JKS A;  5CM5 A;  3UQ6 A;  2DDW A;  3FHX A;  3RS8 A;  3UQD A;  1YHJ A;  2R3E A;  3UMP A;  4E3A A;  3IKH A;  1RFV A;  3ZS7 A;  4S1H A;  4K8P A;  1RKS A;  5C41 A;  4YL5 A;  4KAH A;  3RQX A;  3LJS A;  1LII A;  3RSF A;  4C5J A;  3BF5 A;  3IQ0 A;  5C40 A;  5CGA A;  2Q5R A;  3LKI A;  3RPH A;  3GBU A;  3KTN A;  3RTC A;  1GQT A;  2AJP A;  1V1S A;  5BYF A;  5C3Y A;  2DCN A;  1VM7 A;  5TRW A;  4E8Y A;  1RKA A;  2ABQ A;  3B1P A;  1LIJ A;  4YWR A;  4GM6 A;  4LCA A;  3IE7 A;  2JG5 A;  4S1I A;  4E84 A;  2AJR A;  4C5K A;  4S1I B;  3IH0 A;  3RQ2 A;  3RRE A;  1TZ6 A;  2DDO A;  4WJM A;  3W4S A;  2F7K A;  2HQQ A;  2RBC A;  2HW1 A;  3B1R A;  1RFT A;  3RTB A;  1TYY A;  3RT7 A;  1RKD A;  3N1C A;  4DU5 A;  1TZ3 A;  4XF7 A;  4EUM A;  4EBU A;  3JUL A;  1RFU A;  4XCK A;  3NBW A;  3DZV A;  2QCV A;  3IBQ A;  3K9E A;  3RSQ A;  1YGJ A;  1DGM A;  3RQQ A;  2PKN A;  2I6B A;  2XTB A;  3RS9 A;  4K8T A;  2YXU A;  4C5N A;  4LBG A;  3RY7 A;  3RPZ A;  1LHP A;  4N08 A;  3RRJ A;  3RTD A;  1V19 A;  4K93 A;  2AX3 A;  1C3Q A;  4KAL A;  3UQE A;  2NWH A;  4EN4 A;  2C4E A;  1JXH A;  2DDM A;  4KAN A;  3RU3 A;  1JXI A;  3NC2 A;  4K9C A;  3UQ9 A;  3VAS A;  3Q92 A;  3VAQ A;  4E69 A;  1BX4 A;  4E8W A;  3NL6 A;  3RRF A;  4C5L A;  3RU2 A;  1LIO A;  1UB0 A;  2PKK A;  3NCA A;  3NL2 A;  3RTA A;  4O1G A;  5B6A A;  3B1O A;  4JJP A;  2F02 A;  3LOO A;  3NM1 A;  1ESJ A;  2A9Y A;  3NBV A;  2JGV A;  2PKM A;  3RRB A;  2AFB A;  3RQ8 A;  3RTG A;  3NL5 A;  4S1M A;  3QA2 A;  3QAI A;  2QHP A;  1GC5 A;  5EYN A;  1LHR A;  1YGK A;  5BYD A;  4K8K A;  3KD6 A;  1U2X A;  2ABS A;  3IN1 A;  2R3B A;  4K9I A;  1L2L A;  3BGK A;  3CQD A;  3B3L A;  5C3Z A;  4LC4 A;  3HIC A;  4XDA A;  3RM5 A;  3RTE A;  5COJ A;  3Q1Y A;  3OTX A;  4O1L A;  3B1Q A;  2FV7 A;  2JG1 A;  3MBH A;  3FHY A;  2A9Z A;  4XF6 A;  3RSS A;  4E8Z A;  1EKQ A;  3H49 A;  3NC9 A;  4B8R A;  3B1N A;  1RK2 A;  2YXT A;  3HYO A;  1EKK A;  4KAD A;  1V1A A;  4N09 A;  3RO4 A;  2AA0 A;  4B8S A;  4KBE A;  4LBX A;  3LHX A;  2AWD A;  4X8F A;  1KYH A;  4C5M A;  3GO6 A; 
#chains in the Genus database with same CATH topology
 3I3Y A;  1WYE A;  3GO7 A;  1VK4 A;  4EOH A;  5F11 A;  2V78 A;  4QDI A;  2C49 A;  3NM3 A;  4K8C A;  2PKF A;  2HLZ A;  4PVV A;  4UBE A;  1LIK A;  3PZS A;  3RT9 A;  1VI9 A;  3EWM A;  5TQI A;  2VTE A;  3RQ5 A;  3HPD A;  3RQ6 A;  1V1B A;  3UMO A;  4C12 A;  5F0Z A;  4U7X A;  3RSG A;  3DRW A;  3K5W A;  2VAR A;  3KEU A;  5BYC A;  2AM2 A;  5EY7 A;  4JKU A;  3NL3 A;  4CVL A;  2Y1O A;  1P3D A;  2GCA A;  3KZH A;  3MBJ A;  3PL2 A;  4DC3 A;  4BUB A;  2AM1 A;  3H74 A;  5CGE A;  2I6A A;  1ESQ A;  4XCK A;  1TD2 A;  1UA4 A;  2AB8 A;  2I5B A;  3RQH A;  3UBO A;  5BYE A;  3ZM6 A;  4JKS A;  5CM5 A;  3UQ6 A;  2DDW A;  3FHX A;  3PYZ A;  4QF5 A;  3RS8 A;  3UQD A;  1YHJ A;  2R3E A;  1GG4 A;  3UMP A;  3IKH A;  1RFV A;  1E0D A;  4S1H A;  4K8P A;  1RKS A;  2GCB A;  3EAG A;  3ZS7 A;  4YL5 A;  4KAH A;  3RQX A;  2Y68 A;  1LII A;  3LJS A;  3RSF A;  4C5J A;  3BF5 A;  3IQ0 A;  5BYD A;  5C40 A;  2GC6 A;  2Q5R A;  3LKI A;  3RPH A;  5CGA A;  3GBU A;  2JFG A;  3KTN A;  3RTC A;  1GQT A;  2AJP A;  2GC5 A;  1V1S A;  5BYF A;  5C3Y A;  2DCN A;  1VM7 A;  5TRW A;  4E8Y A;  1RKA A;  2ABQ A;  3B1P A;  1LIJ A;  4YWR A;  4CVK A;  4GM6 A;  4LCA A;  4CVM A;  3HN7 A;  1P31 A;  3IE7 A;  2JG5 A;  2Y66 A;  2Y67 A;  4S1I A;  4E84 A;  2AJR A;  2WTZ A;  5C41 A;  4C5K A;  4S1I B;  3IH0 A;  3RQ2 A;  3RRE A;  1TZ6 A;  2DDO A;  4UAG A;  4WJM A;  3W4S A;  2F7K A;  2HQQ A;  2HW1 A;  2RBC A;  3B1R A;  1RFT A;  3RTB A;  1TYY A;  3RT7 A;  4C5M A;  1RKD A;  3N1C A;  4DU5 A;  1TZ3 A;  5A5E A;  4XF7 A;  4EUM A;  4EBU A;  2JFF A;  1RFU A;  2UUP A;  3JUL A;  3DZV A;  2QCV A;  3IBQ A;  3K9E A;  3NBW A;  1YGJ A;  3RSQ A;  1DGM A;  3RQQ A;  2PKN A;  2I6B A;  2XTB A;  3RS9 A;  3ZM5 A;  4K8T A;  4BUC A;  2YXU A;  4C5N A;  4LBG A;  3RY7 A;  3RPZ A;  1LHP A;  4N08 A;  3RRJ A;  3RTD A;  1V19 A;  4K93 A;  2AX3 A;  1C3Q A;  2UUO A;  3QCZ A;  4KAL A;  2NWH A;  2WJP A;  3HJ6 A;  3UQE A;  4EN4 A;  2C4E A;  3NRS A;  1JXH A;  2DDM A;  4KAN A;  3RU3 A;  1JXI A;  3NC2 A;  4K9C A;  3UQ9 A;  3VAS A;  3Q92 A;  3VAQ A;  4C13 A;  4E69 A;  1BX4 A;  4E8W A;  1E8C A;  2VTD A;  1W78 A;  3NL6 A;  3RRF A;  5A5F A;  4C5L A;  4ZIY A;  1GQQ A;  1LIO A;  1UB0 A;  2PKK A;  1UAG A;  3NCA A;  3NL2 A;  3RTA A;  3RU2 A;  3LK7 A;  4O1G A;  1EEH A;  3B1O A;  5B6A A;  4JJP A;  2F02 A;  3LOO A;  3NM1 A;  1ESJ A;  2VOS A;  4E3A A;  2A9Y A;  3NBV A;  2JGV A;  2PKM A;  3RRB A;  2AFB A;  2XPC A;  2F00 A;  3RQ8 A;  3RTG A;  3NL5 A;  4S1M A;  3QA2 A;  3QAI A;  2QHP A;  1GC5 A;  5EYN A;  1LHR A;  1YGK A;  3UAG A;  4K8K A;  1FGS A;  1O5Z A;  1U2X A;  2ABS A;  3IN1 A;  2R3B A;  3KD6 A;  4K9I A;  1L2L A;  3BGK A;  3CQD A;  1GQY A;  2UAG A;  3B3L A;  5C3Z A;  4LC4 A;  2VOR A;  3HIC A;  4XDA A;  3RM5 A;  3RTE A;  5COJ A;  3Q1Y A;  3OTX A;  4O1L A;  4B8S A;  2XJA A;  3B1Q A;  3ZL8 A;  2FV7 A;  1J6U A;  2JG1 A;  3MBH A;  3FHY A;  3RO4 A;  2A9Z A;  4XF6 A;  3RSS A;  4E8Z A;  1EKQ A;  3H49 A;  3NC9 A;  4B8R A;  3B1N A;  1RK2 A;  2YXT A;  3HYO A;  1EKK A;  1W7K A;  1V1A A;  2X5O A;  1JBV A;  2AA0 A;  3N2A A;  4KAD A;  4N09 A;  2JFH A;  4KBE A;  4LBX A;  3LHX A;  2AWD A;  4X8F A;  1KYH A;  4HV4 A;  1JBW A;  3GO6 A; 
#chains in the Genus database with same CATH homology
 3I3Y A;  1WYE A;  3GO7 A;  1VK4 A;  4EOH A;  5F11 A;  2V78 A;  2C49 A;  3NM3 A;  4K8C A;  2PKF A;  2HLZ A;  4PVV A;  4UBE A;  1LIK A;  3PZS A;  3RT9 A;  1VI9 A;  3EWM A;  5TQI A;  3RQ5 A;  3HPD A;  3RQ6 A;  1V1B A;  3UMO A;  5F0Z A;  4U7X A;  3RSG A;  3DRW A;  3K5W A;  2VAR A;  3KEU A;  5BYC A;  5EY7 A;  4JKU A;  3NL3 A;  3KZH A;  3MBJ A;  3PL2 A;  4DC3 A;  3H74 A;  5CGE A;  2I6A A;  1ESQ A;  1TD2 A;  1UA4 A;  2AB8 A;  2I5B A;  3RQH A;  3UBO A;  5BYE A;  4JKS A;  5CM5 A;  3UQ6 A;  2DDW A;  3FHX A;  3RS8 A;  3UQD A;  1YHJ A;  2R3E A;  3UMP A;  4E3A A;  3IKH A;  1RFV A;  3ZS7 A;  4S1H A;  4K8P A;  1RKS A;  5C41 A;  4YL5 A;  4KAH A;  3RQX A;  3LJS A;  1LII A;  3RSF A;  4C5J A;  3BF5 A;  3IQ0 A;  5C40 A;  5CGA A;  2Q5R A;  3LKI A;  3RPH A;  3GBU A;  3KTN A;  3RTC A;  1GQT A;  2AJP A;  1V1S A;  5BYF A;  5C3Y A;  2DCN A;  1VM7 A;  5TRW A;  4E8Y A;  1RKA A;  2ABQ A;  3B1P A;  1LIJ A;  4YWR A;  4GM6 A;  4LCA A;  3IE7 A;  2JG5 A;  4S1I A;  4E84 A;  2AJR A;  4C5K A;  4S1I B;  3IH0 A;  3RQ2 A;  3RRE A;  1TZ6 A;  2DDO A;  4WJM A;  3W4S A;  2F7K A;  2HQQ A;  2RBC A;  2HW1 A;  3B1R A;  1RFT A;  3RTB A;  1TYY A;  3RT7 A;  1RKD A;  3N1C A;  4DU5 A;  1TZ3 A;  4XF7 A;  4EUM A;  4EBU A;  3JUL A;  1RFU A;  4XCK A;  3NBW A;  3DZV A;  2QCV A;  3IBQ A;  3K9E A;  3RSQ A;  1YGJ A;  1DGM A;  3RQQ A;  2PKN A;  2I6B A;  2XTB A;  3RS9 A;  4K8T A;  2YXU A;  4C5N A;  4LBG A;  3RY7 A;  3RPZ A;  1LHP A;  4N08 A;  3RRJ A;  3RTD A;  1V19 A;  4K93 A;  2AX3 A;  1C3Q A;  4KAL A;  3UQE A;  2NWH A;  3HJ6 A;  4EN4 A;  2C4E A;  1JXH A;  2DDM A;  4KAN A;  3RU3 A;  1JXI A;  3NC2 A;  4K9C A;  3UQ9 A;  3VAS A;  3Q92 A;  3VAQ A;  4E69 A;  1BX4 A;  4E8W A;  3NL6 A;  3RRF A;  4C5L A;  3RU2 A;  1LIO A;  1UB0 A;  2PKK A;  3NCA A;  3NL2 A;  3RTA A;  4O1G A;  5B6A A;  3B1O A;  4JJP A;  2F02 A;  3LOO A;  3NM1 A;  1ESJ A;  2A9Y A;  3NBV A;  2JGV A;  2PKM A;  3RRB A;  2AFB A;  3RQ8 A;  3RTG A;  3NL5 A;  4S1M A;  3QA2 A;  3QAI A;  2QHP A;  1GC5 A;  5EYN A;  1LHR A;  1YGK A;  5BYD A;  4K8K A;  3KD6 A;  1U2X A;  2ABS A;  3IN1 A;  2R3B A;  4K9I A;  1L2L A;  3BGK A;  3CQD A;  3B3L A;  5C3Z A;  4LC4 A;  3HIC A;  4XDA A;  3RM5 A;  3RTE A;  5COJ A;  3Q1Y A;  3OTX A;  4O1L A;  3B1Q A;  2FV7 A;  2JG1 A;  3MBH A;  3FHY A;  2A9Z A;  4XF6 A;  3RSS A;  4E8Z A;  1EKQ A;  3H49 A;  3NC9 A;  4B8R A;  3B1N A;  1RK2 A;  2YXT A;  3HYO A;  1EKK A;  4KAD A;  1V1A A;  4N09 A;  3RO4 A;  2AA0 A;  4B8S A;  4KBE A;  4LBX A;  3LHX A;  2AWD A;  4X8F A;  1KYH A;  4C5M A;  3GO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...