2I5BA

The crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
269
structure length
269
Chain Sequence
MHKALTIAGSDSSGGAGIQADLKTFQEKNVYGMTALTVIVAMDPNNSWNHQVFPIDTDTIRAQLATITDGIGVDAMKTGMLPTVDIIELAAKTIKEKQLKNVVIDPVMVCKGANEVLYPEHAQALREQLAPLATVITPNLFEASQLSGMDELKTVDDMIEAAKKIHALGAQYVVITGGGKLKHEKAVDVLYDGETAEVLESEMIDTPYTHGAGCTFSAAVTAELAKGAEVKEAIYAAKEFITAAIKESFPLNQYVGPTKHSALRLNQQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of an ADP Complex of Bacillus subtilis Pyridoxal Kinase Provides Evidence for the Parallel Emergence of Enzyme Activity During Evolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Phosphomethylpyrimidine kinase
total genus 88
structure length 269
sequence length 269
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2i5bA00
3IBQA 3IQ0A 3B1RA 5C3ZA 2HQQA 1RKAA 3RPZA 4XF7A 4EBUA 1UB0A 2HW1A 3UQ6A 4KBEA 4KANA 1V1AA 4K8CA 1C3QA 1TYYA 3VASA 4X8FA 2QHPA 1YHJA 4YL5A 3RU2A 2JGVA 3ZS7A 4E69A 3RQHA 2DCNA 2PKMA 3EWMA 2ABQA 3UQ9A 1V1SA 2JG1A 3NBWA 4K93A 1DGMA 2R3BA 5B6AA 3GBUA 2YXUA 1U2XA 2DDWA 5F11A 3BGKA 1LHPA 3UQDA 2V78A 3LKIA 3NL3A 3JULA 4JKSA 2C4EA 3RS9A 4C5MA 3DRWA 2AJRA 5BYEA 3H74A 3QA2A 5C41A 4E84A 3RSFA 1RFTA 1RKSA 3B1PA 3UMPA 1LIKA 4EOHA 4K9CA 4JKUA 3Q92A 5BYDA 3RTEA 3MBJA 4LBGA 2AB8A 3LJSA 5C40A 4JJPA 5TQIA 3W4SA 3FHYA 3RT7A 1EKQA 4DC3A 2F02A 3RQ8A 3RREA 1UA4A 1LIOA 2AJPA 3PZSA 2YXTA 1GQTA 4S1HA 3RQXA 5BYCA 3NL5A 1LIIA 2FV7A 2I5BA 3CQDA 3GO6A 3LHXA 3HYOA 5CM5A 3VAQA 3NC2A 2JG5A 2DDOA 3RS8A 4YWRA 4K8PA 4WJMA 3B1OA 1YGKA 3RRFA 3GO7A 4K8KA 2NWHA 2Q5RA 1YGJA 3K9EA 4B8RA 1LHRA 3RRJA 3RY7A 4O1GA 1JXHA 3OTXA 4C5KA 2RBCA 5EY7A 3RQ6A 4UBEA 3RSGA 4U7XA 3N1CA 3NC9A 3QAIA 3UMOA 1VK4A 3KZHA 1RFVA 4O1LA 1TD2A 3IN1A 3RRBA 3RSQA 2AA0A 3RQ5A 4GM6A 2AFBA 1RKDA 1VM7A 3Q1YA 4KADA 3RTCA 2R3EA 3RQ2A 3B1QA 2PKKA 2PKFA 5CGEA 3BF5A 2A9YA 3I3YA 1VI9A 3NM1A 4E8ZA 3DZVA 3IH0A 2HLZA 4LCAA 4DU5A 2A9ZA 2DDMA 1KYHA 3NM3A 3PL2A 1V1BA 4N08A 1ESJA 3FHXA 4KAHA 1TZ6A 3IKHA 3KEUA 3H49A 4XDAA 2QCVA 3HPDA 4S1IA 3UQEA 4E8YA 4PVVA 4E8WA 5C3YA 3KD6A 2AX3A 3IE7A 2C49A 2AWDA 4K8TA 1RFUA 4S1IB 3NL2A 4K9IA 5EYNA 3RTDA 3RPHA 4B8SA 3RT9A 3UBOA 1L2LA 3MBHA 4EUMA 4N09A 3RM5A 3RTAA 4KALA 4EN4A 5BYFA 2PKNA 1RK2A 3NL6A 3NBVA 4XF6A 1LIJA 1GC5A 3RO4A 2ABSA 1BX4A 3KTNA 2VARA 3RTGA 2I6BA 2XTBA 2F7KA 2I6AA 3NCAA 3RU3A 5TRWA 4E3AA 3B1NA 1ESQA 3LOOA 5COJA 3K5WA 3RSSA 4C5NA 5F0ZA 1JXIA 4C5JA 1EKKA 4LC4A 1TZ3A 3HICA 3RQQA 3B3LA 4C5LA 4LBXA 3RTBA 1V19A 5CGAA 4S1MA 1WYEA 4XCKA
chains in the Genus database with same CATH superfamily
3IBQA 3IQ0A 3B1RA 4HV4A 5C3ZA 2HQQA 1RKAA 3RPZA 2WTZA 4XF7A 1UB0A 2HW1A 4EBUA 4KBEA 3UQ6A 4KANA 4CVKA 1V1AA 4K8CA 1C3QA 4ZIYA 1TYYA 3VASA 4X8FA 2QHPA 1YHJA 2JFFA 4YL5A 2JGVA 3RU2A 3ZS7A 4E69A 3RQHA 2DCNA 2PKMA 3EWMA 2ABQA 3UQ9A 1V1SA 2JG1A 3NBWA 4K93A 1DGMA 2R3BA 5B6AA 3GBUA 2YXUA 1U2XA 2DDWA 2XJAA 3BGKA 1LHPA 5F11A 2V78A 3LKIA 3NL3A 3JULA 4JKSA 2C4EA 2UAGA 3RS9A 3DRWA 2AJRA 4C5MA 3H74A 3QA2A 5C41A 3ZM6A 2VTEA 1RFTA 1RKSA 3B1PA 3PYZA 1LIKA 3RSFA 3UMPA 4E84A 4K9CA 4JKUA 4EOHA 3Q92A 5BYDA 1E0DA 3MBJA 2GCAA 2AB8A 2WJPA 3LJSA 4LBGA 3RTEA 5C40A 3UQDA 4JJPA 5TQIA 5BYEA 1JBVA 3W4SA 3FHYA 3RT7A 1EKQA 4DC3A 2F02A 3RQ8A 3RREA 1UA4A 1LIOA 2AJPA 3PZSA 2X5OA 1GQTA 2YXTA 4S1HA 3RQXA 5BYCA 3NL5A 1LIIA 2VTDA 3UAGA 2FV7A 2I5BA 3CQDA 3GO6A 3LHXA 3HYOA 5CM5A 3VAQA 3NC2A 2JG5A 2DDOA 3RS8A 4YWRA 4K8PA 4BUCA 2Y68A 3N2AA 4WJMA 2JFHA 3B1OA 1GQYA 3LK7A 1YGKA 3RRFA 3GO7A 4K8KA 2NWHA 1W7KA 2Q5RA 1YGJA 3K9EA 2UUOA 4B8RA 1LHRA 3RRJA 1UAGA 3RY7A 4C13A 4O1GA 1JXHA 3OTXA 4C5KA 4QF5A 2RBCA 3QCZA 2Y67A 5EY7A 4QDIA 2VORA 2AM1A 4UBEA 2AM2A 4U7XA 3RQ6A 3RSGA 3N1CA 3NC9A 3QAIA 4S1MA 3UMOA 1P31A 1VK4A 3KZHA 1RFVA 4O1LA 1TD2A 3IN1A 3RRBA 3RSQA 5A5EA 2AA0A 3RQ5A 4GM6A 4CVMA 2AFBA 1RKDA 1VM7A 3Q1YA 4KADA 3RTCA 2R3EA 3RQ2A 3B1QA 3ZM5A 2PKKA 2PKFA 5CGEA 1E8CA 2JFGA 3BF5A 2A9YA 3EAGA 1VI9A 3I3YA 3NM1A 3NRSA 4E8ZA 3DZVA 3IH0A 2HLZA 4LCAA 4DU5A 2A9ZA 4UAGA 1GQQA 2DDMA 2VOSA 2GC6A 4CVLA 1KYHA 2GC5A 3NM3A 3PL2A 1V1BA 4N08A 1ESJA 1GG4A 3FHXA 2Y1OA 1TZ6A 3IKHA 4KAHA 3KEUA 3H49A 3HJ6A 4XDAA 2F00A 2QCVA 3HPDA 4S1IA 3UQEA 4E8YA 4PVVA 4E8WA 5C3YA 1J6UA 3KD6A 2AX3A 3IE7A 2Y66A 2C49A 2AWDA 4K8TA 1RFUA 2UUPA 1O5ZA 4S1IB 1EEHA 3NL2A 4K9IA 5EYNA 3RTDA 3RPHA 4B8SA 2XPCA 3RT9A 3UBOA 4C12A 1L2LA 3MBHA 4EUMA 4N09A 3RM5A 3RTAA 4KALA 1FGSA 2GCBA 2PKNA 1P3DA 4EN4A 1RK2A 5BYFA 3NL6A 3NBVA 3ZL8A 4XF6A 1LIJA 1GC5A 3RO4A 2ABSA 1BX4A 4BUBA 1W78A 3KTNA 2VARA 3RTGA 2I6BA 2XTBA 2F7KA 2I6AA 3NCAA 3RU3A 5TRWA 4E3AA 3B1NA 1ESQA 3LOOA 5COJA 3K5WA 3RSSA 4C5NA 5A5FA 1JXIA 5F0ZA 4C5JA 1EKKA 4LC4A 1TZ3A 3HICA 3RQQA 3B3LA 3HN7A 4C5LA 4LBXA 3RTBA 1V19A 5CGAA 1JBWA 1WYEA 4XCKA
chains in the Genus database with same CATH topology
3IBQA 3IQ0A 3B1RA 5C3ZA 2HQQA 1RKAA 3RPZA 4XF7A 4EBUA 1UB0A 2HW1A 3UQ6A 4KBEA 4KANA 1V1AA 4K8CA 1C3QA 1TYYA 3VASA 4X8FA 2QHPA 1YHJA 4YL5A 3RU2A 2JGVA 3ZS7A 4E69A 3RQHA 2DCNA 2PKMA 3EWMA 2ABQA 3UQ9A 1V1SA 2JG1A 3NBWA 4K93A 1DGMA 2R3BA 5B6AA 3GBUA 2YXUA 1U2XA 2DDWA 5F11A 3BGKA 1LHPA 3UQDA 2V78A 3LKIA 3NL3A 3JULA 4JKSA 2C4EA 3RS9A 4C5MA 3DRWA 2AJRA 5BYEA 3H74A 3QA2A 5C41A 4E84A 3RSFA 1RFTA 1RKSA 3B1PA 3UMPA 1LIKA 4EOHA 4K9CA 4JKUA 3Q92A 5BYDA 3RTEA 3MBJA 4LBGA 2AB8A 3LJSA 5C40A 4JJPA 5TQIA 3W4SA 3FHYA 3RT7A 1EKQA 4DC3A 2F02A 3RQ8A 3RREA 1UA4A 1LIOA 2AJPA 3PZSA 2YXTA 1GQTA 4S1HA 3RQXA 5BYCA 3NL5A 1LIIA 2FV7A 2I5BA 3CQDA 3GO6A 3LHXA 3HYOA 5CM5A 3VAQA 3NC2A 2JG5A 2DDOA 3RS8A 4YWRA 4K8PA 4WJMA 3B1OA 1YGKA 3RRFA 3GO7A 4K8KA 2NWHA 2Q5RA 1YGJA 3K9EA 4B8RA 1LHRA 3RRJA 3RY7A 4O1GA 1JXHA 3OTXA 4C5KA 2RBCA 5EY7A 3RQ6A 4UBEA 3RSGA 4U7XA 3N1CA 3NC9A 3QAIA 3UMOA 1VK4A 3KZHA 1RFVA 4O1LA 1TD2A 3IN1A 3RRBA 3RSQA 2AA0A 3RQ5A 4GM6A 2AFBA 1RKDA 1VM7A 3Q1YA 4KADA 3RTCA 2R3EA 3RQ2A 3B1QA 2PKKA 2PKFA 5CGEA 3BF5A 2A9YA 3I3YA 1VI9A 3NM1A 4E8ZA 3DZVA 3IH0A 2HLZA 4LCAA 4DU5A 2A9ZA 2DDMA 1KYHA 3NM3A 3PL2A 1V1BA 4N08A 1ESJA 3FHXA 4KAHA 1TZ6A 3IKHA 3KEUA 3H49A 3HJ6A 4XDAA 2QCVA 3HPDA 4S1IA 3UQEA 4E8YA 4PVVA 4E8WA 5C3YA 3KD6A 2AX3A 3IE7A 2C49A 2AWDA 4K8TA 1RFUA 4S1IB 3NL2A 4K9IA 5EYNA 3RTDA 3RPHA 4B8SA 3RT9A 3UBOA 1L2LA 3MBHA 4EUMA 4N09A 3RM5A 3RTAA 4KALA 4EN4A 5BYFA 2PKNA 1RK2A 3NL6A 3NBVA 4XF6A 1LIJA 1GC5A 3RO4A 2ABSA 1BX4A 3KTNA 2VARA 3RTGA 2I6BA 2XTBA 2F7KA 2I6AA 3NCAA 3RU3A 5TRWA 4E3AA 3B1NA 1ESQA 3LOOA 5COJA 3K5WA 3RSSA 4C5NA 5F0ZA 1JXIA 4C5JA 1EKKA 4LC4A 1TZ3A 3HICA 3RQQA 3B3LA 4C5LA 4LBXA 3RTBA 1V19A 5CGAA 4S1MA 1WYEA 4XCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBQ A;  3IQ0 A;  3B1R A;  5C3Z A;  2HQQ A;  1RKA A;  3RPZ A;  4XF7 A;  4EBU A;  1UB0 A;  2HW1 A;  3UQ6 A;  4KBE A;  4KAN A;  1V1A A;  4K8C A;  1C3Q A;  1TYY A;  3VAS A;  4X8F A;  2QHP A;  1YHJ A;  4YL5 A;  3RU2 A;  2JGV A;  3ZS7 A;  4E69 A;  3RQH A;  2DCN A;  2PKM A;  3EWM A;  2ABQ A;  3UQ9 A;  1V1S A;  2JG1 A;  3NBW A;  4K93 A;  1DGM A;  2R3B A;  5B6A A;  3GBU A;  2YXU A;  1U2X A;  2DDW A;  5F11 A;  3BGK A;  1LHP A;  3UQD A;  2V78 A;  3LKI A;  3NL3 A;  3JUL A;  4JKS A;  2C4E A;  3RS9 A;  4C5M A;  3DRW A;  2AJR A;  5BYE A;  3H74 A;  3QA2 A;  5C41 A;  4E84 A;  3RSF A;  1RFT A;  1RKS A;  3B1P A;  3UMP A;  1LIK A;  4EOH A;  4K9C A;  4JKU A;  3Q92 A;  5BYD A;  3RTE A;  3MBJ A;  4LBG A;  2AB8 A;  3LJS A;  5C40 A;  4JJP A;  5TQI A;  3W4S A;  3FHY A;  3RT7 A;  1EKQ A;  4DC3 A;  2F02 A;  3RQ8 A;  3RRE A;  1UA4 A;  1LIO A;  2AJP A;  3PZS A;  2YXT A;  1GQT A;  4S1H A;  3RQX A;  5BYC A;  3NL5 A;  1LII A;  2FV7 A;  2I5B A;  3CQD A;  3GO6 A;  3LHX A;  3HYO A;  5CM5 A;  3VAQ A;  3NC2 A;  2JG5 A;  2DDO A;  3RS8 A;  4YWR A;  4K8P A;  4WJM A;  3B1O A;  1YGK A;  3RRF A;  3GO7 A;  4K8K A;  2NWH A;  2Q5R A;  1YGJ A;  3K9E A;  4B8R A;  1LHR A;  3RRJ A;  3RY7 A;  4O1G A;  1JXH A;  3OTX A;  4C5K A;  2RBC A;  5EY7 A;  3RQ6 A;  4UBE A;  3RSG A;  4U7X A;  3N1C A;  3NC9 A;  3QAI A;  3UMO A;  1VK4 A;  3KZH A;  1RFV A;  4O1L A;  1TD2 A;  3IN1 A;  3RRB A;  3RSQ A;  2AA0 A;  3RQ5 A;  4GM6 A;  2AFB A;  1RKD A;  1VM7 A;  3Q1Y A;  4KAD A;  3RTC A;  2R3E A;  3RQ2 A;  3B1Q A;  2PKK A;  2PKF A;  5CGE A;  3BF5 A;  2A9Y A;  3I3Y A;  1VI9 A;  3NM1 A;  4E8Z A;  3DZV A;  3IH0 A;  2HLZ A;  4LCA A;  4DU5 A;  2A9Z A;  2DDM A;  1KYH A;  3NM3 A;  3PL2 A;  1V1B A;  4N08 A;  1ESJ A;  3FHX A;  4KAH A;  1TZ6 A;  3IKH A;  3KEU A;  3H49 A;  4XDA A;  2QCV A;  3HPD A;  4S1I A;  3UQE A;  4E8Y A;  4PVV A;  4E8W A;  5C3Y A;  3KD6 A;  2AX3 A;  3IE7 A;  2C49 A;  2AWD A;  4K8T A;  1RFU A;  4S1I B;  3NL2 A;  4K9I A;  5EYN A;  3RTD A;  3RPH A;  4B8S A;  3RT9 A;  3UBO A;  1L2L A;  3MBH A;  4EUM A;  4N09 A;  3RM5 A;  3RTA A;  4KAL A;  4EN4 A;  5BYF A;  2PKN A;  1RK2 A;  3NL6 A;  3NBV A;  4XF6 A;  1LIJ A;  1GC5 A;  3RO4 A;  2ABS A;  1BX4 A;  3KTN A;  2VAR A;  3RTG A;  2I6B A;  2XTB A;  2F7K A;  2I6A A;  3NCA A;  3RU3 A;  5TRW A;  4E3A A;  3B1N A;  1ESQ A;  3LOO A;  5COJ A;  3K5W A;  3RSS A;  4C5N A;  5F0Z A;  1JXI A;  4C5J A;  1EKK A;  4LC4 A;  1TZ3 A;  3HIC A;  3RQQ A;  3B3L A;  4C5L A;  4LBX A;  3RTB A;  1V19 A;  5CGA A;  4S1M A;  1WYE A;  4XCK A; 
#chains in the Genus database with same CATH topology
 3IBQ A;  3IQ0 A;  3B1R A;  4HV4 A;  5C3Z A;  2HQQ A;  1RKA A;  3RPZ A;  2WTZ A;  4XF7 A;  1UB0 A;  2HW1 A;  4EBU A;  4KBE A;  3UQ6 A;  4KAN A;  4CVK A;  1V1A A;  4K8C A;  1C3Q A;  4ZIY A;  1TYY A;  3VAS A;  4X8F A;  2QHP A;  1YHJ A;  2JFF A;  4YL5 A;  2JGV A;  3RU2 A;  3ZS7 A;  4E69 A;  3RQH A;  2DCN A;  2PKM A;  3EWM A;  2ABQ A;  3UQ9 A;  1V1S A;  2JG1 A;  3NBW A;  4K93 A;  1DGM A;  2R3B A;  5B6A A;  3GBU A;  2YXU A;  1U2X A;  2DDW A;  2XJA A;  3BGK A;  1LHP A;  5F11 A;  2V78 A;  3LKI A;  3NL3 A;  3JUL A;  4JKS A;  2C4E A;  2UAG A;  3RS9 A;  3DRW A;  2AJR A;  4C5M A;  3H74 A;  3QA2 A;  5C41 A;  3ZM6 A;  2VTE A;  1RFT A;  1RKS A;  3B1P A;  3PYZ A;  1LIK A;  3RSF A;  3UMP A;  4E84 A;  4K9C A;  4JKU A;  4EOH A;  3Q92 A;  5BYD A;  1E0D A;  3MBJ A;  2GCA A;  2AB8 A;  2WJP A;  3LJS A;  4LBG A;  3RTE A;  5C40 A;  3UQD A;  4JJP A;  5TQI A;  5BYE A;  1JBV A;  3W4S A;  3FHY A;  3RT7 A;  1EKQ A;  4DC3 A;  2F02 A;  3RQ8 A;  3RRE A;  1UA4 A;  1LIO A;  2AJP A;  3PZS A;  2X5O A;  1GQT A;  2YXT A;  4S1H A;  3RQX A;  5BYC A;  3NL5 A;  1LII A;  2VTD A;  3UAG A;  2FV7 A;  2I5B A;  3CQD A;  3GO6 A;  3LHX A;  3HYO A;  5CM5 A;  3VAQ A;  3NC2 A;  2JG5 A;  2DDO A;  3RS8 A;  4YWR A;  4K8P A;  4BUC A;  2Y68 A;  3N2A A;  4WJM A;  2JFH A;  3B1O A;  1GQY A;  3LK7 A;  1YGK A;  3RRF A;  3GO7 A;  4K8K A;  2NWH A;  1W7K A;  2Q5R A;  1YGJ A;  3K9E A;  2UUO A;  4B8R A;  1LHR A;  3RRJ A;  1UAG A;  3RY7 A;  4C13 A;  4O1G A;  1JXH A;  3OTX A;  4C5K A;  4QF5 A;  2RBC A;  3QCZ A;  2Y67 A;  5EY7 A;  4QDI A;  2VOR A;  2AM1 A;  4UBE A;  2AM2 A;  4U7X A;  3RQ6 A;  3RSG A;  3N1C A;  3NC9 A;  3QAI A;  4S1M A;  3UMO A;  1P31 A;  1VK4 A;  3KZH A;  1RFV A;  4O1L A;  1TD2 A;  3IN1 A;  3RRB A;  3RSQ A;  5A5E A;  2AA0 A;  3RQ5 A;  4GM6 A;  4CVM A;  2AFB A;  1RKD A;  1VM7 A;  3Q1Y A;  4KAD A;  3RTC A;  2R3E A;  3RQ2 A;  3B1Q A;  3ZM5 A;  2PKK A;  2PKF A;  5CGE A;  1E8C A;  2JFG A;  3BF5 A;  2A9Y A;  3EAG A;  1VI9 A;  3I3Y A;  3NM1 A;  3NRS A;  4E8Z A;  3DZV A;  3IH0 A;  2HLZ A;  4LCA A;  4DU5 A;  2A9Z A;  4UAG A;  1GQQ A;  2DDM A;  2VOS A;  2GC6 A;  4CVL A;  1KYH A;  2GC5 A;  3NM3 A;  3PL2 A;  1V1B A;  4N08 A;  1ESJ A;  1GG4 A;  3FHX A;  2Y1O A;  1TZ6 A;  3IKH A;  4KAH A;  3KEU A;  3H49 A;  3HJ6 A;  4XDA A;  2F00 A;  2QCV A;  3HPD A;  4S1I A;  3UQE A;  4E8Y A;  4PVV A;  4E8W A;  5C3Y A;  1J6U A;  3KD6 A;  2AX3 A;  3IE7 A;  2Y66 A;  2C49 A;  2AWD A;  4K8T A;  1RFU A;  2UUP A;  1O5Z A;  4S1I B;  1EEH A;  3NL2 A;  4K9I A;  5EYN A;  3RTD A;  3RPH A;  4B8S A;  2XPC A;  3RT9 A;  3UBO A;  4C12 A;  1L2L A;  3MBH A;  4EUM A;  4N09 A;  3RM5 A;  3RTA A;  4KAL A;  1FGS A;  2GCB A;  2PKN A;  1P3D A;  4EN4 A;  1RK2 A;  5BYF A;  3NL6 A;  3NBV A;  3ZL8 A;  4XF6 A;  1LIJ A;  1GC5 A;  3RO4 A;  2ABS A;  1BX4 A;  4BUB A;  1W78 A;  3KTN A;  2VAR A;  3RTG A;  2I6B A;  2XTB A;  2F7K A;  2I6A A;  3NCA A;  3RU3 A;  5TRW A;  4E3A A;  3B1N A;  1ESQ A;  3LOO A;  5COJ A;  3K5W A;  3RSS A;  4C5N A;  5A5F A;  1JXI A;  5F0Z A;  4C5J A;  1EKK A;  4LC4 A;  1TZ3 A;  3HIC A;  3RQQ A;  3B3L A;  3HN7 A;  4C5L A;  4LBX A;  3RTB A;  1V19 A;  5CGA A;  1JBW A;  1WYE A;  4XCK A; 
#chains in the Genus database with same CATH homology
 3IBQ A;  3IQ0 A;  3B1R A;  5C3Z A;  2HQQ A;  1RKA A;  3RPZ A;  4XF7 A;  4EBU A;  1UB0 A;  2HW1 A;  3UQ6 A;  4KBE A;  4KAN A;  1V1A A;  4K8C A;  1C3Q A;  1TYY A;  3VAS A;  4X8F A;  2QHP A;  1YHJ A;  4YL5 A;  3RU2 A;  2JGV A;  3ZS7 A;  4E69 A;  3RQH A;  2DCN A;  2PKM A;  3EWM A;  2ABQ A;  3UQ9 A;  1V1S A;  2JG1 A;  3NBW A;  4K93 A;  1DGM A;  2R3B A;  5B6A A;  3GBU A;  2YXU A;  1U2X A;  2DDW A;  5F11 A;  3BGK A;  1LHP A;  3UQD A;  2V78 A;  3LKI A;  3NL3 A;  3JUL A;  4JKS A;  2C4E A;  3RS9 A;  4C5M A;  3DRW A;  2AJR A;  5BYE A;  3H74 A;  3QA2 A;  5C41 A;  4E84 A;  3RSF A;  1RFT A;  1RKS A;  3B1P A;  3UMP A;  1LIK A;  4EOH A;  4K9C A;  4JKU A;  3Q92 A;  5BYD A;  3RTE A;  3MBJ A;  4LBG A;  2AB8 A;  3LJS A;  5C40 A;  4JJP A;  5TQI A;  3W4S A;  3FHY A;  3RT7 A;  1EKQ A;  4DC3 A;  2F02 A;  3RQ8 A;  3RRE A;  1UA4 A;  1LIO A;  2AJP A;  3PZS A;  2YXT A;  1GQT A;  4S1H A;  3RQX A;  5BYC A;  3NL5 A;  1LII A;  2FV7 A;  2I5B A;  3CQD A;  3GO6 A;  3LHX A;  3HYO A;  5CM5 A;  3VAQ A;  3NC2 A;  2JG5 A;  2DDO A;  3RS8 A;  4YWR A;  4K8P A;  4WJM A;  3B1O A;  1YGK A;  3RRF A;  3GO7 A;  4K8K A;  2NWH A;  2Q5R A;  1YGJ A;  3K9E A;  4B8R A;  1LHR A;  3RRJ A;  3RY7 A;  4O1G A;  1JXH A;  3OTX A;  4C5K A;  2RBC A;  5EY7 A;  3RQ6 A;  4UBE A;  3RSG A;  4U7X A;  3N1C A;  3NC9 A;  3QAI A;  3UMO A;  1VK4 A;  3KZH A;  1RFV A;  4O1L A;  1TD2 A;  3IN1 A;  3RRB A;  3RSQ A;  2AA0 A;  3RQ5 A;  4GM6 A;  2AFB A;  1RKD A;  1VM7 A;  3Q1Y A;  4KAD A;  3RTC A;  2R3E A;  3RQ2 A;  3B1Q A;  2PKK A;  2PKF A;  5CGE A;  3BF5 A;  2A9Y A;  3I3Y A;  1VI9 A;  3NM1 A;  4E8Z A;  3DZV A;  3IH0 A;  2HLZ A;  4LCA A;  4DU5 A;  2A9Z A;  2DDM A;  1KYH A;  3NM3 A;  3PL2 A;  1V1B A;  4N08 A;  1ESJ A;  3FHX A;  4KAH A;  1TZ6 A;  3IKH A;  3KEU A;  3H49 A;  3HJ6 A;  4XDA A;  2QCV A;  3HPD A;  4S1I A;  3UQE A;  4E8Y A;  4PVV A;  4E8W A;  5C3Y A;  3KD6 A;  2AX3 A;  3IE7 A;  2C49 A;  2AWD A;  4K8T A;  1RFU A;  4S1I B;  3NL2 A;  4K9I A;  5EYN A;  3RTD A;  3RPH A;  4B8S A;  3RT9 A;  3UBO A;  1L2L A;  3MBH A;  4EUM A;  4N09 A;  3RM5 A;  3RTA A;  4KAL A;  4EN4 A;  5BYF A;  2PKN A;  1RK2 A;  3NL6 A;  3NBV A;  4XF6 A;  1LIJ A;  1GC5 A;  3RO4 A;  2ABS A;  1BX4 A;  3KTN A;  2VAR A;  3RTG A;  2I6B A;  2XTB A;  2F7K A;  2I6A A;  3NCA A;  3RU3 A;  5TRW A;  4E3A A;  3B1N A;  1ESQ A;  3LOO A;  5COJ A;  3K5W A;  3RSS A;  4C5N A;  5F0Z A;  1JXI A;  4C5J A;  1EKK A;  4LC4 A;  1TZ3 A;  3HIC A;  3RQQ A;  3B3L A;  4C5L A;  4LBX A;  3RTB A;  1V19 A;  5CGA A;  4S1M A;  1WYE A;  4XCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...