2I5CA

Crystal structure of the c-terminal ph domain of pleckstrin in complex with d-myo-ins(1,2,3,4,5)p5
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
94
Chain Sequence
VIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pleckstrin
publication title Structural analysis of the carboxy terminal PH domain of pleckstrin bound to D-myo-inositol 1,2,3,5,6-pentakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 17
structure length 94
sequence length 104
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2i5cA00
2DHIA 1X05A 1J0WA 4PNKA 1U27A 4MY6A 1N3HA 2ROVA 1TQZA 2EC1A 2K2UA 1NU2A 5DI9B 2P8VA 1FOEA 3LJUX 2EJ8A 3U7DA 2D9WA 2D4QA 2ELBA 2VRWB 3RCPA 3TVVA 3P6AA 5HE1A 3AU4A 3AJ4A 2R09A 3ODWA 3PVLA 5EFXA 3F0WA 3SV1A 1EF1A 2MFQA 2RVBB 2DX5A 4WSFA 2DHKA 2YVCA 4K81A 3U8ZA 3KY9A 1OMWA 4IOYX 2J59M 5J3TA 4WJ7A 3HW2B 3SO6A 4Z2MB 1IRSA 2NMBA 3D8DA 5C79A 3CXBB 4HB3B 3N7CA 1WJ1A 1XKEA 4EMOA 1WGUA 5KQ1A 1XCGA 5JLJB 3KZ1A 1K5GB 3D8FA 3M1IB 1NTYA 3HQCA 2DYQA 2D9YA 2LYDA 4PQ0A 1ZSQA 3D8EA 2K00A 4L6EA 4F7GA 1V88A 2H7DA 2P0HA 1DBHA 2HE7A 2YS5A 2J0MA 1U5EA 1V5PA 1X1GA 1U29A 4K2OA 2LG1A 2I1JA 4B6HA 1FGYA 3AU5A 4DX8A 3F5RA 4KVGB 2CRFA 1FHXA 1U5GA 2Z0PA 3A8PA 2COCA 2CODA 4KHAA 2DX1A 2E2XA 2RUKB 3DXCA 1WG7A 2I5FA 1UNRA 2D2QA 4K17A 4A6KA 2DHJA 5FI1A 4HAVB 2R0DA 1X86A 5J3YA 2VSZA 4C0AA 3PVUA 2M38A 1ZC4B 2HTHB 1OY2A 2W2XD 3P7ZA 4ZRKA 2YS3A 2D9XA 1P5TA 2XQNM 3DXDA 2P0FA 2KGXB 3TW1A 5HE3A 4HAWB 2X18A 2DFKA 3A98B 1W1GA 3V5WA 2AEHA 4P7IA 3GYPA 4A6FB 5JHHA 2QKLA 4Y94A 1XR0B 3PSCA 2KUPA 5DHAB 1UNPA 1W1HA 4ZRIA 2CY4A 2YSZA 1MAIA 2OTXA 1W1DA 1U5DA 3ZDTA 4IFSA 1LW3A 2PZ1A 2YRYA 3QIJA 4H8SA 3MDBC 2QKMA 2W2XC 2I1KA 4HB2B 4DXAB 2N0YA 1Y19B 2Z0QA 1PMSA 3IVFA 1DDMA 2IYBA 4NY0A 1DDWA 3TCAA 2NZ8B 1EVHA 1UNQA 2EMSA 5JP4A 2ELAA 5KCVA 3PG7A 1BWNA 2ADZA 1X11A 2UVMA 1H10A 2RGNB 4HATB 3ODXA 1SGHA 1DYNA 1OQNA 3FSSA 4KAXB 1M7RA 1V89A 1LB1A 3ML4A 4GMXB 4NSWA 5HE2A 5HE0A 1V5UA 2DKQA 2RNRB 1V5MA 3ZVRA 1GG3A 2AL6A 1AWEA 2LOZA 1WGQA 2JP2A 4F7UP 4WVFB 5D3YA 2DN6A 1MIZB 1NTVA 2MKRA 3KSYA 2H7EA 5C16A 1Q67A 3QWMA 2VKIA 3ULBA 1Y5OA 2L2IA 2GS0A 2LULA 4A6FA 4GPTB 1MPHA 3WYFB 4HAXB 2G35A 2I5CA 1XD4A 3G9WA 1FHWA 3BINA 2N23A 2D9ZA 3A8QA 2FJLA 3NSUA 1KZ7A 3SYXA 3VOQA 4CYEA 5JHGA 2RSGA 2YS1A 3ULCA 4HAYB 1MKEA 1K5DB 2Z0OA 5DH9B 3QBVB 4MK0A 4HDQA 5KQ4A 5C5BB 3T06A 2GCJA 4HDOA 1UPQA 1QQGA 2IFSA 4MT7A 1BAKA 1ZC3B 4HHVA 1P3RA 4CHMA 2LOXA 3PZDA 1I7AA 1UPRA 1WJMA 2Y7BA 4KHOA 2V76A 4HAUB 3BJIA 4GZUA 3SUZA 1PFJA 5CLLB 4YONA 2Y8GA 4EJNA 4GMVA 3X23A 2COAA 2MDXA 3O96A 2UZSA 3KRWA 4EKUA 2W2WA 1EAZA 1V61A 3WA0A 2Q13A 2DKPA 3UZTA 1E5WA 2CAYA 3OANA 4D0NB 2P0DA 5C6RA 3MPXA 2L1CA 1XODA 1GC7A 4F7HA 4BBKA 1X1FA 2DA0A 2J0KA 4CHJA 1U5FA 1M7EA 3FEHA 5D3WA 1MK7B 1WVHA 1QC6A 4HAZB 1TJ6A 3DXEA 2DYNA 3VIAA 3HK0A 4XWXA 1TXDA 1J19A 1SHCA 2EMTA 2RLOA 3PP2A 2UZRA 1XX0A 3KRXA 2CY5A 2DTCA 2Y8FA 4IAPA 4GN1A 1BTKA 4A6HA 4Z2NA 4KHBB 1ZVRA 1ZM0A 5C5BA 2M14A 2ROZB 4TYZA 1UEFA 2D10A 3FM8C 3PEGA 4K2PA 5CLQB 5D27A 4GXBA 3TO1A 1KI1B 5LOPB 5FI0A 4DX90 3GYOA 1PLSA 2GCLA 5L81A 1ISNA 4HB4B 1B55A 2D11A 1EGXA 4HB0B 2KCJA 1I2HA 3TFMA 2DLWA 2J0JA 1MIXA 1FB8A 2LKOA 1P6SA 3ODOA 2OQBA 5GOWB 4A5KA 2BCJA 2D9VA 2YT1A 1NI2A 3SNHA 5DHFB 1WI1A 1Z87A 4TKNA 5LONB 2GJYA 2YT0A 1RJ2A 1FGZA 5DIFB 5D3VA 2YF0A 1GC6A 1H4RA 1KZGA 2MWNB 5J3QA 4DBBA 1MK9B 1DDVA 2ZPYA 2COFA 4ZRJA 2K2JA 3PVWA 1U2BA 1RRPB 3CIKA 4YL8A 1FAOA 1DROA 5D3XA 1AQCA 1BTNA 1FHOA
chains in the Genus database with same CATH superfamily
2DHIA 1X05A 1J0WA 4PNKA 1U27A 4MY6A 1N3HA 2ROVA 1TQZA 2EC1A 2K2UA 1NU2A 5DI9B 2P8VA 1FOEA 3LJUX 2EJ8A 3U7DA 2D9WA 4QJ3B 2D4QA 2ELBA 3HIEA 2K49A 4KHBA 2VRWB 3RCPA 3TVVA 3P6AA 1T77A 5HE1A 3AU4A 3AJ4A 2R09A 3ODWA 3PVLA 5EFXA 3F0WA 3SV1A 4D6WA 1EF1A 2MFQA 2RVBB 2DX5A 4OSNA 2DHKA 4WSFA 2KR0A 2YVCA 4K81A 3U8ZA 3KY9A 1OMWA 2NBVA 4IOYX 2J59M 5J3TA 4WJ7A 3HW2B 3SO6A 4Z2MB 1IRSA 2NMBA 3D8DA 5C79A 3CXBB 4HB3B 2R2YA 3N7CA 1WJ1A 1XKEA 4EMOA 1WGUA 5KQ1A 1XCGA 5M4YB 5JLJB 3KZ1A 1K5GB 3D8FA 3M1IB 1NTYA 3HQCA 2DYQA 4OT1A 2D9YA 2LYDA 4PQ0A 1ZSQA 3D8EA 4GNKB 2K00A 3B77A 4L6EA 4F7GA 1V88A 5LG4B 2H7DA 2P0HA 1DBHA 2HE7A 2YS5A 2J0MA 1U5EA 1V5PA 1X1GA 1U29A 4K2OA 2LG1A 2I1JA 4B6HA 1FGYA 3AU5A 4DX8A 3F5RA 4KVGB 2CRFA 5IRSA 1FHXA 1U5GA 2Z0PA 3DCXA 3A8PA 2COCA 2CODA 4KHAA 2DX1A 2E2XA 2RUKB 3DXCA 1WG7A 2I5FA 1UNRA 2D2QA 4K17A 4A6KA 2DHJA 5FI1A 4HAVB 2R0DA 1X86A 5J3YA 2VSZA 4C0AA 3PVUA 2M38A 1ZC4B 2HTHB 1OY2A 4CSQA 2W2XD 3P7ZA 4ZRKA 2YS3A 2D9XA 1P5TA 2XQNM 3DXDA 2P0FA 2KGXB 3TW1A 5HE3A 4HAWB 2X18A 2DFKA 3A98B 1W1GA 3V5WA 2AEHA 4P7IA 3GYPA 4A6FB 5JHHA 2QKLA 4Y94A 1XR0B 2Z59A 3PSCA 2KUPA 5DHAB 1UNPA 1W1HA 4QJ4B 4ZRIA 2CY4A 2YSZA 1MAIA 2OTXA 1W1DA 1U5DA 3ZDTA 3A58A 4IFSA 1LW3A 2PZ1A 2YRYA 3QIJA 4H8SA 3MDBC 2QKMA 2W2XC 2I1KA 4HB2B 4DXAB 2N0YA 1Y19B 2Z0QA 1PMSA 3IVFA 3OHMB 1DDMA 2IYBA 4NY0A 1DDWA 2FJUB 3TCAA 2NZ8B 1EVHA 1UNQA 2EMSA 5JP4A 2ELAA 5KCVA 3PG7A 2Z14A 1BWNA 2ADZA 1MI1A 1X11A 2UVMA 1H10A 2RGNB 4HATB 3ODXA 5I2SA 2Z4DA 1SGHA 1DYNA 1OQNA 3FSSA 4KAXB 1M7RA 1V89A 1LB1A 3ML4A 4GMXB 4NSWA 5HE2A 5HE0A 1V5UA 2DKQA 2RNRB 1V5MA 3ZVRA 1GG3A 2AL6A 1AWEA 2LOZA 1WGQA 2JP2A 4F7UP 4WVFB 5D3YA 2DN6A 3FVCA 1MIZB 1NTVA 2MKRA 3KSYA 4QJ5B 2H7EA 5C16A 1Q67A 3QWMA 2VKIA 3ULBA 1Y5OA 2L2IA 2GS0A 2KIEA 2LULA 4A6FA 4GPTB 1MPHA 3WYFB 4HAXB 2G35A 2I5CA 1XD4A 3G9WA 1FHWA 3BINA 2N23A 2D9ZA 3A8QA 2FJLA 3NSUA 1KZ7A 3SYXA 3VOQA 4CYEA 5JHGA 2RSGA 2YS1A 4QXAB 3ULCA 4HAYB 1MKEA 1K5DB 2Z0OA 5DH9B 3QBVB 4MK0A 4HDQA 5KQ4A 5C5BB 3T06A 2GCJA 4HDOA 1UPQA 1QQGA 2IFSA 4MT7A 1BAKA 1ZC3B 4HHVA 1P3RA 4CHMA 2LOXA 3PZDA 1I7AA 1UPRA 1WJMA 2Y7BA 4KHOA 2V76A 4HAUB 3HSAA 3BJIA 4GZUA 3SUZA 1PFJA 5CLLB 4YONA 2Y8GA 3NWFA 4EJNA 4GMVA 3X23A 2COAA 2MDXA 4GOUA 3O96A 3NW8A 2UZSA 3KRWA 4EKUA 2W2WA 1EAZA 1V61A 3WA0A 2Q13A 2DKPA 5I2MA 3UZTA 1E5WA 2CAYA 3OANA 4D0NB 2P0DA 5C6RA 3MPXA 2L1CA 2KIGA 1XODA 1GC7A 4F7HA 4BBKA 1X1FA 2DA0A 2J0KA 4CHJA 1U5FA 1M7EA 3FEHA 5D3WA 2KUQA 1MK7B 1WVHA 1QC6A 4HAZB 1TJ6A 3DXEA 2DYNA 3VIAA 3HK0A 4XWXA 2GUMA 1TXDA 1J19A 1SHCA 2EMTA 2RLOA 3PP2A 2UZRA 2Z13A 1XX0A 3KRXA 2CY5A 2DTCA 2Y8FA 4IAPA 4GN1A 3U12A 1BTKA 4A6HA 4Z2NA 4KHBB 1ZVRA 1ZM0A 5C5BA 2M14A 2ROZB 4TYZA 1UEFA 4HSIA 2D10A 3FM8C 3PEGA 4K2PA 5CLQB 5D27A 4GXBA 3TO1A 1KI1B 5LOPB 5FI0A 4DX90 3GYOA 3NWAA 3NWDA 1PLSA 2GCLA 5L81A 2K8EA 1ISNA 4HB4B 1B55A 2D11A 1EGXA 4HB0B 2KCJA 1I2HA 3TFMA 2DLWA 2YT2A 2J0JA 1MIXA 1ZYIA 1FB8A 2LKOA 1P6SA 3ODOA 2OQBA 5GOWB 4A5KA 2BCJA 2D9VA 2YT1A 1NI2A 3SNHA 5DHFB 1WI1A 1Z87A 4TKNA 2ZKMX 5LONB 2GJYA 2YT0A 1RJ2A 1FGZA 5DIFB 5D3VA 2YF0A 1GC6A 1H4RA 1KZGA 2MWNB 5J3QA 2RRFA 4DBBA 1MK9B 1DDVA 2ZPYA 2COFA 4ZRJA 4DIXA 2K2JA 3PVWA 4L1RA 1U2BA 1RRPB 3CIKA 4YL8A 1FAOA 1DROA 5D3XA 1AQCA 1BTNA 1FHOA
chains in the Genus database with same CATH topology
2DHIA 1X05A 1J0WA 4PNKA 1U27A 4MY6A 1N3HA 2ROVA 1TQZA 2EC1A 2K2UA 1NU2A 5DI9B 2P8VA 1FOEA 3LJUX 2EJ8A 3U7DA 2D9WA 2D4QA 2ELBA 2VRWB 3RCPA 3TVVA 3P6AA 5HE1A 3AU4A 3AJ4A 2R09A 3ODWA 3PVLA 5EFXA 3F0WA 3SV1A 1EF1A 2MFQA 2RVBB 2DX5A 4WSFA 2DHKA 2YVCA 4K81A 3U8ZA 3KY9A 1OMWA 4IOYX 2J59M 5J3TA 4WJ7A 3HW2B 3SO6A 4Z2MB 1IRSA 2NMBA 3D8DA 5C79A 3CXBB 4HB3B 3N7CA 1WJ1A 1XKEA 4EMOA 1WGUA 5KQ1A 1XCGA 5JLJB 3KZ1A 1K5GB 3D8FA 3M1IB 1NTYA 3HQCA 2DYQA 2D9YA 2LYDA 4PQ0A 1ZSQA 3D8EA 2K00A 4L6EA 4F7GA 1V88A 2H7DA 2P0HA 1DBHA 2HE7A 2YS5A 2J0MA 1U5EA 1V5PA 1X1GA 1U29A 4K2OA 2LG1A 2I1JA 4B6HA 1FGYA 3AU5A 4DX8A 3F5RA 4KVGB 2CRFA 1FHXA 1U5GA 2Z0PA 3A8PA 2COCA 2CODA 4KHAA 2DX1A 2E2XA 2RUKB 3DXCA 1WG7A 2I5FA 1UNRA 2D2QA 4K17A 4A6KA 2DHJA 5FI1A 4HAVB 2R0DA 1X86A 5J3YA 2VSZA 4C0AA 3PVUA 2M38A 1ZC4B 2HTHB 1OY2A 2W2XD 3P7ZA 4ZRKA 2YS3A 2D9XA 1P5TA 2XQNM 3DXDA 2P0FA 2KGXB 3TW1A 5HE3A 4HAWB 2X18A 2DFKA 3A98B 1W1GA 3V5WA 2AEHA 4P7IA 3GYPA 4A6FB 5JHHA 2QKLA 4Y94A 1XR0B 3PSCA 2KUPA 5DHAB 1UNPA 1W1HA 4ZRIA 2CY4A 2YSZA 1MAIA 2OTXA 1W1DA 1U5DA 3ZDTA 4IFSA 1LW3A 2PZ1A 2YRYA 3QIJA 4H8SA 3MDBC 2QKMA 2W2XC 2I1KA 4HB2B 4DXAB 2N0YA 1Y19B 2Z0QA 1PMSA 3IVFA 1DDMA 2IYBA 4NY0A 1DDWA 3TCAA 2NZ8B 1EVHA 1UNQA 2EMSA 5JP4A 2ELAA 5KCVA 3PG7A 1BWNA 2ADZA 1X11A 2UVMA 1H10A 2RGNB 4HATB 3ODXA 1SGHA 1DYNA 1OQNA 3FSSA 4KAXB 1M7RA 1V89A 1LB1A 3ML4A 4GMXB 4NSWA 5HE2A 5HE0A 1V5UA 2DKQA 2RNRB 1V5MA 3ZVRA 1GG3A 2AL6A 1AWEA 2LOZA 1WGQA 2JP2A 4F7UP 4WVFB 5D3YA 2DN6A 1MIZB 1NTVA 2MKRA 3KSYA 2H7EA 5C16A 1Q67A 3QWMA 2VKIA 3ULBA 1Y5OA 2L2IA 2GS0A 2LULA 4A6FA 4GPTB 1MPHA 3WYFB 4HAXB 2G35A 2I5CA 1XD4A 3G9WA 1FHWA 3BINA 2N23A 2D9ZA 3A8QA 2FJLA 3NSUA 1KZ7A 3SYXA 3VOQA 4CYEA 5JHGA 2RSGA 2YS1A 3ULCA 4HAYB 1MKEA 1K5DB 2Z0OA 5DH9B 3QBVB 4MK0A 4HDQA 5KQ4A 5C5BB 3T06A 2GCJA 4HDOA 1UPQA 1QQGA 2IFSA 4MT7A 1BAKA 1ZC3B 4HHVA 1P3RA 4CHMA 2LOXA 3PZDA 1I7AA 1UPRA 1WJMA 2Y7BA 4KHOA 2V76A 4HAUB 3BJIA 4GZUA 3SUZA 1PFJA 5CLLB 4YONA 2Y8GA 4EJNA 4GMVA 3X23A 2COAA 2MDXA 3O96A 2UZSA 3KRWA 4EKUA 2W2WA 1EAZA 1V61A 3WA0A 2Q13A 2DKPA 3UZTA 1E5WA 2CAYA 3OANA 4D0NB 2P0DA 5C6RA 3MPXA 2L1CA 1XODA 1GC7A 4F7HA 4BBKA 1X1FA 2DA0A 2J0KA 4CHJA 1U5FA 1M7EA 3FEHA 5D3WA 1MK7B 1WVHA 1QC6A 4HAZB 1TJ6A 3DXEA 2DYNA 3VIAA 3HK0A 4XWXA 1TXDA 1J19A 1SHCA 2EMTA 2RLOA 3PP2A 2UZRA 1XX0A 3KRXA 2CY5A 2DTCA 2Y8FA 4IAPA 4GN1A 1BTKA 4A6HA 4Z2NA 4KHBB 1ZVRA 1ZM0A 5C5BA 2M14A 2ROZB 4TYZA 1UEFA 2D10A 3FM8C 3PEGA 4K2PA 5CLQB 5D27A 4GXBA 3TO1A 1KI1B 5LOPB 5FI0A 4DX90 3GYOA 1PLSA 2GCLA 5L81A 1ISNA 4HB4B 1B55A 2D11A 1EGXA 4HB0B 2KCJA 1I2HA 3TFMA 2DLWA 2J0JA 1MIXA 1FB8A 2LKOA 1P6SA 3ODOA 2OQBA 5GOWB 4A5KA 2BCJA 2D9VA 2YT1A 1NI2A 3SNHA 5DHFB 1WI1A 1Z87A 4TKNA 5LONB 2GJYA 2YT0A 1RJ2A 1FGZA 5DIFB 5D3VA 2YF0A 1GC6A 1H4RA 1KZGA 2MWNB 5J3QA 4DBBA 1MK9B 1DDVA 2ZPYA 2COFA 4ZRJA 2K2JA 3PVWA 1U2BA 1RRPB 3CIKA 4YL8A 1FAOA 1DROA 5D3XA 1AQCA 1BTNA 1FHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHI A;  1X05 A;  1J0W A;  4PNK A;  1U27 A;  4MY6 A;  1N3H A;  2ROV A;  1TQZ A;  2EC1 A;  2K2U A;  1NU2 A;  5DI9 B;  2P8V A;  1FOE A;  3LJU X;  2EJ8 A;  3U7D A;  2D9W A;  2D4Q A;  2ELB A;  2VRW B;  3RCP A;  3TVV A;  3P6A A;  5HE1 A;  3AU4 A;  3AJ4 A;  2R09 A;  3ODW A;  3PVL A;  5EFX A;  3F0W A;  3SV1 A;  1EF1 A;  2MFQ A;  2RVB B;  2DX5 A;  4WSF A;  2DHK A;  2YVC A;  4K81 A;  3U8Z A;  3KY9 A;  1OMW A;  4IOY X;  2J59 M;  5J3T A;  4WJ7 A;  3HW2 B;  3SO6 A;  4Z2M B;  1IRS A;  2NMB A;  3D8D A;  5C79 A;  3CXB B;  4HB3 B;  3N7C A;  1WJ1 A;  1XKE A;  4EMO A;  1WGU A;  5KQ1 A;  1XCG A;  5JLJ B;  3KZ1 A;  1K5G B;  3D8F A;  3M1I B;  1NTY A;  3HQC A;  2DYQ A;  2D9Y A;  2LYD A;  4PQ0 A;  1ZSQ A;  3D8E A;  2K00 A;  4L6E A;  4F7G A;  1V88 A;  2H7D A;  2P0H A;  1DBH A;  2HE7 A;  2YS5 A;  2J0M A;  1U5E A;  1V5P A;  1X1G A;  1U29 A;  4K2O A;  2LG1 A;  2I1J A;  4B6H A;  1FGY A;  3AU5 A;  4DX8 A;  3F5R A;  4KVG B;  2CRF A;  1FHX A;  1U5G A;  2Z0P A;  3A8P A;  2COC A;  2COD A;  4KHA A;  2DX1 A;  2E2X A;  2RUK B;  3DXC A;  1WG7 A;  2I5F A;  1UNR A;  2D2Q A;  4K17 A;  4A6K A;  2DHJ A;  5FI1 A;  4HAV B;  2R0D A;  1X86 A;  5J3Y A;  2VSZ A;  4C0A A;  3PVU A;  2M38 A;  1ZC4 B;  2HTH B;  1OY2 A;  2W2X D;  3P7Z A;  4ZRK A;  2YS3 A;  2D9X A;  1P5T A;  2XQN M;  3DXD A;  2P0F A;  2KGX B;  3TW1 A;  5HE3 A;  4HAW B;  2X18 A;  2DFK A;  3A98 B;  1W1G A;  3V5W A;  2AEH A;  4P7I A;  3GYP A;  4A6F B;  5JHH A;  2QKL A;  4Y94 A;  1XR0 B;  3PSC A;  2KUP A;  5DHA B;  1UNP A;  1W1H A;  4ZRI A;  2CY4 A;  2YSZ A;  1MAI A;  2OTX A;  1W1D A;  1U5D A;  3ZDT A;  4IFS A;  1LW3 A;  2PZ1 A;  2YRY A;  3QIJ A;  4H8S A;  3MDB C;  2QKM A;  2W2X C;  2I1K A;  4HB2 B;  4DXA B;  2N0Y A;  1Y19 B;  2Z0Q A;  1PMS A;  3IVF A;  1DDM A;  2IYB A;  4NY0 A;  1DDW A;  3TCA A;  2NZ8 B;  1EVH A;  1UNQ A;  2EMS A;  5JP4 A;  2ELA A;  5KCV A;  3PG7 A;  1BWN A;  2ADZ A;  1X11 A;  2UVM A;  1H10 A;  2RGN B;  4HAT B;  3ODX A;  1SGH A;  1DYN A;  1OQN A;  3FSS A;  4KAX B;  1M7R A;  1V89 A;  1LB1 A;  3ML4 A;  4GMX B;  4NSW A;  5HE2 A;  5HE0 A;  1V5U A;  2DKQ A;  2RNR B;  1V5M A;  3ZVR A;  1GG3 A;  2AL6 A;  1AWE A;  2LOZ A;  1WGQ A;  2JP2 A;  4F7U P;  4WVF B;  5D3Y A;  2DN6 A;  1MIZ B;  1NTV A;  2MKR A;  3KSY A;  2H7E A;  5C16 A;  1Q67 A;  3QWM A;  2VKI A;  3ULB A;  1Y5O A;  2L2I A;  2GS0 A;  2LUL A;  4A6F A;  4GPT B;  1MPH A;  3WYF B;  4HAX B;  2G35 A;  2I5C A;  1XD4 A;  3G9W A;  1FHW A;  3BIN A;  2N23 A;  2D9Z A;  3A8Q A;  2FJL A;  3NSU A;  1KZ7 A;  3SYX A;  3VOQ A;  4CYE A;  5JHG A;  2RSG A;  2YS1 A;  3ULC A;  4HAY B;  1MKE A;  1K5D B;  2Z0O A;  5DH9 B;  3QBV B;  4MK0 A;  4HDQ A;  5KQ4 A;  5C5B B;  3T06 A;  2GCJ A;  4HDO A;  1UPQ A;  1QQG A;  2IFS A;  4MT7 A;  1BAK A;  1ZC3 B;  4HHV A;  1P3R A;  4CHM A;  2LOX A;  3PZD A;  1I7A A;  1UPR A;  1WJM A;  2Y7B A;  4KHO A;  2V76 A;  4HAU B;  3BJI A;  4GZU A;  3SUZ A;  1PFJ A;  5CLL B;  4YON A;  2Y8G A;  4EJN A;  4GMV A;  3X23 A;  2COA A;  2MDX A;  3O96 A;  2UZS A;  3KRW A;  4EKU A;  2W2W A;  1EAZ A;  1V61 A;  3WA0 A;  2Q13 A;  2DKP A;  3UZT A;  1E5W A;  2CAY A;  3OAN A;  4D0N B;  2P0D A;  5C6R A;  3MPX A;  2L1C A;  1XOD A;  1GC7 A;  4F7H A;  4BBK A;  1X1F A;  2DA0 A;  2J0K A;  4CHJ A;  1U5F A;  1M7E A;  3FEH A;  5D3W A;  1MK7 B;  1WVH A;  1QC6 A;  4HAZ B;  1TJ6 A;  3DXE A;  2DYN A;  3VIA A;  3HK0 A;  4XWX A;  1TXD A;  1J19 A;  1SHC A;  2EMT A;  2RLO A;  3PP2 A;  2UZR A;  1XX0 A;  3KRX A;  2CY5 A;  2DTC A;  2Y8F A;  4IAP A;  4GN1 A;  1BTK A;  4A6H A;  4Z2N A;  4KHB B;  1ZVR A;  1ZM0 A;  5C5B A;  2M14 A;  2ROZ B;  4TYZ A;  1UEF A;  2D10 A;  3FM8 C;  3PEG A;  4K2P A;  5CLQ B;  5D27 A;  4GXB A;  3TO1 A;  1KI1 B;  5LOP B;  5FI0 A;  4DX9 0;  3GYO A;  1PLS A;  2GCL A;  5L81 A;  1ISN A;  4HB4 B;  1B55 A;  2D11 A;  1EGX A;  4HB0 B;  2KCJ A;  1I2H A;  3TFM A;  2DLW A;  2J0J A;  1MIX A;  1FB8 A;  2LKO A;  1P6S A;  3ODO A;  2OQB A;  5GOW B;  4A5K A;  2BCJ A;  2D9V A;  2YT1 A;  1NI2 A;  3SNH A;  5DHF B;  1WI1 A;  1Z87 A;  4TKN A;  5LON B;  2GJY A;  2YT0 A;  1RJ2 A;  1FGZ A;  5DIF B;  5D3V A;  2YF0 A;  1GC6 A;  1H4R A;  1KZG A;  2MWN B;  5J3Q A;  4DBB A;  1MK9 B;  1DDV A;  2ZPY A;  2COF A;  4ZRJ A;  2K2J A;  3PVW A;  1U2B A;  1RRP B;  3CIK A;  4YL8 A;  1FAO A;  1DRO A;  5D3X A;  1AQC A;  1BTN A;  1FHO A; 
#chains in the Genus database with same CATH topology
 2DHI A;  1X05 A;  1J0W A;  4PNK A;  1U27 A;  4MY6 A;  1N3H A;  2ROV A;  1TQZ A;  2EC1 A;  2K2U A;  1NU2 A;  5DI9 B;  2P8V A;  1FOE A;  3LJU X;  2EJ8 A;  3U7D A;  2D9W A;  4QJ3 B;  2D4Q A;  2ELB A;  3HIE A;  2K49 A;  4KHB A;  2VRW B;  3RCP A;  3TVV A;  3P6A A;  1T77 A;  5HE1 A;  3AU4 A;  3AJ4 A;  2R09 A;  3ODW A;  3PVL A;  5EFX A;  3F0W A;  3SV1 A;  4D6W A;  1EF1 A;  2MFQ A;  2RVB B;  2DX5 A;  4OSN A;  2DHK A;  4WSF A;  2KR0 A;  2YVC A;  4K81 A;  3U8Z A;  3KY9 A;  1OMW A;  2NBV A;  4IOY X;  2J59 M;  5J3T A;  4WJ7 A;  3HW2 B;  3SO6 A;  4Z2M B;  1IRS A;  2NMB A;  3D8D A;  5C79 A;  3CXB B;  4HB3 B;  2R2Y A;  3N7C A;  1WJ1 A;  1XKE A;  4EMO A;  1WGU A;  5KQ1 A;  1XCG A;  5M4Y B;  5JLJ B;  3KZ1 A;  1K5G B;  3D8F A;  3M1I B;  1NTY A;  3HQC A;  2DYQ A;  4OT1 A;  2D9Y A;  2LYD A;  4PQ0 A;  1ZSQ A;  3D8E A;  4GNK B;  2K00 A;  3B77 A;  4L6E A;  4F7G A;  1V88 A;  5LG4 B;  2H7D A;  2P0H A;  1DBH A;  2HE7 A;  2YS5 A;  2J0M A;  1U5E A;  1V5P A;  1X1G A;  1U29 A;  4K2O A;  2LG1 A;  2I1J A;  4B6H A;  1FGY A;  3AU5 A;  4DX8 A;  3F5R A;  4KVG B;  2CRF A;  5IRS A;  1FHX A;  1U5G A;  2Z0P A;  3DCX A;  3A8P A;  2COC A;  2COD A;  4KHA A;  2DX1 A;  2E2X A;  2RUK B;  3DXC A;  1WG7 A;  2I5F A;  1UNR A;  2D2Q A;  4K17 A;  4A6K A;  2DHJ A;  5FI1 A;  4HAV B;  2R0D A;  1X86 A;  5J3Y A;  2VSZ A;  4C0A A;  3PVU A;  2M38 A;  1ZC4 B;  2HTH B;  1OY2 A;  4CSQ A;  2W2X D;  3P7Z A;  4ZRK A;  2YS3 A;  2D9X A;  1P5T A;  2XQN M;  3DXD A;  2P0F A;  2KGX B;  3TW1 A;  5HE3 A;  4HAW B;  2X18 A;  2DFK A;  3A98 B;  1W1G A;  3V5W A;  2AEH A;  4P7I A;  3GYP A;  4A6F B;  5JHH A;  2QKL A;  4Y94 A;  1XR0 B;  2Z59 A;  3PSC A;  2KUP A;  5DHA B;  1UNP A;  1W1H A;  4QJ4 B;  4ZRI A;  2CY4 A;  2YSZ A;  1MAI A;  2OTX A;  1W1D A;  1U5D A;  3ZDT A;  3A58 A;  4IFS A;  1LW3 A;  2PZ1 A;  2YRY A;  3QIJ A;  4H8S A;  3MDB C;  2QKM A;  2W2X C;  2I1K A;  4HB2 B;  4DXA B;  2N0Y A;  1Y19 B;  2Z0Q A;  1PMS A;  3IVF A;  3OHM B;  1DDM A;  2IYB A;  4NY0 A;  1DDW A;  2FJU B;  3TCA A;  2NZ8 B;  1EVH A;  1UNQ A;  2EMS A;  5JP4 A;  2ELA A;  5KCV A;  3PG7 A;  2Z14 A;  1BWN A;  2ADZ A;  1MI1 A;  1X11 A;  2UVM A;  1H10 A;  2RGN B;  4HAT B;  3ODX A;  5I2S A;  2Z4D A;  1SGH A;  1DYN A;  1OQN A;  3FSS A;  4KAX B;  1M7R A;  1V89 A;  1LB1 A;  3ML4 A;  4GMX B;  4NSW A;  5HE2 A;  5HE0 A;  1V5U A;  2DKQ A;  2RNR B;  1V5M A;  3ZVR A;  1GG3 A;  2AL6 A;  1AWE A;  2LOZ A;  1WGQ A;  2JP2 A;  4F7U P;  4WVF B;  5D3Y A;  2DN6 A;  3FVC A;  1MIZ B;  1NTV A;  2MKR A;  3KSY A;  4QJ5 B;  2H7E A;  5C16 A;  1Q67 A;  3QWM A;  2VKI A;  3ULB A;  1Y5O A;  2L2I A;  2GS0 A;  2KIE A;  2LUL A;  4A6F A;  4GPT B;  1MPH A;  3WYF B;  4HAX B;  2G35 A;  2I5C A;  1XD4 A;  3G9W A;  1FHW A;  3BIN A;  2N23 A;  2D9Z A;  3A8Q A;  2FJL A;  3NSU A;  1KZ7 A;  3SYX A;  3VOQ A;  4CYE A;  5JHG A;  2RSG A;  2YS1 A;  4QXA B;  3ULC A;  4HAY B;  1MKE A;  1K5D B;  2Z0O A;  5DH9 B;  3QBV B;  4MK0 A;  4HDQ A;  5KQ4 A;  5C5B B;  3T06 A;  2GCJ A;  4HDO A;  1UPQ A;  1QQG A;  2IFS A;  4MT7 A;  1BAK A;  1ZC3 B;  4HHV A;  1P3R A;  4CHM A;  2LOX A;  3PZD A;  1I7A A;  1UPR A;  1WJM A;  2Y7B A;  4KHO A;  2V76 A;  4HAU B;  3HSA A;  3BJI A;  4GZU A;  3SUZ A;  1PFJ A;  5CLL B;  4YON A;  2Y8G A;  3NWF A;  4EJN A;  4GMV A;  3X23 A;  2COA A;  2MDX A;  4GOU A;  3O96 A;  3NW8 A;  2UZS A;  3KRW A;  4EKU A;  2W2W A;  1EAZ A;  1V61 A;  3WA0 A;  2Q13 A;  2DKP A;  5I2M A;  3UZT A;  1E5W A;  2CAY A;  3OAN A;  4D0N B;  2P0D A;  5C6R A;  3MPX A;  2L1C A;  2KIG A;  1XOD A;  1GC7 A;  4F7H A;  4BBK A;  1X1F A;  2DA0 A;  2J0K A;  4CHJ A;  1U5F A;  1M7E A;  3FEH A;  5D3W A;  2KUQ A;  1MK7 B;  1WVH A;  1QC6 A;  4HAZ B;  1TJ6 A;  3DXE A;  2DYN A;  3VIA A;  3HK0 A;  4XWX A;  2GUM A;  1TXD A;  1J19 A;  1SHC A;  2EMT A;  2RLO A;  3PP2 A;  2UZR A;  2Z13 A;  1XX0 A;  3KRX A;  2CY5 A;  2DTC A;  2Y8F A;  4IAP A;  4GN1 A;  3U12 A;  1BTK A;  4A6H A;  4Z2N A;  4KHB B;  1ZVR A;  1ZM0 A;  5C5B A;  2M14 A;  2ROZ B;  4TYZ A;  1UEF A;  4HSI A;  2D10 A;  3FM8 C;  3PEG A;  4K2P A;  5CLQ B;  5D27 A;  4GXB A;  3TO1 A;  1KI1 B;  5LOP B;  5FI0 A;  4DX9 0;  3GYO A;  3NWA A;  3NWD A;  1PLS A;  2GCL A;  5L81 A;  2K8E A;  1ISN A;  4HB4 B;  1B55 A;  2D11 A;  1EGX A;  4HB0 B;  2KCJ A;  1I2H A;  3TFM A;  2DLW A;  2YT2 A;  2J0J A;  1MIX A;  1ZYI A;  1FB8 A;  2LKO A;  1P6S A;  3ODO A;  2OQB A;  5GOW B;  4A5K A;  2BCJ A;  2D9V A;  2YT1 A;  1NI2 A;  3SNH A;  5DHF B;  1WI1 A;  1Z87 A;  4TKN A;  2ZKM X;  5LON B;  2GJY A;  2YT0 A;  1RJ2 A;  1FGZ A;  5DIF B;  5D3V A;  2YF0 A;  1GC6 A;  1H4R A;  1KZG A;  2MWN B;  5J3Q A;  2RRF A;  4DBB A;  1MK9 B;  1DDV A;  2ZPY A;  2COF A;  4ZRJ A;  4DIX A;  2K2J A;  3PVW A;  4L1R A;  1U2B A;  1RRP B;  3CIK A;  4YL8 A;  1FAO A;  1DRO A;  5D3X A;  1AQC A;  1BTN A;  1FHO A; 
#chains in the Genus database with same CATH homology
 2DHI A;  1X05 A;  1J0W A;  4PNK A;  1U27 A;  4MY6 A;  1N3H A;  2ROV A;  1TQZ A;  2EC1 A;  2K2U A;  1NU2 A;  5DI9 B;  2P8V A;  1FOE A;  3LJU X;  2EJ8 A;  3U7D A;  2D9W A;  2D4Q A;  2ELB A;  2VRW B;  3RCP A;  3TVV A;  3P6A A;  5HE1 A;  3AU4 A;  3AJ4 A;  2R09 A;  3ODW A;  3PVL A;  5EFX A;  3F0W A;  3SV1 A;  1EF1 A;  2MFQ A;  2RVB B;  2DX5 A;  4WSF A;  2DHK A;  2YVC A;  4K81 A;  3U8Z A;  3KY9 A;  1OMW A;  4IOY X;  2J59 M;  5J3T A;  4WJ7 A;  3HW2 B;  3SO6 A;  4Z2M B;  1IRS A;  2NMB A;  3D8D A;  5C79 A;  3CXB B;  4HB3 B;  3N7C A;  1WJ1 A;  1XKE A;  4EMO A;  1WGU A;  5KQ1 A;  1XCG A;  5JLJ B;  3KZ1 A;  1K5G B;  3D8F A;  3M1I B;  1NTY A;  3HQC A;  2DYQ A;  2D9Y A;  2LYD A;  4PQ0 A;  1ZSQ A;  3D8E A;  2K00 A;  4L6E A;  4F7G A;  1V88 A;  2H7D A;  2P0H A;  1DBH A;  2HE7 A;  2YS5 A;  2J0M A;  1U5E A;  1V5P A;  1X1G A;  1U29 A;  4K2O A;  2LG1 A;  2I1J A;  4B6H A;  1FGY A;  3AU5 A;  4DX8 A;  3F5R A;  4KVG B;  2CRF A;  1FHX A;  1U5G A;  2Z0P A;  3A8P A;  2COC A;  2COD A;  4KHA A;  2DX1 A;  2E2X A;  2RUK B;  3DXC A;  1WG7 A;  2I5F A;  1UNR A;  2D2Q A;  4K17 A;  4A6K A;  2DHJ A;  5FI1 A;  4HAV B;  2R0D A;  1X86 A;  5J3Y A;  2VSZ A;  4C0A A;  3PVU A;  2M38 A;  1ZC4 B;  2HTH B;  1OY2 A;  2W2X D;  3P7Z A;  4ZRK A;  2YS3 A;  2D9X A;  1P5T A;  2XQN M;  3DXD A;  2P0F A;  2KGX B;  3TW1 A;  5HE3 A;  4HAW B;  2X18 A;  2DFK A;  3A98 B;  1W1G A;  3V5W A;  2AEH A;  4P7I A;  3GYP A;  4A6F B;  5JHH A;  2QKL A;  4Y94 A;  1XR0 B;  3PSC A;  2KUP A;  5DHA B;  1UNP A;  1W1H A;  4ZRI A;  2CY4 A;  2YSZ A;  1MAI A;  2OTX A;  1W1D A;  1U5D A;  3ZDT A;  4IFS A;  1LW3 A;  2PZ1 A;  2YRY A;  3QIJ A;  4H8S A;  3MDB C;  2QKM A;  2W2X C;  2I1K A;  4HB2 B;  4DXA B;  2N0Y A;  1Y19 B;  2Z0Q A;  1PMS A;  3IVF A;  1DDM A;  2IYB A;  4NY0 A;  1DDW A;  3TCA A;  2NZ8 B;  1EVH A;  1UNQ A;  2EMS A;  5JP4 A;  2ELA A;  5KCV A;  3PG7 A;  1BWN A;  2ADZ A;  1X11 A;  2UVM A;  1H10 A;  2RGN B;  4HAT B;  3ODX A;  1SGH A;  1DYN A;  1OQN A;  3FSS A;  4KAX B;  1M7R A;  1V89 A;  1LB1 A;  3ML4 A;  4GMX B;  4NSW A;  5HE2 A;  5HE0 A;  1V5U A;  2DKQ A;  2RNR B;  1V5M A;  3ZVR A;  1GG3 A;  2AL6 A;  1AWE A;  2LOZ A;  1WGQ A;  2JP2 A;  4F7U P;  4WVF B;  5D3Y A;  2DN6 A;  1MIZ B;  1NTV A;  2MKR A;  3KSY A;  2H7E A;  5C16 A;  1Q67 A;  3QWM A;  2VKI A;  3ULB A;  1Y5O A;  2L2I A;  2GS0 A;  2LUL A;  4A6F A;  4GPT B;  1MPH A;  3WYF B;  4HAX B;  2G35 A;  2I5C A;  1XD4 A;  3G9W A;  1FHW A;  3BIN A;  2N23 A;  2D9Z A;  3A8Q A;  2FJL A;  3NSU A;  1KZ7 A;  3SYX A;  3VOQ A;  4CYE A;  5JHG A;  2RSG A;  2YS1 A;  3ULC A;  4HAY B;  1MKE A;  1K5D B;  2Z0O A;  5DH9 B;  3QBV B;  4MK0 A;  4HDQ A;  5KQ4 A;  5C5B B;  3T06 A;  2GCJ A;  4HDO A;  1UPQ A;  1QQG A;  2IFS A;  4MT7 A;  1BAK A;  1ZC3 B;  4HHV A;  1P3R A;  4CHM A;  2LOX A;  3PZD A;  1I7A A;  1UPR A;  1WJM A;  2Y7B A;  4KHO A;  2V76 A;  4HAU B;  3BJI A;  4GZU A;  3SUZ A;  1PFJ A;  5CLL B;  4YON A;  2Y8G A;  4EJN A;  4GMV A;  3X23 A;  2COA A;  2MDX A;  3O96 A;  2UZS A;  3KRW A;  4EKU A;  2W2W A;  1EAZ A;  1V61 A;  3WA0 A;  2Q13 A;  2DKP A;  3UZT A;  1E5W A;  2CAY A;  3OAN A;  4D0N B;  2P0D A;  5C6R A;  3MPX A;  2L1C A;  1XOD A;  1GC7 A;  4F7H A;  4BBK A;  1X1F A;  2DA0 A;  2J0K A;  4CHJ A;  1U5F A;  1M7E A;  3FEH A;  5D3W A;  1MK7 B;  1WVH A;  1QC6 A;  4HAZ B;  1TJ6 A;  3DXE A;  2DYN A;  3VIA A;  3HK0 A;  4XWX A;  1TXD A;  1J19 A;  1SHC A;  2EMT A;  2RLO A;  3PP2 A;  2UZR A;  1XX0 A;  3KRX A;  2CY5 A;  2DTC A;  2Y8F A;  4IAP A;  4GN1 A;  1BTK A;  4A6H A;  4Z2N A;  4KHB B;  1ZVR A;  1ZM0 A;  5C5B A;  2M14 A;  2ROZ B;  4TYZ A;  1UEF A;  2D10 A;  3FM8 C;  3PEG A;  4K2P A;  5CLQ B;  5D27 A;  4GXB A;  3TO1 A;  1KI1 B;  5LOP B;  5FI0 A;  4DX9 0;  3GYO A;  1PLS A;  2GCL A;  5L81 A;  1ISN A;  4HB4 B;  1B55 A;  2D11 A;  1EGX A;  4HB0 B;  2KCJ A;  1I2H A;  3TFM A;  2DLW A;  2J0J A;  1MIX A;  1FB8 A;  2LKO A;  1P6S A;  3ODO A;  2OQB A;  5GOW B;  4A5K A;  2BCJ A;  2D9V A;  2YT1 A;  1NI2 A;  3SNH A;  5DHF B;  1WI1 A;  1Z87 A;  4TKN A;  5LON B;  2GJY A;  2YT0 A;  1RJ2 A;  1FGZ A;  5DIF B;  5D3V A;  2YF0 A;  1GC6 A;  1H4R A;  1KZG A;  2MWN B;  5J3Q A;  4DBB A;  1MK9 B;  1DDV A;  2ZPY A;  2COF A;  4ZRJ A;  2K2J A;  3PVW A;  1U2B A;  1RRP B;  3CIK A;  4YL8 A;  1FAO A;  1DRO A;  5D3X A;  1AQC A;  1BTN A;  1FHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...