2I5CA

Crystal structure of the c-terminal ph domain of pleckstrin in complex with d-myo-ins(1,2,3,4,5)p5
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
94
Chain Sequence
VIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the carboxy terminal PH domain of pleckstrin bound to D-myo-inositol 1,2,3,5,6-pentakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Pleckstrin
total genus 17
structure length 94
sequence length 104
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2i5cA00
2OTXA 3D8EA 1NU2A 3OANA 4ZRJA 2M14A 1FHWA 2EMSA 1I2HA 2DYNA 1OMWA 2PZ1A 1WGUA 1M7EA 2Z0QA 5DIFB 1EGXA 5JLJB 2YF0A 3DXDA 5D27A 5HE0A 2IFSA 3HW2B 1I7AA 1TXDA 2DLWA 2ROVA 3AU4A 5C79A 4A6KA 2D4QA 2DKQA 2P0DA 4YL8A 1ZVRA 2W2XC 5J3QA 3QIJA 4DX8A 4GZUA 4IAPA 1K5GB 5HE1A 1DBHA 1XKEA 1V61A 2BCJA 3KSYA 1XODA 2RLOA 3MPXA 4A6FB 3F5RA 2D9ZA 2GS0A 3ULCA 1X1FA 2RSGA 2UZRA 4TYZA 1M7RA 1OY2A 4HDOA 2Z0OA 4KVGB 2EMTA 1V88A 2JP2A 2KUPA 2GJYA 3VIAA 2LOXA 2LULA 4HB0B 5CLLB 1ZSQA 5JHHA 1ZM0A 3D8FA 1MKEA 4F7GA 4WSFA 4HDQA 1XD4A 1MPHA 4HAWB 2P0HA 5LOPB 3ODWA 4KHAA 2EC1A 1BAKA 4HAYB 2Y7BA 1W1DA 4DXAB 4YONA 1FHOA 3TW1A 1P5TA 2VRWB 3F0WA 4D0NB 5D3WA 3UZTA 1AQCA 4A6HA 3A8QA 3U8ZA 2NZ8B 3P7ZA 3HK0A 1LW3A 2YT1A 2YRYA 4HHVA 3MDBC 2QKLA 1TJ6A 1E5WA 1X1GA 2Z0PA 5KQ1A 3KRXA 4IFSA 3CIKA 3NSUA 2RVBB 1KZGA 3TCAA 2I5FA 2AL6A 5FI0A 3ODXA 2YS3A 2YS1A 1OQNA 3WYFB 4L6EA 5L81A 1EF1A 2ROZB 3LJUX 2G35A 3ZDTA 2QKMA 1QC6A 2DX5A 3TVVA 2N0YA 1V5UA 2D9VA 2MKRA 4A6FA 2OQBA 4TKNA 3KRWA 1UNQA 5FI1A 4WJ7A 3G9WA 3GYPA 1RJ2A 3KZ1A 3X23A 2D11A 2K00A 1BTKA 4DX90 1V5MA 2ZPYA 1ISNA 1NI2A 1U5FA 1AWEA 2MFQA 3AU5A 5C6RA 3ML4A 2VKIA 4PQ0A 1DYNA 2I1KA 2DHKA 5JP4A 2FJLA 1V89A 2LOZA 2P8VA 3A98B 1PMSA 1FB8A 2DHJA 1XCGA 4HAZB 2NMBA 4GN1A 4Z2MB 3CXBB 2X18A 2DA0A 4CHMA 4KHBB 3QBVB 4XWXA 1J19A 2UVMA 1MIZB 4EKUA 2J0MA 4NSWA 1FAOA 3DXCA 2LYDA 1LB1A 1TQZA 2YSZA 4K81A 4HAUB 5GOWB 1UPRA 2COCA 4Z2NA 1EVHA 4GMVA 4HAVB 2CRFA 4HATB 1DDWA 1X86A 2W2XD 1WI1A 5CLQB 3IVFA 5HE3A 2HTHB 4F7HA 4A5KA 3KY9A 2K2JA 2D9WA 4MK0A 2I1JA 2GCJA 4GXBA 2D10A 5D3VA 2Y8FA 1N3HA 4CYEA 1W1HA 4HAXB 2ELBA 2H7EA 3VOQA 1MIXA 1UPQA 1DROA 2DKPA 2YVCA 5DH9B 1WGQA 2UZSA 5DHAB 4EJNA 1W1GA 3PVWA 5JHGA 1PLSA 1MK7B 2HE7A 2J0JA 3FM8C 2ELAA 4P7IA 3SUZA 5C5BA 2DX1A 1KZ7A 5HE2A 2KCJA 1H4RA 2CY4A 3PZDA 1Y19B 3QWMA 1MK9B 1H10A 2LKOA 3N7CA 2I5CA 2RGNB 3M1IB 1WJ1A 3BINA 4K17A 4Y94A 1K5DB 1NTVA 2CAYA 5J3TA 4HB2B 2VSZA 2DN6A 4HB3B 1ZC4B 3GYOA 3PP2A 4KAXB 2COAA 3U7DA 2R0DA 4C0AA 4BBKA 1U5DA 1RRPB 1SHCA 2MDXA 1P6SA 1BWNA 1X05A 2D9YA 2W2WA 2GCLA 2N23A 3ULBA 2MWNB 4HB4B 2Y8GA 4MY6A 3O96A 5C5BB 3PVLA 3PG7A 2J59M 2ADZA 1DDVA 2YT0A 1EAZA 4K2OA 2V76A 3SO6A 2E2XA 3TFMA 1U5EA 5KCVA 2P0FA 2AEHA 1X11A 1NTYA 2COFA 3PSCA 1UNRA 5D3XA 2D2QA 1Q67A 1UEFA 1FGYA 1B55A 1GG3A 1Y5OA 1WJMA 2R09A 3PEGA 3ZVRA 4GPTB 3PVUA 5J3YA 4MT7A 4NY0A 3SNHA 1SGHA 3BJIA 1PFJA 2EJ8A 5C16A 2KGXB 1P3RA 4CHJA 5LONB 1Z87A 2DYQA 1XX0A 2CODA 3RCPA 1ZC3B 5KQ4A 4ZRKA 2H7DA 4H8SA 1U2BA 4PNKA 3WA0A 1GC6A 1XR0B 3V5WA 3HQCA 2DHIA 2RNRB 1UNPA 3FEHA 1U5GA 5EFXA 3D8DA 3DXEA 3A8PA 4KHOA 4EMOA 3AJ4A 5D3YA 1MAIA 4ZRIA 5DHFB 3SYXA 2YS5A 2L1CA 2M38A 3TO1A 1U29A 2IYBA 2K2UA 2J0KA 4F7UP 1DDMA 2CY5A 3P6AA 4IOYX 1IRSA 1FHXA 1J0WA 1WVHA 4WVFB 4GMXB 1QQGA 1V5PA 1KI1B 2L2IA 2RUKB 5DI9B 3SV1A 2D9XA 2DFKA 3T06A 2DTCA 1BTNA 1GC7A 4B6HA 1FOEA 4DBBA 1U27A 4K2PA 1FGZA 3FSSA 3ODOA 2LG1A 2XQNM 2Q13A 1WG7A
chains in the Genus database with same CATH superfamily
2OTXA 3D8EA 1NU2A 3OANA 4ZRJA 2M14A 1FHWA 2EMSA 1I2HA 2DYNA 1OMWA 2PZ1A 1WGUA 1M7EA 2FJUB 2Z0QA 5DIFB 1T77A 1EGXA 5JLJB 2YF0A 3DXDA 5D27A 5HE0A 3NWAA 2IFSA 3HW2B 1I7AA 1TXDA 2DLWA 2ROVA 3AU4A 5C79A 4A6KA 2D4QA 2DKQA 2P0DA 4YL8A 1ZVRA 2W2XC 5J3QA 4L1RA 3QIJA 4DX8A 4GZUA 4IAPA 1K5GB 2Z14A 2KIEA 5HE1A 1DBHA 1XKEA 1V61A 2ZKMX 2BCJA 3KSYA 1XODA 2RLOA 3MPXA 4A6FB 3F5RA 2D9ZA 2GS0A 3ULCA 1X1FA 2RSGA 2UZRA 4TYZA 2KR0A 2KUQA 1M7RA 1OY2A 4HDOA 2Z0OA 4KVGB 2EMTA 1V88A 2JP2A 2KUPA 2GJYA 3VIAA 2LOXA 2LULA 4HB0B 5CLLB 1ZSQA 5JHHA 1ZM0A 3D8FA 1MKEA 4F7GA 4WSFA 4HDQA 1XD4A 1MPHA 4HAWB 2P0HA 5LOPB 3ODWA 4KHAA 2EC1A 5M4YB 1BAKA 4HAYB 2Y7BA 1W1DA 4DXAB 4YONA 1FHOA 3TW1A 1P5TA 2VRWB 3F0WA 4D0NB 5D3WA 3UZTA 1AQCA 4A6HA 3A8QA 2KIGA 3U8ZA 2NZ8B 3P7ZA 3HK0A 1LW3A 2YT1A 2YRYA 4HHVA 3MDBC 2QKLA 1TJ6A 1E5WA 1X1GA 2Z0PA 4OSNA 5KQ1A 3KRXA 4IFSA 3CIKA 3NSUA 2RVBB 1KZGA 3TCAA 2I5FA 2AL6A 5FI0A 3OHMB 3ODXA 2YS3A 2YS1A 1OQNA 3WYFB 4L6EA 5L81A 1EF1A 2ROZB 3LJUX 2G35A 3ZDTA 2QKMA 1QC6A 2DX5A 3TVVA 2N0YA 1V5UA 2D9VA 2MKRA 4A6FA 2OQBA 4TKNA 3KRWA 1UNQA 5FI1A 4WJ7A 3G9WA 4GNKB 3GYPA 1RJ2A 3KZ1A 3X23A 2D11A 2K00A 1BTKA 4DX90 1V5MA 2ZPYA 1ISNA 1NI2A 1U5FA 1AWEA 2MFQA 2Z59A 3AU5A 5C6RA 3ML4A 2VKIA 4PQ0A 1DYNA 2I1KA 2DHKA 5JP4A 2FJLA 1V89A 2LOZA 2P8VA 3A98B 1PMSA 1FB8A 2DHJA 1XCGA 4HAZB 2NMBA 4GN1A 4Z2MB 3CXBB 2X18A 2DA0A 4CHMA 4KHBB 2GUMA 3QBVB 4XWXA 1J19A 2UVMA 1MIZB 4EKUA 2J0MA 4NSWA 3HSAA 1FAOA 3DXCA 2LYDA 1LB1A 3FVCA 1TQZA 2YSZA 4K81A 4HAUB 5GOWB 1UPRA 2COCA 4Z2NA 1EVHA 4GMVA 2CRFA 4HAVB 4HATB 1DDWA 2RRFA 1X86A 2W2XD 1WI1A 5CLQB 3IVFA 5HE3A 2HTHB 4F7HA 4A5KA 3KY9A 2K2JA 4D6WA 2D9WA 4MK0A 2I1JA 3U12A 2GCJA 4GXBA 2D10A 4KHBA 5D3VA 2Y8FA 1N3HA 3A58A 1W1HA 4CYEA 4HAXB 2ELBA 2H7EA 3VOQA 1MIXA 1UPQA 1DROA 2DKPA 2YVCA 5DH9B 1WGQA 2UZSA 5DHAB 4EJNA 1W1GA 3PVWA 5JHGA 1PLSA 1MK7B 2HE7A 2J0JA 3FM8C 2ELAA 4P7IA 3SUZA 5C5BA 2DX1A 1KZ7A 5HE2A 2KCJA 1H4RA 2CY4A 3PZDA 3NWFA 1Y19B 3QWMA 1MK9B 1H10A 2LKOA 3N7CA 2I5CA 2RGNB 3NW8A 1MI1A 3M1IB 1WJ1A 3BINA 4K17A 4Y94A 1K5DB 1NTVA 2CAYA 2K49A 5J3TA 4HB2B 2VSZA 2DN6A 4HB3B 1ZC4B 5I2SA 3GYOA 3PP2A 4KAXB 2COAA 3HIEA 3DCXA 2R0DA 3U7DA 4C0AA 4QJ4B 4BBKA 1U5DA 1RRPB 1SHCA 2MDXA 1P6SA 1BWNA 1X05A 2D9YA 2W2WA 2GCLA 2N23A 3ULBA 2MWNB 4HB4B 2Y8GA 4MY6A 3O96A 5C5BB 3PVLA 3PG7A 2J59M 2ADZA 1DDVA 2YT0A 4DIXA 1EAZA 4K2OA 2V76A 3SO6A 2E2XA 3TFMA 1U5EA 5KCVA 2P0FA 2AEHA 1X11A 2Z4DA 4QJ3B 1NTYA 2COFA 3PSCA 1UNRA 5D3XA 2NBVA 2D2QA 1Q67A 1UEFA 1FGYA 1B55A 1GG3A 1Y5OA 1WJMA 2R09A 3PEGA 4HSIA 3ZVRA 4GPTB 3PVUA 5LG4B 5J3YA 4MT7A 4NY0A 3SNHA 1SGHA 3BJIA 1PFJA 2EJ8A 5C16A 2KGXB 1P3RA 4CHJA 5LONB 1Z87A 2DYQA 1XX0A 3B77A 2CODA 3RCPA 1ZC3B 5KQ4A 4ZRKA 2H7DA 4H8SA 1U2BA 4PNKA 3WA0A 4GOUA 1GC6A 1XR0B 2K8EA 3V5WA 3HQCA 2DHIA 5IRSA 2RNRB 2YT2A 1UNPA 3FEHA 1U5GA 5EFXA 3D8DA 2Z13A 5I2MA 3DXEA 3A8PA 4KHOA 4EMOA 3AJ4A 5D3YA 1MAIA 4ZRIA 5DHFB 3SYXA 4OT1A 2YS5A 3NWDA 2L1CA 2M38A 3TO1A 2R2YA 1U29A 2IYBA 2K2UA 2J0KA 4F7UP 1DDMA 2CY5A 3P6AA 4IOYX 1IRSA 1FHXA 1J0WA 1WVHA 4WVFB 4GMXB 1QQGA 1V5PA 1KI1B 2L2IA 2RUKB 5DI9B 4QXAB 3SV1A 2D9XA 2DFKA 3T06A 2DTCA 1BTNA 1GC7A 4CSQA 4B6HA 1FOEA 4QJ5B 4DBBA 1U27A 4K2PA 1FGZA 3FSSA 3ODOA 2LG1A 1ZYIA 2XQNM 2Q13A 1WG7A
chains in the Genus database with same CATH topology
2OTXA 3D8EA 1NU2A 3OANA 4ZRJA 2M14A 1FHWA 2EMSA 1I2HA 2DYNA 1OMWA 2PZ1A 1WGUA 1M7EA 2Z0QA 5DIFB 1EGXA 5JLJB 2YF0A 3DXDA 5D27A 5HE0A 2IFSA 3HW2B 1I7AA 1TXDA 2DLWA 2ROVA 3AU4A 5C79A 4A6KA 2D4QA 2DKQA 2P0DA 4YL8A 1ZVRA 2W2XC 5J3QA 3QIJA 4DX8A 4GZUA 4IAPA 1K5GB 5HE1A 1DBHA 1XKEA 1V61A 2BCJA 3KSYA 1XODA 2RLOA 3MPXA 4A6FB 3F5RA 2D9ZA 2GS0A 3ULCA 1X1FA 2RSGA 2UZRA 4TYZA 1M7RA 1OY2A 4HDOA 2Z0OA 4KVGB 2EMTA 1V88A 2JP2A 2KUPA 2GJYA 3VIAA 2LOXA 2LULA 4HB0B 5CLLB 1ZSQA 5JHHA 1ZM0A 3D8FA 1MKEA 4F7GA 4WSFA 4HDQA 1XD4A 1MPHA 4HAWB 2P0HA 5LOPB 3ODWA 4KHAA 2EC1A 1BAKA 4HAYB 2Y7BA 1W1DA 4DXAB 4YONA 1FHOA 3TW1A 1P5TA 2VRWB 3F0WA 4D0NB 5D3WA 3UZTA 1AQCA 4A6HA 3A8QA 3U8ZA 2NZ8B 3P7ZA 3HK0A 1LW3A 2YT1A 2YRYA 4HHVA 3MDBC 2QKLA 1TJ6A 1E5WA 1X1GA 2Z0PA 5KQ1A 3KRXA 4IFSA 3CIKA 3NSUA 2RVBB 1KZGA 3TCAA 2I5FA 2AL6A 5FI0A 3ODXA 2YS3A 2YS1A 1OQNA 3WYFB 4L6EA 5L81A 1EF1A 2ROZB 3LJUX 2G35A 3ZDTA 2QKMA 1QC6A 2DX5A 3TVVA 2N0YA 1V5UA 2D9VA 2MKRA 4A6FA 2OQBA 4TKNA 3KRWA 1UNQA 5FI1A 4WJ7A 3G9WA 3GYPA 1RJ2A 3KZ1A 3X23A 2D11A 2K00A 1BTKA 4DX90 1V5MA 2ZPYA 1ISNA 1NI2A 1U5FA 1AWEA 2MFQA 3AU5A 5C6RA 3ML4A 2VKIA 4PQ0A 1DYNA 2I1KA 2DHKA 5JP4A 2FJLA 1V89A 2LOZA 2P8VA 3A98B 1PMSA 1FB8A 2DHJA 1XCGA 4HAZB 2NMBA 4GN1A 4Z2MB 3CXBB 2X18A 2DA0A 4CHMA 4KHBB 3QBVB 4XWXA 1J19A 2UVMA 1MIZB 4EKUA 2J0MA 4NSWA 1FAOA 3DXCA 2LYDA 1LB1A 1TQZA 2YSZA 4K81A 4HAUB 5GOWB 1UPRA 2COCA 4Z2NA 1EVHA 4GMVA 4HAVB 2CRFA 4HATB 1DDWA 1X86A 2W2XD 1WI1A 5CLQB 3IVFA 5HE3A 2HTHB 4F7HA 4A5KA 3KY9A 2K2JA 2D9WA 4MK0A 2I1JA 2GCJA 4GXBA 2D10A 5D3VA 2Y8FA 1N3HA 4CYEA 1W1HA 4HAXB 2ELBA 2H7EA 3VOQA 1MIXA 1UPQA 1DROA 2DKPA 2YVCA 5DH9B 1WGQA 2UZSA 5DHAB 4EJNA 1W1GA 3PVWA 5JHGA 1PLSA 1MK7B 2HE7A 2J0JA 3FM8C 2ELAA 4P7IA 3SUZA 5C5BA 2DX1A 1KZ7A 5HE2A 2KCJA 1H4RA 2CY4A 3PZDA 1Y19B 3QWMA 1MK9B 1H10A 2LKOA 3N7CA 2I5CA 2RGNB 3M1IB 1WJ1A 3BINA 4K17A 4Y94A 1K5DB 1NTVA 2CAYA 5J3TA 4HB2B 2VSZA 2DN6A 4HB3B 1ZC4B 3GYOA 3PP2A 4KAXB 2COAA 3U7DA 2R0DA 4C0AA 4BBKA 1U5DA 1RRPB 1SHCA 2MDXA 1P6SA 1BWNA 1X05A 2D9YA 2W2WA 2GCLA 2N23A 3ULBA 2MWNB 4HB4B 2Y8GA 4MY6A 3O96A 5C5BB 3PVLA 3PG7A 2J59M 2ADZA 1DDVA 2YT0A 1EAZA 4K2OA 2V76A 3SO6A 2E2XA 3TFMA 1U5EA 5KCVA 2P0FA 2AEHA 1X11A 1NTYA 2COFA 3PSCA 1UNRA 5D3XA 2D2QA 1Q67A 1UEFA 1FGYA 1B55A 1GG3A 1Y5OA 1WJMA 2R09A 3PEGA 3ZVRA 4GPTB 3PVUA 5J3YA 4MT7A 4NY0A 3SNHA 1SGHA 3BJIA 1PFJA 2EJ8A 5C16A 2KGXB 1P3RA 4CHJA 5LONB 1Z87A 2DYQA 1XX0A 2CODA 3RCPA 1ZC3B 5KQ4A 4ZRKA 2H7DA 4H8SA 1U2BA 4PNKA 3WA0A 1GC6A 1XR0B 3V5WA 3HQCA 2DHIA 2RNRB 1UNPA 3FEHA 1U5GA 5EFXA 3D8DA 3DXEA 3A8PA 4KHOA 4EMOA 3AJ4A 5D3YA 1MAIA 4ZRIA 5DHFB 3SYXA 2YS5A 2L1CA 2M38A 3TO1A 1U29A 2IYBA 2K2UA 2J0KA 4F7UP 1DDMA 2CY5A 3P6AA 4IOYX 1IRSA 1FHXA 1J0WA 1WVHA 4WVFB 4GMXB 1QQGA 1V5PA 1KI1B 2L2IA 2RUKB 5DI9B 3SV1A 2D9XA 2DFKA 3T06A 2DTCA 1BTNA 1GC7A 4B6HA 1FOEA 4DBBA 1U27A 4K2PA 1FGZA 3FSSA 3ODOA 2LG1A 2XQNM 2Q13A 1WG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTX A;  3D8E A;  1NU2 A;  3OAN A;  4ZRJ A;  2M14 A;  1FHW A;  2EMS A;  1I2H A;  2DYN A;  1OMW A;  2PZ1 A;  1WGU A;  1M7E A;  2Z0Q A;  5DIF B;  1EGX A;  5JLJ B;  2YF0 A;  3DXD A;  5D27 A;  5HE0 A;  2IFS A;  3HW2 B;  1I7A A;  1TXD A;  2DLW A;  2ROV A;  3AU4 A;  5C79 A;  4A6K A;  2D4Q A;  2DKQ A;  2P0D A;  4YL8 A;  1ZVR A;  2W2X C;  5J3Q A;  3QIJ A;  4DX8 A;  4GZU A;  4IAP A;  1K5G B;  5HE1 A;  1DBH A;  1XKE A;  1V61 A;  2BCJ A;  3KSY A;  1XOD A;  2RLO A;  3MPX A;  4A6F B;  3F5R A;  2D9Z A;  2GS0 A;  3ULC A;  1X1F A;  2RSG A;  2UZR A;  4TYZ A;  1M7R A;  1OY2 A;  4HDO A;  2Z0O A;  4KVG B;  2EMT A;  1V88 A;  2JP2 A;  2KUP A;  2GJY A;  3VIA A;  2LOX A;  2LUL A;  4HB0 B;  5CLL B;  1ZSQ A;  5JHH A;  1ZM0 A;  3D8F A;  1MKE A;  4F7G A;  4WSF A;  4HDQ A;  1XD4 A;  1MPH A;  4HAW B;  2P0H A;  5LOP B;  3ODW A;  4KHA A;  2EC1 A;  1BAK A;  4HAY B;  2Y7B A;  1W1D A;  4DXA B;  4YON A;  1FHO A;  3TW1 A;  1P5T A;  2VRW B;  3F0W A;  4D0N B;  5D3W A;  3UZT A;  1AQC A;  4A6H A;  3A8Q A;  3U8Z A;  2NZ8 B;  3P7Z A;  3HK0 A;  1LW3 A;  2YT1 A;  2YRY A;  4HHV A;  3MDB C;  2QKL A;  1TJ6 A;  1E5W A;  1X1G A;  2Z0P A;  5KQ1 A;  3KRX A;  4IFS A;  3CIK A;  3NSU A;  2RVB B;  1KZG A;  3TCA A;  2I5F A;  2AL6 A;  5FI0 A;  3ODX A;  2YS3 A;  2YS1 A;  1OQN A;  3WYF B;  4L6E A;  5L81 A;  1EF1 A;  2ROZ B;  3LJU X;  2G35 A;  3ZDT A;  2QKM A;  1QC6 A;  2DX5 A;  3TVV A;  2N0Y A;  1V5U A;  2D9V A;  2MKR A;  4A6F A;  2OQB A;  4TKN A;  3KRW A;  1UNQ A;  5FI1 A;  4WJ7 A;  3G9W A;  3GYP A;  1RJ2 A;  3KZ1 A;  3X23 A;  2D11 A;  2K00 A;  1BTK A;  4DX9 0;  1V5M A;  2ZPY A;  1ISN A;  1NI2 A;  1U5F A;  1AWE A;  2MFQ A;  3AU5 A;  5C6R A;  3ML4 A;  2VKI A;  4PQ0 A;  1DYN A;  2I1K A;  2DHK A;  5JP4 A;  2FJL A;  1V89 A;  2LOZ A;  2P8V A;  3A98 B;  1PMS A;  1FB8 A;  2DHJ A;  1XCG A;  4HAZ B;  2NMB A;  4GN1 A;  4Z2M B;  3CXB B;  2X18 A;  2DA0 A;  4CHM A;  4KHB B;  3QBV B;  4XWX A;  1J19 A;  2UVM A;  1MIZ B;  4EKU A;  2J0M A;  4NSW A;  1FAO A;  3DXC A;  2LYD A;  1LB1 A;  1TQZ A;  2YSZ A;  4K81 A;  4HAU B;  5GOW B;  1UPR A;  2COC A;  4Z2N A;  1EVH A;  4GMV A;  4HAV B;  2CRF A;  4HAT B;  1DDW A;  1X86 A;  2W2X D;  1WI1 A;  5CLQ B;  3IVF A;  5HE3 A;  2HTH B;  4F7H A;  4A5K A;  3KY9 A;  2K2J A;  2D9W A;  4MK0 A;  2I1J A;  2GCJ A;  4GXB A;  2D10 A;  5D3V A;  2Y8F A;  1N3H A;  4CYE A;  1W1H A;  4HAX B;  2ELB A;  2H7E A;  3VOQ A;  1MIX A;  1UPQ A;  1DRO A;  2DKP A;  2YVC A;  5DH9 B;  1WGQ A;  2UZS A;  5DHA B;  4EJN A;  1W1G A;  3PVW A;  5JHG A;  1PLS A;  1MK7 B;  2HE7 A;  2J0J A;  3FM8 C;  2ELA A;  4P7I A;  3SUZ A;  5C5B A;  2DX1 A;  1KZ7 A;  5HE2 A;  2KCJ A;  1H4R A;  2CY4 A;  3PZD A;  1Y19 B;  3QWM A;  1MK9 B;  1H10 A;  2LKO A;  3N7C A;  2I5C A;  2RGN B;  3M1I B;  1WJ1 A;  3BIN A;  4K17 A;  4Y94 A;  1K5D B;  1NTV A;  2CAY A;  5J3T A;  4HB2 B;  2VSZ A;  2DN6 A;  4HB3 B;  1ZC4 B;  3GYO A;  3PP2 A;  4KAX B;  2COA A;  3U7D A;  2R0D A;  4C0A A;  4BBK A;  1U5D A;  1RRP B;  1SHC A;  2MDX A;  1P6S A;  1BWN A;  1X05 A;  2D9Y A;  2W2W A;  2GCL A;  2N23 A;  3ULB A;  2MWN B;  4HB4 B;  2Y8G A;  4MY6 A;  3O96 A;  5C5B B;  3PVL A;  3PG7 A;  2J59 M;  2ADZ A;  1DDV A;  2YT0 A;  1EAZ A;  4K2O A;  2V76 A;  3SO6 A;  2E2X A;  3TFM A;  1U5E A;  5KCV A;  2P0F A;  2AEH A;  1X11 A;  1NTY A;  2COF A;  3PSC A;  1UNR A;  5D3X A;  2D2Q A;  1Q67 A;  1UEF A;  1FGY A;  1B55 A;  1GG3 A;  1Y5O A;  1WJM A;  2R09 A;  3PEG A;  3ZVR A;  4GPT B;  3PVU A;  5J3Y A;  4MT7 A;  4NY0 A;  3SNH A;  1SGH A;  3BJI A;  1PFJ A;  2EJ8 A;  5C16 A;  2KGX B;  1P3R A;  4CHJ A;  5LON B;  1Z87 A;  2DYQ A;  1XX0 A;  2COD A;  3RCP A;  1ZC3 B;  5KQ4 A;  4ZRK A;  2H7D A;  4H8S A;  1U2B A;  4PNK A;  3WA0 A;  1GC6 A;  1XR0 B;  3V5W A;  3HQC A;  2DHI A;  2RNR B;  1UNP A;  3FEH A;  1U5G A;  5EFX A;  3D8D A;  3DXE A;  3A8P A;  4KHO A;  4EMO A;  3AJ4 A;  5D3Y A;  1MAI A;  4ZRI A;  5DHF B;  3SYX A;  2YS5 A;  2L1C A;  2M38 A;  3TO1 A;  1U29 A;  2IYB A;  2K2U A;  2J0K A;  4F7U P;  1DDM A;  2CY5 A;  3P6A A;  4IOY X;  1IRS A;  1FHX A;  1J0W A;  1WVH A;  4WVF B;  4GMX B;  1QQG A;  1V5P A;  1KI1 B;  2L2I A;  2RUK B;  5DI9 B;  3SV1 A;  2D9X A;  2DFK A;  3T06 A;  2DTC A;  1BTN A;  1GC7 A;  4B6H A;  1FOE A;  4DBB A;  1U27 A;  4K2P A;  1FGZ A;  3FSS A;  3ODO A;  2LG1 A;  2XQN M;  2Q13 A;  1WG7 A; 
#chains in the Genus database with same CATH topology
 2OTX A;  3D8E A;  1NU2 A;  3OAN A;  4ZRJ A;  2M14 A;  1FHW A;  2EMS A;  1I2H A;  2DYN A;  1OMW A;  2PZ1 A;  1WGU A;  1M7E A;  2FJU B;  2Z0Q A;  5DIF B;  1T77 A;  1EGX A;  5JLJ B;  2YF0 A;  3DXD A;  5D27 A;  5HE0 A;  3NWA A;  2IFS A;  3HW2 B;  1I7A A;  1TXD A;  2DLW A;  2ROV A;  3AU4 A;  5C79 A;  4A6K A;  2D4Q A;  2DKQ A;  2P0D A;  4YL8 A;  1ZVR A;  2W2X C;  5J3Q A;  4L1R A;  3QIJ A;  4DX8 A;  4GZU A;  4IAP A;  1K5G B;  2Z14 A;  2KIE A;  5HE1 A;  1DBH A;  1XKE A;  1V61 A;  2ZKM X;  2BCJ A;  3KSY A;  1XOD A;  2RLO A;  3MPX A;  4A6F B;  3F5R A;  2D9Z A;  2GS0 A;  3ULC A;  1X1F A;  2RSG A;  2UZR A;  4TYZ A;  2KR0 A;  2KUQ A;  1M7R A;  1OY2 A;  4HDO A;  2Z0O A;  4KVG B;  2EMT A;  1V88 A;  2JP2 A;  2KUP A;  2GJY A;  3VIA A;  2LOX A;  2LUL A;  4HB0 B;  5CLL B;  1ZSQ A;  5JHH A;  1ZM0 A;  3D8F A;  1MKE A;  4F7G A;  4WSF A;  4HDQ A;  1XD4 A;  1MPH A;  4HAW B;  2P0H A;  5LOP B;  3ODW A;  4KHA A;  2EC1 A;  5M4Y B;  1BAK A;  4HAY B;  2Y7B A;  1W1D A;  4DXA B;  4YON A;  1FHO A;  3TW1 A;  1P5T A;  2VRW B;  3F0W A;  4D0N B;  5D3W A;  3UZT A;  1AQC A;  4A6H A;  3A8Q A;  2KIG A;  3U8Z A;  2NZ8 B;  3P7Z A;  3HK0 A;  1LW3 A;  2YT1 A;  2YRY A;  4HHV A;  3MDB C;  2QKL A;  1TJ6 A;  1E5W A;  1X1G A;  2Z0P A;  4OSN A;  5KQ1 A;  3KRX A;  4IFS A;  3CIK A;  3NSU A;  2RVB B;  1KZG A;  3TCA A;  2I5F A;  2AL6 A;  5FI0 A;  3OHM B;  3ODX A;  2YS3 A;  2YS1 A;  1OQN A;  3WYF B;  4L6E A;  5L81 A;  1EF1 A;  2ROZ B;  3LJU X;  2G35 A;  3ZDT A;  2QKM A;  1QC6 A;  2DX5 A;  3TVV A;  2N0Y A;  1V5U A;  2D9V A;  2MKR A;  4A6F A;  2OQB A;  4TKN A;  3KRW A;  1UNQ A;  5FI1 A;  4WJ7 A;  3G9W A;  4GNK B;  3GYP A;  1RJ2 A;  3KZ1 A;  3X23 A;  2D11 A;  2K00 A;  1BTK A;  4DX9 0;  1V5M A;  2ZPY A;  1ISN A;  1NI2 A;  1U5F A;  1AWE A;  2MFQ A;  2Z59 A;  3AU5 A;  5C6R A;  3ML4 A;  2VKI A;  4PQ0 A;  1DYN A;  2I1K A;  2DHK A;  5JP4 A;  2FJL A;  1V89 A;  2LOZ A;  2P8V A;  3A98 B;  1PMS A;  1FB8 A;  2DHJ A;  1XCG A;  4HAZ B;  2NMB A;  4GN1 A;  4Z2M B;  3CXB B;  2X18 A;  2DA0 A;  4CHM A;  4KHB B;  2GUM A;  3QBV B;  4XWX A;  1J19 A;  2UVM A;  1MIZ B;  4EKU A;  2J0M A;  4NSW A;  3HSA A;  1FAO A;  3DXC A;  2LYD A;  1LB1 A;  3FVC A;  1TQZ A;  2YSZ A;  4K81 A;  4HAU B;  5GOW B;  1UPR A;  2COC A;  4Z2N A;  1EVH A;  4GMV A;  2CRF A;  4HAV B;  4HAT B;  1DDW A;  2RRF A;  1X86 A;  2W2X D;  1WI1 A;  5CLQ B;  3IVF A;  5HE3 A;  2HTH B;  4F7H A;  4A5K A;  3KY9 A;  2K2J A;  4D6W A;  2D9W A;  4MK0 A;  2I1J A;  3U12 A;  2GCJ A;  4GXB A;  2D10 A;  4KHB A;  5D3V A;  2Y8F A;  1N3H A;  3A58 A;  1W1H A;  4CYE A;  4HAX B;  2ELB A;  2H7E A;  3VOQ A;  1MIX A;  1UPQ A;  1DRO A;  2DKP A;  2YVC A;  5DH9 B;  1WGQ A;  2UZS A;  5DHA B;  4EJN A;  1W1G A;  3PVW A;  5JHG A;  1PLS A;  1MK7 B;  2HE7 A;  2J0J A;  3FM8 C;  2ELA A;  4P7I A;  3SUZ A;  5C5B A;  2DX1 A;  1KZ7 A;  5HE2 A;  2KCJ A;  1H4R A;  2CY4 A;  3PZD A;  3NWF A;  1Y19 B;  3QWM A;  1MK9 B;  1H10 A;  2LKO A;  3N7C A;  2I5C A;  2RGN B;  3NW8 A;  1MI1 A;  3M1I B;  1WJ1 A;  3BIN A;  4K17 A;  4Y94 A;  1K5D B;  1NTV A;  2CAY A;  2K49 A;  5J3T A;  4HB2 B;  2VSZ A;  2DN6 A;  4HB3 B;  1ZC4 B;  5I2S A;  3GYO A;  3PP2 A;  4KAX B;  2COA A;  3HIE A;  3DCX A;  2R0D A;  3U7D A;  4C0A A;  4QJ4 B;  4BBK A;  1U5D A;  1RRP B;  1SHC A;  2MDX A;  1P6S A;  1BWN A;  1X05 A;  2D9Y A;  2W2W A;  2GCL A;  2N23 A;  3ULB A;  2MWN B;  4HB4 B;  2Y8G A;  4MY6 A;  3O96 A;  5C5B B;  3PVL A;  3PG7 A;  2J59 M;  2ADZ A;  1DDV A;  2YT0 A;  4DIX A;  1EAZ A;  4K2O A;  2V76 A;  3SO6 A;  2E2X A;  3TFM A;  1U5E A;  5KCV A;  2P0F A;  2AEH A;  1X11 A;  2Z4D A;  4QJ3 B;  1NTY A;  2COF A;  3PSC A;  1UNR A;  5D3X A;  2NBV A;  2D2Q A;  1Q67 A;  1UEF A;  1FGY A;  1B55 A;  1GG3 A;  1Y5O A;  1WJM A;  2R09 A;  3PEG A;  4HSI A;  3ZVR A;  4GPT B;  3PVU A;  5LG4 B;  5J3Y A;  4MT7 A;  4NY0 A;  3SNH A;  1SGH A;  3BJI A;  1PFJ A;  2EJ8 A;  5C16 A;  2KGX B;  1P3R A;  4CHJ A;  5LON B;  1Z87 A;  2DYQ A;  1XX0 A;  3B77 A;  2COD A;  3RCP A;  1ZC3 B;  5KQ4 A;  4ZRK A;  2H7D A;  4H8S A;  1U2B A;  4PNK A;  3WA0 A;  4GOU A;  1GC6 A;  1XR0 B;  2K8E A;  3V5W A;  3HQC A;  2DHI A;  5IRS A;  2RNR B;  2YT2 A;  1UNP A;  3FEH A;  1U5G A;  5EFX A;  3D8D A;  2Z13 A;  5I2M A;  3DXE A;  3A8P A;  4KHO A;  4EMO A;  3AJ4 A;  5D3Y A;  1MAI A;  4ZRI A;  5DHF B;  3SYX A;  4OT1 A;  2YS5 A;  3NWD A;  2L1C A;  2M38 A;  3TO1 A;  2R2Y A;  1U29 A;  2IYB A;  2K2U A;  2J0K A;  4F7U P;  1DDM A;  2CY5 A;  3P6A A;  4IOY X;  1IRS A;  1FHX A;  1J0W A;  1WVH A;  4WVF B;  4GMX B;  1QQG A;  1V5P A;  1KI1 B;  2L2I A;  2RUK B;  5DI9 B;  4QXA B;  3SV1 A;  2D9X A;  2DFK A;  3T06 A;  2DTC A;  1BTN A;  1GC7 A;  4CSQ A;  4B6H A;  1FOE A;  4QJ5 B;  4DBB A;  1U27 A;  4K2P A;  1FGZ A;  3FSS A;  3ODO A;  2LG1 A;  1ZYI A;  2XQN M;  2Q13 A;  1WG7 A; 
#chains in the Genus database with same CATH homology
 2OTX A;  3D8E A;  1NU2 A;  3OAN A;  4ZRJ A;  2M14 A;  1FHW A;  2EMS A;  1I2H A;  2DYN A;  1OMW A;  2PZ1 A;  1WGU A;  1M7E A;  2Z0Q A;  5DIF B;  1EGX A;  5JLJ B;  2YF0 A;  3DXD A;  5D27 A;  5HE0 A;  2IFS A;  3HW2 B;  1I7A A;  1TXD A;  2DLW A;  2ROV A;  3AU4 A;  5C79 A;  4A6K A;  2D4Q A;  2DKQ A;  2P0D A;  4YL8 A;  1ZVR A;  2W2X C;  5J3Q A;  3QIJ A;  4DX8 A;  4GZU A;  4IAP A;  1K5G B;  5HE1 A;  1DBH A;  1XKE A;  1V61 A;  2BCJ A;  3KSY A;  1XOD A;  2RLO A;  3MPX A;  4A6F B;  3F5R A;  2D9Z A;  2GS0 A;  3ULC A;  1X1F A;  2RSG A;  2UZR A;  4TYZ A;  1M7R A;  1OY2 A;  4HDO A;  2Z0O A;  4KVG B;  2EMT A;  1V88 A;  2JP2 A;  2KUP A;  2GJY A;  3VIA A;  2LOX A;  2LUL A;  4HB0 B;  5CLL B;  1ZSQ A;  5JHH A;  1ZM0 A;  3D8F A;  1MKE A;  4F7G A;  4WSF A;  4HDQ A;  1XD4 A;  1MPH A;  4HAW B;  2P0H A;  5LOP B;  3ODW A;  4KHA A;  2EC1 A;  1BAK A;  4HAY B;  2Y7B A;  1W1D A;  4DXA B;  4YON A;  1FHO A;  3TW1 A;  1P5T A;  2VRW B;  3F0W A;  4D0N B;  5D3W A;  3UZT A;  1AQC A;  4A6H A;  3A8Q A;  3U8Z A;  2NZ8 B;  3P7Z A;  3HK0 A;  1LW3 A;  2YT1 A;  2YRY A;  4HHV A;  3MDB C;  2QKL A;  1TJ6 A;  1E5W A;  1X1G A;  2Z0P A;  5KQ1 A;  3KRX A;  4IFS A;  3CIK A;  3NSU A;  2RVB B;  1KZG A;  3TCA A;  2I5F A;  2AL6 A;  5FI0 A;  3ODX A;  2YS3 A;  2YS1 A;  1OQN A;  3WYF B;  4L6E A;  5L81 A;  1EF1 A;  2ROZ B;  3LJU X;  2G35 A;  3ZDT A;  2QKM A;  1QC6 A;  2DX5 A;  3TVV A;  2N0Y A;  1V5U A;  2D9V A;  2MKR A;  4A6F A;  2OQB A;  4TKN A;  3KRW A;  1UNQ A;  5FI1 A;  4WJ7 A;  3G9W A;  3GYP A;  1RJ2 A;  3KZ1 A;  3X23 A;  2D11 A;  2K00 A;  1BTK A;  4DX9 0;  1V5M A;  2ZPY A;  1ISN A;  1NI2 A;  1U5F A;  1AWE A;  2MFQ A;  3AU5 A;  5C6R A;  3ML4 A;  2VKI A;  4PQ0 A;  1DYN A;  2I1K A;  2DHK A;  5JP4 A;  2FJL A;  1V89 A;  2LOZ A;  2P8V A;  3A98 B;  1PMS A;  1FB8 A;  2DHJ A;  1XCG A;  4HAZ B;  2NMB A;  4GN1 A;  4Z2M B;  3CXB B;  2X18 A;  2DA0 A;  4CHM A;  4KHB B;  3QBV B;  4XWX A;  1J19 A;  2UVM A;  1MIZ B;  4EKU A;  2J0M A;  4NSW A;  1FAO A;  3DXC A;  2LYD A;  1LB1 A;  1TQZ A;  2YSZ A;  4K81 A;  4HAU B;  5GOW B;  1UPR A;  2COC A;  4Z2N A;  1EVH A;  4GMV A;  4HAV B;  2CRF A;  4HAT B;  1DDW A;  1X86 A;  2W2X D;  1WI1 A;  5CLQ B;  3IVF A;  5HE3 A;  2HTH B;  4F7H A;  4A5K A;  3KY9 A;  2K2J A;  2D9W A;  4MK0 A;  2I1J A;  2GCJ A;  4GXB A;  2D10 A;  5D3V A;  2Y8F A;  1N3H A;  4CYE A;  1W1H A;  4HAX B;  2ELB A;  2H7E A;  3VOQ A;  1MIX A;  1UPQ A;  1DRO A;  2DKP A;  2YVC A;  5DH9 B;  1WGQ A;  2UZS A;  5DHA B;  4EJN A;  1W1G A;  3PVW A;  5JHG A;  1PLS A;  1MK7 B;  2HE7 A;  2J0J A;  3FM8 C;  2ELA A;  4P7I A;  3SUZ A;  5C5B A;  2DX1 A;  1KZ7 A;  5HE2 A;  2KCJ A;  1H4R A;  2CY4 A;  3PZD A;  1Y19 B;  3QWM A;  1MK9 B;  1H10 A;  2LKO A;  3N7C A;  2I5C A;  2RGN B;  3M1I B;  1WJ1 A;  3BIN A;  4K17 A;  4Y94 A;  1K5D B;  1NTV A;  2CAY A;  5J3T A;  4HB2 B;  2VSZ A;  2DN6 A;  4HB3 B;  1ZC4 B;  3GYO A;  3PP2 A;  4KAX B;  2COA A;  3U7D A;  2R0D A;  4C0A A;  4BBK A;  1U5D A;  1RRP B;  1SHC A;  2MDX A;  1P6S A;  1BWN A;  1X05 A;  2D9Y A;  2W2W A;  2GCL A;  2N23 A;  3ULB A;  2MWN B;  4HB4 B;  2Y8G A;  4MY6 A;  3O96 A;  5C5B B;  3PVL A;  3PG7 A;  2J59 M;  2ADZ A;  1DDV A;  2YT0 A;  1EAZ A;  4K2O A;  2V76 A;  3SO6 A;  2E2X A;  3TFM A;  1U5E A;  5KCV A;  2P0F A;  2AEH A;  1X11 A;  1NTY A;  2COF A;  3PSC A;  1UNR A;  5D3X A;  2D2Q A;  1Q67 A;  1UEF A;  1FGY A;  1B55 A;  1GG3 A;  1Y5O A;  1WJM A;  2R09 A;  3PEG A;  3ZVR A;  4GPT B;  3PVU A;  5J3Y A;  4MT7 A;  4NY0 A;  3SNH A;  1SGH A;  3BJI A;  1PFJ A;  2EJ8 A;  5C16 A;  2KGX B;  1P3R A;  4CHJ A;  5LON B;  1Z87 A;  2DYQ A;  1XX0 A;  2COD A;  3RCP A;  1ZC3 B;  5KQ4 A;  4ZRK A;  2H7D A;  4H8S A;  1U2B A;  4PNK A;  3WA0 A;  1GC6 A;  1XR0 B;  3V5W A;  3HQC A;  2DHI A;  2RNR B;  1UNP A;  3FEH A;  1U5G A;  5EFX A;  3D8D A;  3DXE A;  3A8P A;  4KHO A;  4EMO A;  3AJ4 A;  5D3Y A;  1MAI A;  4ZRI A;  5DHF B;  3SYX A;  2YS5 A;  2L1C A;  2M38 A;  3TO1 A;  1U29 A;  2IYB A;  2K2U A;  2J0K A;  4F7U P;  1DDM A;  2CY5 A;  3P6A A;  4IOY X;  1IRS A;  1FHX A;  1J0W A;  1WVH A;  4WVF B;  4GMX B;  1QQG A;  1V5P A;  1KI1 B;  2L2I A;  2RUK B;  5DI9 B;  3SV1 A;  2D9X A;  2DFK A;  3T06 A;  2DTC A;  1BTN A;  1GC7 A;  4B6H A;  1FOE A;  4DBB A;  1U27 A;  4K2P A;  1FGZ A;  3FSS A;  3ODO A;  2LG1 A;  2XQN M;  2Q13 A;  1WG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...