2I5LX

Crystal structure of bacillus subtilis cold shock protein variant bs-cspb m1r/e3k/k65i
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
RLKGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimized variants of the cold shock protein from in vitro selection: structural basis of their high thermostability.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
molecule keywords Cold shock protein cspB
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5lX00
4GLAC 1VQIA 2DGYA 4OWWB 4DV1L 2UUBL 4DR7L 1XMQQ 2Q2UA 1J6QA 3RZOH 1Y1VH 4IO9A 1PVOA 2E5LQ 4JOIA 1UE7A 2RHSB 1PYSB 2VL6A 4OXPA 5M3FG 1KIXA 4O2DA 2XGTA 3MXNB 3A74A 4POFA 1C7YA 4OONA 2VUMG 2R7ZG 3DLLA 1E22A 1PH3A 3HOWH 4B3MQ 4PMWA 1I94Q 1HR0Q 4A3BG 2H5XA 1G6PA 1Q81C 4UP7A 4JI1Q 2PNHA 3RLNA 4A4IA 4A3GG 1I3QH 5M5WH 2Y0SE 4A3EG 1PHJA 1OXSC 1YEZA 3D31A 1VQNA 1KAWA 2HIVA 4H02A 4Y52H 4HJ8A 1LUZA 1L1OC 1UWVA 2CQOA 2K50A 2D0PA 3I4MG 1K3RA 4J15A 4RG1A 4X65L 1QVFA 2ID0A 2ALYB 4DV6L 3VDYA 4LW1A 2ZM6L 4A3FG 4LNQA 5C4JH 2RCNA 1IBLQ 3W1GA 3T1YL 1VS0A 1QVGA 4JI6L 1CKNA 1E7ZA 1CKOA 3L0OA 2MNAA 1XMOL 2PQAA 3J7ZC 2WB1G 2UXCQ 1UE1A 4L5SA 3JAMi 4X66Q 1VQLA 4DUZL 3CPFA 2VQFQ 3PCOB 4YCUA 5M3MG 1IBKL 1VCIA 2JJQA 3UDFA 4ALPA 3NELA 1V43A 2KHJA 3EN2A 3CMAA 1W3SA 5IYDG 1N34Q 2E5LL 2ZTDA 3I7FA 2K5HA 3UDXA 3F8TA 4JI5L 1W2BA 2HT1A 1CKNB 3HOUH 1IBMQ 5C0XI 3HOXG 3HKSA 2IX1A 3PO2G 3PSIA 2KHIA 3STBC 4DR4L 2LSSA 1VQFA 2ZJQA 1HNWQ 1NJIC 1SRUA 1I94L 2EIFA 4JBWA 3U4ZA 1G51A 1WI5A 2NVYH 4L5QA 2N8NA 2LXKA 1SROA 4IJLA 2A1AA 3HOYH 3W1BA 3PF4A 1Q1EA 1OTCA 2JA8G 3S14H 2R93H 4UY8C 1PH9A 3BZCA 2B63G 1PV4A 4A76A 4BA2I 3CQZH 2JEBI 3FKIH 4JBJA 1OXUA 2HQLA 4IPHA 3CCQA 1QZGA 2R7FA 1VQ4A 4IFDJ 3CMEA 4R4IA 3HOZH 1S3OA 1CUKA 2ZM6Q 4EX5A 4LFCQ 4MNOA 1GD7A 1HR0L 2D62A 2UXCL 5FLMG 1L1OA 3CCSA 3TEHB 2I5HA 4BBSH 4K0KL 2EXDA 1PFSA 4LFAQ 4GNXB 2E2JH 3J81i 5AJ3Q 4A75A 3I4NH 1WJJA 4JI4L 4X6AH 2K5VA 3CP0A 3AFQA 5GAHC 2JA6H 4BY7H 1EIYB 1A8VA 3A5ZB 4DNIA 3CCLA 3K7AH 1A62A 4PZ7A 5JEAJ 3KF6A 3S16H 1N9WA 4LUZA 5M5YH 3CW2C 2JA7H 2IT1A 4YWLA 3RLOA 5C3EH 1TXYA 4LF5L 1KL9A 1MKHA 1XMOQ 2B3GA 3F1ZA 1YZ6A 3AEVA 4A3MG 5EAYA 4DR6L 2WAQE 4DV4Q 2UUCL 4JI2L 1Q12A 3M7NA 3AFPA 3OTOQ 1YBYA 2FXQA 1X3EA 3K80C 4A3IG 3ZJYC 4R4QA 1X54A 1HNXQ 4LF8Q 3GTGH 4GKKQ 4JI5Q 1NE3A 3H0GG 4TQUS 1QUQB 3GTPH 3G48A 5K36G 3ER0A 3J81j 1L2FA 5J3BA 3AYHB 3CXCA 4JYAL 4IOCA 1N8RC 4A3KG 1X65A 1PA6A 4A3CG 3CCRA 1FVIA 2Z6KA 2HIXA 3S1RH 2KCMA 4LF7L 3I4OA 3CCVA 1HJPA 4AYBG 1V9PA 3I2ZA 5C4XG 1KXLA 3DM3A 3E9HA 4HIKA 1QVCA 1WCMH 1N36Q 2OTJA 2JE6I 4YY3Q 2NN6G 1VQ9A 2I0QA 4A3JG 4DR5Q 1YHQA 1D7QA 3SGIA 4YWMA 3UE1A 1Y14B 1NBWA 2ZTEA 3L7ZC 5GROA 1KD1C 3TRZA 2JA5G 4LF9Q 4LFBL 1JJGA 2YV5A 3CCEA 1I50H 1WFQA 4ME3A 4A93H 4L5TA 2PI2E 1KC8C 1Y1VG 3GTMH 3PIOA 1XNQQ 3S2DH 1IXRA 2PI2A 5GQOA 1VQHA 5M3FH 3EBEA 4LUVA 5E7NA 4BA1I 2OQKA 4BY1H 4GNXA 3ICEA 5ELOA 5IP9H 1HZAA 3PIPA 4GNXC 4IOAA 2N78A 2R7ZH 2VUMH 1ASZA 4JI8Q 4P75A 2MQHA 1DGSA 5IYBG 1XNRL 1NMFA 3MEFA 4JI7L 2JA9A 3JAMc 4GS3A 2Z0SA 2NVTH 2R92G 1M90C 1LM0A 1X55A 5IYCG 3GTOH 1K8GA 4KHPL 2CWPA 1N32Q 5IY0A 1TWFH 3HOVH 1Z47A 2UXDL 4C3HH 1V1QA 3AQQA 2ES2A 1Q1BA 4FDBA 4QGUA 4R4TA 5BR8Q 4DR6Q 3RN2A 1XPRA 4OX9L 1P8LA 5LMNL 1M1KC 4JI3Q 4BBRG 4C2MH 1UEBA 3A5UA 4IPCA 3T1HQ 4XTCS 3GDEA 1EUJA 2V1CC 5GADC 1N33Q 2MFIA 2BA0A 3FHWA 4JOIC 4AIMA 1E3PA 1RIPA 1YHAA 3NEMA 1J5EL 1VQMA 2MO1A 4NB3A 1VQ5A 4JYAQ 4B3ML 4B3RL 2Q2TA 5C44G 1IBLL 2CKZB 1GM5A 4JI0L 1UE5A 2PQAB 1EOVA 5IYDH 3H3VI 4YCWA 4X66L 2VQFL 3K81C 3HOUG 1C9OA 1WOCA 1CKMA 3CC2A 1FL0A 3S24A 2IY5B 2KBNA 5LMUL 2K4KA 1YJNA 4UPAA 4JI8L 4DR5L 5IE8A 2JEAI 4DV6Q 1PH1A 2UUAL 4A3DG 4BXXG 3PUXA 3K8AA 2VZAA 3RZDH 3PUVA 1E1OA 4YCVA 4B3TL 2R93G 2AWNA 3J80i 5FJ8H 2KCTA 4R4CA 4DR1L 2VY3A 2E8GA 1YHBA 2BH2A 2OCEA 4A3LH 1KRSA 4DV0L 2F52A 2UXDQ 1HZCA 3RLFA 3FKIG 2JQOA 4AH6A 4QJFA 1IZ6A 1IBKQ 4DR3Q 2K5NA 4DR2Q 3I55A 1VQBA 4JI3L 1IYJB 1EYGA 1EQQA 3HFZB 3U58A 4IFDI 2PMZE 2A8VA 3KJOA 4LUOA 1X9NA 1PH6A 1AH9A 4X64Q 5GAGC 4BBSG 1U5KA 4UP9A 2NVQH 4NXML 4GN5A 3M4PA 3UE0A 4R4OA 5C0XG 1GVPA 3G4SA 1VQ8A 2YU9H 3I4NG 1HZBA 4NXNQ 1K73C 1HNWL 4JCVE 2VNUD 1LTLA 2HHHQ 1Y1WH 3KLWA 2Z6KC 1VQJA 4KHZA 5BR8L 4LF6Q 1FGUA 1TWGH 2RHQB 4OWXB 4OX9Q 3HKZG 2VQEQ 4GOPA 4LFAL 3S1MH 1I6HH 1OXVA 1EIFA 3BU2A 4GLVB 1MIUA 2Q2HA 1LYLA 1EQRA 5JEAG 1PH2A 3PO3G 3EIVA 4OO1G 4DAMA 2NN6I 2Y0SG 3Q8DA 2QEXA 1H95A 5IP7G 1B70B 1I5FA 3M85A 2UU9Q 1K8AC 2IHEA 2E2HH 2UXBQ 3RR5A 2IHFA 5IWAQ 2OTLA 2I5LX 1KQSA 4MZ9A 4B3RQ 1C0AA 2AKWB 1E24A 1KHIA 1R9TH 3ULPA 4JI0Q 1CSPA 3TQYA 2WFWA 4KI0A 2GVBA 5IT9c 2AWOA 4GOPB 4EQ5A 1MJEA 1JMCA 2NVXH 3CCMA 1JJCB 1TWAH 3PGZA 4WJ4A 1YITA 4LF4Q 4L5RC 3GTLH 3KFUA 3NBHB 4QIWE 4DPGA 4JI2Q 1XMQL 1SE8A 2NZOA 3HOWG 2WB1E 3TS2A 1A63A 5JJKA 1B8AA 4P71A 4A3BH 3KDFB 3UDGA 3BJUA 4A3EH 4HIMA 4B3TQ 5C4XH 4P73A 5FLXc 2K14A 4XIGS 3UDIA 2E2IH 4NXMQ 4LF5Q 4BY7G 3M4OH 4NXNL 4DV0Q 1VQPA 1VQGA 3RN5A 4HJ9A 3S15H 2YYZA 2OWOA 2F4VQ 4P72A 1XTDA 4A3JH 4C3IH 1YJWA 2K52A 1X3GA 2GN5A 5H1SE 1MJCA 3CCJA 2UUCQ 2JA7G 4IPGA 3ERSX 1Q82C 1L1OB 3K7UC 4A3FH 4IJHA 2JK8A 2R7DA 1JB7A 3M3YH 4O0AA 4A93G 1AE2A 3GTQH 2R6GA 1A0IA 4GKKL 4A3MH 3J80c 1P16A 1JE5A 3RNUA 2WP8J 3M9BA 1CSQA 3U4VA 1XJVA 4B3SQ 5IP9G 3S1NH 3HKZE 3KF6B 3KF8B 1O7IA 3T1YQ 1HZ9A 1G291 4AQYL 1Q86C 2F3IA 1XNQL 2N49A 1PH5A 4LF6L 1VQOA 2XTIA 4DKAC 4P74A 1NY4A 1VQ7A 3PF5A 1OXTA 4LF4L 1WYDA 5IYCH 2ZTCA 3A0JA 3STBD 1N36L 4A3CH 4QY7A 4PZ6A 1SFOH 3H3VH 4A3GH 2K75A 1EFWA 3S2HH 2UU9L 3E0EA 5IWAL 4DV7Q 3F2BA 4DV3Q 1BBWA 1FJGQ 1WCMG 4KHPQ 2B63H 2Q2IA 3PUYA 4JI6Q 2I5MX 3KOJA 1YJ9A 3I4MH 4KLKA 3BZKA 2CWAA 4JBKA 1T9HA 2F4VL 1D8LA 3L2PA 1X56A 1XPOA 1SLJA 2JA5H 3CD6A 1NMGA 1GKHA 3HOZG 4HIDA 4RMFA 2B29A 4QL5A 4DV5L 2YTXA 1K9MC 5C44H 1Z9FA 2AMCB 3KDFA 4JI7Q 4DV2L 5FLMH 4BY1G 4JV5Q 4GKJL 2OQ0A 5DLQE 5M3MH 2QA4A 4OWTB 2YTYA 3GTKH 3CAMA 4C3JH 4GOPC 4TVAB 4DR4Q 3S1QH 3ULJA 4HIOA 3WWVA 4UP8A 5C0XJ 4HJ7A 4AQYQ 2JA6G 3KJPA 4Y7NH 2QGQA 4A3DH 2N3SA 1Q46A 3HOXH 3PO2H 1NTGA 3D0FA 3B6YA 5LMNQ 5AJ3L 4BXXH 1JT8A 1K0RA 5C3EG 2C35B 3HOVG 2VS1A 1TWCH 1QUQA 3PV0A 2DUDA 3W5OA 3T1HL 3S17H 1ASYA 3E9IA 1N33L 4A3LG 3GO5A 1B7YB 3HOYG 4GN3B 2UUAQ 4DAYB 1PH7A 1KRTA 5LMNW 2KENA 4DUYQ 2JA8H 1J5EQ 4DV7L 3CC7A 1BVSA 1HH2P 4BBRH 4X62L 4LFCL 1VQKA 3CC4A 4B3SL 4DK3C 1HNZL 2LXJA 1VQEA 4NPSA 2EQSA 1Q7YC 4K0KQ 1RL2A 1U0LA 1S72A 1YI2A 3H0GH 4JI4Q 4DV4L 5M5XH 5GAEC 2UUBQ 2MO0A 1OXXK 5LMUQ 4DR3L 3G71A 2NZHA 1IL2A 4DR7Q 3G6EA 4DV5Q 3NENA 3ULLA 4A3KH 3U50C 5HGQA 4OO1I 3TREA 1HNXL 2VW9A 4DV2Q 4LF8L 4GKJQ 2YTVA 4JV5L 1EWIA 4X64L 3KYHC 3GTJH 4DV3L 3F2DA 1FJGL 3M4QA 4DR1Q 2WAQG 2ZJPA 1PH4A 4HJAA 1PH8A 4YHHL 3PO3H 1X3FA 4GLXA 1UE6A 4JBMA 4HJ5A 1TWHH 1K83H 1X6OA 2L15A 5IP7H 4DV1Q 3LGJA 5FJ8G 2VQEL 4R1JA 3OTOL 4DR2L 1Q8KA 3JC66 3PUZA 4QQBX 3OW2A 2RF4A 1SMXA 3CPWA 4YY3L 4JC0A 4IFDG 1E1TA 4X65Q 1SN8A 1S40A 1BBUA 2IX0A 2ASBA 1VQCA 4DUYL 1VQAA 4AYBE 2ATWA 4LF9L 4X62Q 4LFBQ 4IPDA 2AHOB 4A3IH 3J7A5 4JI1L 2HHHL 4LF7Q 1YNXA 4LWCA 4PG3A 5IYBH 3GD7A 1PYBA 2BA1A 4GN4B 3F2CA 4DUZQ 3H15A 2GVAA 3I56A 2ZJRA 2R92H 2A19A 4JG2A 5JJIA 1XPUA 4APVA 3K0XA 3CF5A 3CCUA 3J81c 4POGA 1QZHA 1SR3A 1Y1WG 4YWKA 1N34L 1AE3A 1VQDA 4MTNA 1XNRQ 1JJ2A 5JJLA 2BH8A 3TS0A 4PZ8A 2D0OA 4DK6C 3IRBA 1YIJA 5ELNA 4WJ3M 1YVCA 2CFMA 1IBML 1L0WA 1GO3E 3FP9A 2CCZA 1BKBA 1N32L 1HNZQ 3PUWA 2UXBL 5HY6A 4YHHQ 1HR0W 1VQ6A 3OYYA
chains in the Genus database with same CATH superfamily
2EOTA 3GQBA 1VQIA 2Z6BA 1TQOA 4K8JA 2Q2UA 3R8BA 3ITPA 1KABA 4MIUA 4IO9A 4A3EB 1STNA 4JOIA 1UE7A 2RHSB 3H09A 2VL6A 5M3FG 3OMCA 1QJOA 4M8AA 5KYIA 4OONA 1E22A 1PH3A 1EY9A 1G6PA 2HDLA 2H5XA 4JI1Q 3RLNA 4A4IA 5M5WB 1WD0A 4DK0A 4GZYC 1VQNA 3OSOA 5G3LD 1EZ6A 2WB1B 2CQOA 2D0PA 1QVFA 3A7LA 1LTAD 2ALYB 1D1IA 4DV6L 4LW1A 1KDAA 5ISRA 3HZXA 2B2TA 4CHTB 1IBLQ 1QVGA 1XMOL 2PQAA 2EE1A 3JAMi 1I4RA 2J7ZA 1VQLA 5CV4A 4DA2A 2VQFQ 1DONA 5CORA 3PCOB 3IKJA 2PNRC 3M4OB 4EVOA 2JJQA 5BN3A 1DJRD 3A54A 3EN2A 2QKIC 5IYDG 3S2HB 3I7FA 1GUWA 3HOXG 2VUMB 1VQFA 4MHEA 2G9DA 4JBWA 4OO1H 4L5QA 2NVYH 2Y0SB 2LXKA 3HOYH 3W1BA 1LV9A 2O2LD 4A76A 3CQZH 1CHQD 2JEBI 2FMCA 1QZGA 2R7FA 3HOXB 3CQZB 2B2VA 4IFDJ 2MJ8A 4LFCQ 1RTOA 2D62A 4ZCKA 3QOLA 1L1OA 1Y69U 1F2LA 3CCSA 4Y7NB 1EQVA 2F0IA 3S1RB 4GNXB 2E2JH 1PZID 4DU9A 3J81i 3NHHA 3CP0A 4JVZA 3CCLA 1SAPA 5JEAJ 1KTKA 3MC0B 4LUZA 2JA7H 1AEXA 4LF5L 2RCFA 1YZ6A 2F0TA 4DR6L 2WAQE 2H4OA 1HQMC 2EY6A 1YBYA 5KNDA 5CV6A 1X3EA 1YNJD 2XN9C 1B3QA 5FO9B 1YNNC 3GTGB 1X54A 4LF8Q 1NE3A 4TQUS 4ILWA 1QUQB 1PFBA 4RKLA 2JA6B 3J81j 1GUOA 1TWHB 4JYAL 3I70A 3VYUA 1PRTF 1SYFA 5JAVA 1PA6A 5TSSA 1FVIA 3CCRA 5KIXA 4A3CG 1TWFB 2KCMA 4JW0A 4K6DA 3QR8A 4CDEC 1QB5D 1EYAA 4RHRA 2WINB 3DM3A 3E9HA 3K6OA 4CKEA 5CR3A 1WCMH 1PDQA 2EJMA 2JE6I 4YY3Q 1VQ9A 2I0QA 4DR5Q 1D7QA 3UE1A 5JJZA 1Y14B 1NBWA 2ZTEA 3LNNA 4LMQD 4C3IB 4LFBL 2YV5A 2DNEA 2EZVA 3S15B 4L5TA 4KKSA 2PI2E 2R92B 3T4AC 4DAPA 2AQ1B 5E7NA 2OQKA 4GNXA 5IP9H 3FPUB 3PIPA 2N78A 2R7ZH 4JI8Q 2MQHA 5ELCA 4JI7L 2JA9A 4GS3A 1NUCA 1HPCA 1RD9D 3SHLA 1T5XD 3QO2A 5IYCG 1KDCA 1SE3A 4ULLA 2CVRA 2K32A 3ONAB 5M5XB 3GTLB 2O4XA 3AQQA 2G9HD 3A5UA 3BVGA 1EUJA 2Z4HA 1N33Q 1D6EC 3CU7A 2KA7A 1PFMA 1GXDC 3A8IE 2JA5B 1VQMA 1VQ5A 2IW3A 1IBLL 1JWSD 1UE5A 2DNCA 1X3PA 3GTOB 5I6WA 2VQFL 1MSGA 1C9OA 1VF5C 5M3MB 2NUCA 5IE8A 4K5WA 1KDBA 3FKIB 4DV6Q 1PH1A 2UUAL 3K8AA 3D3RA 4YCVA 1TS4A 2AWNA 3J80i 2KCTA 4OIJA 2F0DA 5IGCA 3HP3A 4G4KA 1FR3A 2ZXOA 4HMJA 5E1FA 4DR2Q 4BBRB 3DXJC 2PMZB 3U58A 2A5HA 4F87A 2PMZE 2NTTA 3K59A 1PH6A 1AH9A 2JYOA 5GAGC 4BBSG 4UP9A 1O78A 4UAIA 1GVPA 1Y8NB 1LTLA 1Y1WH 2X6LA 2X69A 3KLWA 1VQJA 3R93A 2VQEQ 2I07B 2D2CC 5EPKA 3BU2A 4GLVB 1MIUA 2Q2HA 5JEAG 1EQRA 1PH2A 3PO3G 3EIVA 5IOCA 2NN6I 2Y0SG 1HFGA 1H95A 1Y8OB 1B70B 2UU9Q 3E5SA 2IHFA 4JPBW 5IWAQ 4XYQA 1ET9A 1KQSA 4KY5A 4MZ9A 4B3RQ 2AKWB 1R9TH 1C4QA 3TQYA 2EYFA 1MJEA 1C8CA 1SYBA 4WJ4A 1SBBB 4I65A 3KFUA 3NBHB 4QIWE 1CA6A 1SE8A 1A3UA 1X3QA 3BVZA 1A63A 1B8AA 1RKNA 3QWNA 4A3BH 3KDFB 1WCMB 3N6RA 3BJUA 2L5TA 4A3BB 5C4XH 2CHBD 4P73A 2E2IH 1JR0D 4LF5Q 3U9OA 2TMPA 1VQPA 3RN5A 4HJ9A 1F2MA 3S15H 1H9RA 1XTDA 2J0TD 3HOWB 2CH4W 2K52A 1MJCA 1Q82C 1L1OB 4A3FH 1O7ZA 1STEA 1WTQA 4ZYSA 1D5XC 2NVTB 1LTTD 1WTHA 5HURA 3KLRA 2ENBA 1CZGA 2SNSA 3Q23A 1XJVA 4CJ1B 3S1NH 1Q86C 3A55A 1CQVA 3MXUA 4K5XA 3TP8A 1PH5A 4DKAC 1B53A 4C3HB 1JQYD 3TBIB 1OXTA 4LF4L 2AQ2B 2ZXPA 2ZTCA 3A0JA 1EY5A 4C3JB 3EJIA 4ZKBB 4IZ8A 3S2HH 1W6JA 2I46A 1FJGQ 1YNJC 3PUYA 3I90A 1EIGA 1BCPF 4HSVA 2CWAA 4C1NI 1T9HA 2F4VL 1D8LA 5M9OA 2LKVA 1X56A 1SLJA 4IURA 5FOBB 1NMGA 4EQOA 2YU9B 2Q8RE 4H7BA 4DV5L 3EROA 3KDFA 4JI7Q 4BY1G 4JV5Q 4GKJL 5M3MH 2QA4A 4H0LC 3CAMA 4C3JH 4GOPC 4TVAB 3KK7A 1IKLA 3H91A 4RGTA 4J6HA 4IN3A 3D6CA 2N3SA 1Q46A 3PIP3 3HOXH 2QILA 5AJ3L 3K5OA 5C3EG 2VS1A 3W5OA 3D4WA 2KEEA 1N33L 4RFBA 1QWYA 1D1KA 4A3LG 2F0WA 3VYRA 2UUAQ 2KHSA 5LMNW 1Q3LA 1U4LA 3MHBA 3CC4A 4DK3C 5JVH3 1HNZL 1SJED 3OIPA 3FEWX 3I4LA 4NPSA 1S72A 1YI2A 3W3AA 5E4XA 4JI4Q 2UUBQ 1OXXK 1IW7D 2V4DA 4KKTA 3U50C 2EYPA 2PQEA 3J7AV 2YTVA 1BQQT 5C5LA 1Q8IA 3FVQA 3R2IA 2C9OA 2ZJPA 5C4ZA 2A6EC 2QW7A 4GLXA 3NSWA 1EU3A 1X6OA 1ESFA 3PQIA 3LGJA 5FO7B 2VQEL 4DR2L 1GOZA 3BG3A 2PPBC 1ILQA 3CPWA 2FHTA 1GHJA 1BBUA 1EWHA 2ZXRA 1VQCA 2QF7A 4AYBE 1H9KA 4LF9L 2ATWA 1CFMA 1VMPA 4A3IH 3MFYA 3J7A5 4PG3A 1PYBA 4GN4B 4DUZQ 5JJIA 1XPUA 1K8MA 3VR5A 3J81c 4A3KB 4POGA 2E75C 1N34L 4FO2A 1XNRQ 1JJ2A 1F2ZA 4FXGC 4PZ8A 1I4HA 5ELNA 5C6AA 2NTSA 3FP9A 1TVXA 1N32L 3BYYB 4ZLTF 2UXBL 5HY6A 4XQJA 1LO5D 4YHHQ 1VQ6A 1CZWA 4GLAC 3MTSA 4K14A 3MAQA 2DGYA 2K04A 4DR7L 1G2TA 1DCZA 4O42A 4XT3B 3RZOH 1PVOA 2E5LQ 4J8QA 1PYSB 3MWYW 5ELEA 2PZWA 1ZKOA 2N88A 3A74A 4QUFA 3SDZA 4G7OC 2VUMG 1SNQA 1TT2A 3HOWH 1EFID 1I94Q 4DN4M 1Q81C 1KAAA 1I3QH 1SDFA 2A69C 2B8GA 2Y0SE 4A3EG 1OXSC 1YEZA 3D31A 2HD3A 2HIVA 3LWUA 1I6VC 1CHPD 1XWEA 3T16A 4Y52H 5EPLA 4RCNA 1EU4A 2XWBB 3I4MG 1K3RA 4J15A 4X65L 1II3A 2ZM6L 2RCNA 1IYVA 4HTHA 3OMGA 2K5DA 4HAEA 2H1EA 1CKNA 1ESRA 3V2TA 3PMFA 2WB1G 5EKKA 1B9NA 4ID6A 1ENAA 3CPFA 3VR3A 1G91A 1K0SA 1IBKL 3OIQA 1I4XA 4CJ2C 3IAYA 2KHJA 2HUGA 3N52A 3UDXA 2OT2A 2EY2A 4JI5L 1S5DD 1Z7TA 1IBMQ 5C0XI 4WJWA 3PSIA 2KHIA 2R7ZB 2LSSA 2RBMA 1HHVA 3BDOA 3S14B 3U4ZA 1G51A 3NQTA 2A1AA 3S14H 1Q1EA 4A3IB 2JA8G 1BOSA 4UY8C 4Q0FA 3BZCA 3VR2A 2B63G 2LMCB 3HEJA 4JBJA 1OXUA 4IPHA 5CV5A 3DMUA 1M4VA 5EBCA 4N9TA 3CMEA 3HOZH 2L1BA 2EY5A 4EX5A 5DEHA 5C3WA 2KJXA 3FRPB 5A2QL 2P5ZX 3K58A 2UXCL 5FLMG 3TEHB 4B08A 3CHBD 2EXDA 5AJ3Q 1WD1A 1WJJA 3BDCA 4JI4L 2K5VA 2K5QA 4DNTB 3S16B 3NTHA 2B2YC 3I72A 1RTNA 1A8VA 3A5ZB 3QG1A 3BYTB 1A62A 3SK6A 1TIID 2NB0A 4Z9CB 5JPNC 1MKHA 1XMOQ 4N8FA 4KY6A 1UNSA 2K03A 4ME5A 1G8ZD 4IFDH 4KJNA 4A3MG 2F0JA 2EJFC 4JI2L 3AFPA 3J80L 2FXQA 2KCCA 4C1NK 1JICA 4CKCA 3GTGH 2F0VA 4GKKQ 3H0GG 2PO4A 3GTPH 1TWCB 5K36G 3ER0A 1U4PA 3CXCA 5J3BA 1V8QA 1B44D 4IOCA 1N8RC 4A3KG 1X65A 1O7YA 2HIXA 3S1RH 3I4OA 3CCVA 1LT5D 2XRQD 4G57A 1Y8PB 4QF4A 4HIKA 5AFWA 1N36Q 2EPBA 2OTJA 3VR4A 4A3JG 3SGIA 1RDPD 2TSSA 2JA5G 4LF9Q 5ELBA 1JJGA 2AQ3B 1I50H 1WFQA 3C1FA 5C3XA 4B9XA 1KC8C 3TN2A 1Y1VG 5LL6X 3GTMH 3AB9A 3K5NA 2PI2A 1LTID 4QCLA 3EBEA 4S3SA 4LUVA 4XDXA 1S5ED 3I4MB 1HZAA 4GNXC 1WTPA 5FLXL 1UEAB 1ASZA 4OHJA 5D3DA 5IYBG 1XNRL 5D3IB 2R92G 3GTQB 2Z0SA 1NR4A 4DF7A 2JN4A 3NUCA 1K8GA 1LT6D 3TP7A 4FYDA 1N32Q 1TWFH 1F9RA 1Z47A 4C3HH 4KK7A 4FDBA 3RUZA 5BR8Q 2BE5C 5I9PA 4DR6Q 2JP1A 2CW0C 4OIKA 4L63B 1P8LA 4OX9L 5LMNL 3E6ZX 1TY0A 4K5VA 1SMYC 4BBRG 1UEBA 1M1KC 4JI3Q 3T1HQ 2A6HC 1EY4A 2MFIA 1HXYD 1RF2D 1QNKA 4JOIC 1JWMD 4AIMA 5FO8B 1J5EL 2MO1A 1I3QB 2QDLA 4NB3A 1PTOH 4JYAQ 2Q2TA 4RH6A 4DAVA 4JI0L 1STAA 5KNCA 2PQAB 3H3VI 4YCWA 3HOUG 3NPPA 2IY5B 1FL0A 1DOKA 5LMUL 2R61A 2K4KA 4K2KA 1YJNA 2OF1A 1EYDA 4DR5L 2JEAI 1FD7D 2HCIA 1EY0A 1BNZA 2VZAA 4CKBA 1E1OA 4B3TL 2R93G 5FJ8H 3RD4A 3HGBA 4R4CA 2VY3A 3WDNA 1KRSA 2UXDQ 1ZYRD 1HZCA 3RLFA 1QG7A 2WV6D 3D4RA 2JQOA 4AH6A 1IZ6A 1IBKQ 1LACA 4DR3Q 3HKZB 1VQBA 1EYGA 1CM9A 2VXWA 3IFTA 2RKSA 2A8VA 4BS9A 3TZUA 3VYSA 1WVLA 1U5KA 2NVQH 4GN5A 3G4SA 4R4OA 2YU9H 3I4NG 4XQNA 1HZBA 4JCVE 5I9OA 5ELFA 2HHHQ 1VDZA 3H94A 2EXZA 4K6LA 4OWXB 3HKZG 5CYUA 4GOPA 1OXVA 1EIFA 3H6MA 3TMEA 1PZJD 1DZ1A 2F0LA 4OO1G 4DAMA 3Q8DA 1SYGA 4IUNA 3T56B 2E2HH 1EYCA 2OTLA 4NMZA 1E24A 1KHIA 2J4XA 2WFWA 2GVBA 2NVXH 4EQ5A 4CBVA 3CCMA 1TWAH 3PGZA 4L5RC 3GTLH 2RQXA 4CGYB 4JI2Q 2NZOA 3TS2A 5CC4A 5EGTA 5JJKA 4P71A 3SXHA 3KBGA 3UDGA 4FXDA 2F0EA 1NAPA 1TWGB 4NXMQ 3UI2A 1ML0D 3P7JA 3S2DB 4BY7G 4NXNL 3MZ5A 5DAUA 1VQGA 2PCFB 3SE0A 5KGUA 3E0JA 3DHQA 2GN5A 1S4ZA 3CCJA 1NR2A 1GJXA 4FF3A 3K7UC 2JK8A 1JB7A 3M3YB 2KQ3A 4O0AA 1DXMA 4A93G 1AE2A 1ZXTA 1A0IA 4GKKL 3R2TA 1ONLA 3MXNA 2A73B 4R8NA 1CSQA 3ZYYX 4B3SQ 3HKZE 1O7IA 3T1YQ 1HZ9A 4AQYL 1IL8A 1BXTA 2F3IA 2N49A 2XTIA 2K7VA 1NY4A 2K33A 1VQ7A 2K05A 1N36L 3RMHA 3STBD 1STYA 4QY7A 3OPOA 1SFOH 4A3GB 2SNMA 1HUNA 1HTPA 5J39A 3J80E 2UU9L 1EY7A 3KF8A 1SNPA 3NE5B 1EEID 1IHZA 5COYA 5IWAL 4DV7Q 4DV3Q 1BBWA 2KVMA 3SK4A 4CJ0B 2I5MX 1YJ9A 1SE4A 3SEBA 1PYWD 3L2PA 1R4QB 1JB3A 2MHVA 4F8MA 2O5IC 1PLFA 4EGVA 3Q24A 2YTXA 1K9MC 5C44H 1B9MA 5CV7A 1Z9FA 4DV2L 1SJHD 2OQ0A 5DLQE 5C44B 3GTKH 4X3KA 1SYEA 1LTRD 4DR4Q 1A2TA 3A7AB 3ULJA 5E3FA 4UP8A 3WWVA 5C0XJ 2JA6G 3AU7A 2QGQA 2SEBD 1SNDA 1KLGD 4A3DH 4FF2A 5LMNQ 4BXXH 1K0RA 4N9PA 1AN8A 2C35B 2E76C 3T1HL 2JA8B 1ASYA 1RCVD 3PIO3 3GO5A 3HOYG 4DAYB 1PH7A 2JA8H 2KENA 2KECA 3K0YA 4DUYQ 1J5EQ 4X62L 1PFNA 4FVMA 1A3VA 1DYQA 5C3EB 4K0KQ 1PRTB 2DY7A 4DV4L 1PTOD 1Q90A 5GAEC 4DR3L 5LMUQ 1IL2A 3G71A 3HOZB 3G6EA 3NENA 3ULLA 5HGQA 5KRUA 4OO1I 3TREA 5CGKA 1EWIA 1FJGL 2WAQG 1SYDA 4HJAA 4BBSB 1JCKB 1K83H 5IP7H 2L15A 1PRTC 4R1JA 3JC66 3PUZA 1SMXA 4QMGA 4KKUA 4IFDG 4JC0A 1E1TA 1JC7A 4BY7B 3H3VC 2Q8IB 4KD4A 4IPDA 2AHOB 1NNXA 4JI1L 2HHHL 4M1UB 4LWCA 1YNXA 1V1PB 2Z1CA 3GD7A 1WTRA 2L0CA 1ENFA 1MHWC 2Z4IA 3EFXD 2ZJRA 2DN8A 3NBHA 1YNND 2EYJA 2XRSD 3P1HA 1HTLD 4NDXA 1QZHA 1SR3A 1Y1WG 1O7LA 3TSSA 1AE3A 3CKIB 4MTNA 5JJLA 2BH8A 4NKLA 3IRBA 4C3IG 4WJ3M 1YVCA 1L0WA 1HNZQ 3PUWA 1SEBD 1QOHA 1HR0W 1F9SA 4TKOB 4OWWB 1EEFD 5I2YA 5T1GA 4DV1L 2UUBL 4TRDA 5CV9A 1J6QA 1JWUD 5IODA 1KIXA 4O2DA 1J8IA 1BCPB 1C7YA 4N8X1 2R7ZG 3DLLA 4B3MQ 4PMWA 1HR0Q 4A3BG 5M3FB 4A3GG 2K6AA 5M5WH 3GTPB 1KAWA 5CV8A 1Z6HA 5KYLA 5I2XA 4H02A 2O5JC 5IGBA 4HJ8A 1UWVA 2K50A 1SE2A 4RG1A 1CA5A 2AUKA 4TSSA 4WRDA 3L3OC 4A3FG 4LNQA 5C4JH 3FMCA 3T1YL 2LY7A 4XXEA 2ICEC 4X66Q 4DUZL 1HRJA 1VCIA 4ALPA 3NELA 3CMAA 2F3VA 1BUVT 1W3SA 1N34Q 4FF1A 3NWTA 2K5HA 3F8TA 2FINB 3PO2G 3HKSA 2IX1A 3STBC 4DR4L 2ZJQA 2M9VA 2R93B 1WI5A 4XT1B 4IALA 2R93H 1OTCA 2B2VC 5I4DA 1PV4A 3CCQA 1PZKD 1VQ4A 3PO2B 1CUKA 1S5BD 3EQLC 4MNOA 2F1MA 1CT1D 3P75A 3V96A 2PW5A 4BBSH 2ZT9C 1LTGD 4X3SA 4A75A 3I4NH 4X6AH 3AFQA 2G5DA 5GAHC 3S17B 1E0BA 2XIWA 4DNIA 3K7AH 3S16H 4PZ7A 3KF6A 1L0YB 2HQEA 3CW2C 1A2UA 2DJFC 4YWLA 5C3EH 4H44C 2PZUA 4KMUC 2NZ1D 1KL9A 1L0XB 1XYIA 1TS5A 3ND8A 3D4DA 3F1ZA 3EVQA 4WFN3 1V1OA 3AEVA 1Y1WB 5EAYA 2EYMA 5IGEA 4DV4Q 2M00A 1Q12A 3M7NA 1BR9A 1JOQA 1EL0A 4ZQ3A 4J1MA 5IIFA 3WOEA 3K80C 1HFNA 3ZJYC 3AMUA 4JI5Q 4RGOS 2F3WA 3G48A 3SR1A 1H9JA 2C5CA 2KCNA 2Z6KA 3NXWA 2IWHA 4AYBG 2JXMB 1V9PA 3D8GA 5C4XG 3MEHA 1MD2D 1QVCA 3OOCA 2EDGA 3L7ZC 1KD1C 4Q5VA 3BS1A 1HCZA 3GTMB 4DXFA 5GQOA 1PRTD 1VQHA 4RGNA 5M3FH 2MPMA 4FXKC 1KNEA 4BA1I 1WTOA 4BY1H 3DEOA 5ELOA 2LS01 1T5EA 3BDLA 1RJTA 1DGSA 3DEPA 4NW2A 1NMFA 1FNWA 2ICIA 3IFDA 1BCPC 2NVTH 1LM0A 1X32A 1X55A 2EYHA 3HOVH 1PTOC 4KN7C 5E4WC 4QGUA 4R4TA 3RN2A 2HDMA 4C2MH 3RZDB 3GV3A 4IPCA 3GDEA 2V1CC 5GADC 1B2TA 2BA0A 4X3TA 2XWJB 1K8OA 1E3PA 1TU2B 3NEMA 4B3ML 1D5MC 5C44G 5BN5A 1GM5A 1EOVA 2X6GA 4OL7A 4LK1C 4X66L 3K81C 4C3JG 5M5YB 3CC2A 4QUCA 1GHKA 4UPAA 4JI8L 3PUXA 4R9WA 2B8FA 4B9WA 3I91A 5G3LF 2E8GA 4U673 5EKLA 2BH2A 1I4QA 4A3LH 4DV0L 2F52A 3S1QB 3FKIG 1GUGA 1MSHA 4PMBA 1SNCA 4QJFA 2K5NA 1E2ZA 1EQQA 3HS0C 1PXUA 4KD3A 1X9NA 3UE0A 3L9AX 5L37A 1VQ8A 1QE6A 1E2WA 2VNUD 3I8ZA 4HCSA 2Z6KC 5BR8L 4LF6Q 1TWGH 4IUTA 4OX9Q 1SNMA 2L12A 4L8JA 3MXGA 2QCPX 4ABNA 1KLUD 2IX3A 2QEXA 4C2MB 3M85A 2QEJC 2IHEA 1K8AC 1QCBD 2I5LX 2L4NA 2BCOA 4JI0Q 5LHY1 1BBXC 3J81E 3O13A 2AWOA 2F0FA 4E6IA 1YITA 4LF4Q 1LT3D 1XMQL 1AFPA 4HEDA 4IUQA 2F0PA 3OW7A 1W6KA 3K7AB 2B2YA 1CTMA 3T51B 4HIMA 4B3TQ 4PMCA 3UDIA 2NWGA 4KV6A 2PZTA 3M4OH 2OWOA 5CBEE 2F4VQ 2XNAC 4P72A 1A6XA 1TKWB 4C3IH 5H1SE 1X3GA 2RDGA 2JA7G 3F2UA 4IPGA 3ERSX 4DNRB 2F0HA 5K5PA 2E2DC 1F77A 1PTOF 2R6GA 5EKIA 2RDHA 4A3MH 1A15A 1VMCA 1XTCD 1M8AA 3M9BA 4ZAIA 3KLSX 5IP9G 4LJZC 2NVXB 3KF6B 1J9OA 1U9RA 1G291 2AUJD 1TWAB 1B3AA 1A3TA 5EPJA 4CDDC 1EY6A 1VQOA 3GTKB 4P74A 2A68D 2EVBA 3W2DA 5C4JB 1EZ8A 1JE4A 4A3CH 4PZ6A 1CK1A 3MA2B 3RZOB 2K75A 4X3UA 1EFWA 1XX8A 2HCCA 1I4PA 5EJWA 1WCMG 2BDNA 4YIJA 2Q2IA 4JI6Q 4RGMA 3KOJA 3I4MH 5KEEA 4KLKA 3BZKA 4RAUC 2RSOA 1S5FD 3TDQA 4EQPA 2B2WA 1ET6A 4IUPA 5JOBA 1GKHA 3TP6A 4HIDA 1NSNS 3HOZG 2XSCA 4RMFA 2B29A 4QL5A 4PV1C 4DFAA 5FLMH 1CI3M 1HUMA 1TR5A 2WAQB 2B2UC 3NTIA 2EYOA 4HIOA 4RKBA 3X3NA 5IGDA 3LWEA 2L9HA 3PO2H 1F2YA 1NTGA 3D0FA 4I7ZC 3QJYA 1JT8A 1LABA 5CMDA 1TWCH 3PV0A 4C3HG 1JOOA 3S17H 3E9IA 1KRTA 5D14A 1HH2P 1O80A 2A6HD 3KBXA 4B3SL 2F0KA 4O1NA 1DD2A 2LXJA 1STBA 2CW0D 3H0GH 1B1ZA 2B2TC 5M5XH 1ZEQX 1SYCA 3KLSA 4IUVA 5C0XH 4DV5Q 1PMRA 1AW7A 1E2VA 3GTJB 4A3KH 5IT9L 1HNXL 4OEMB 4GKJQ 4JV5L 4DV3L 4HCEA 3M4YA 4KHVA 3F2DA 3M4QA 1MBYA 3BVMA 3FPPA 2F4IA 4YHHL 3PO3H 1X3FA 3OWFA 3K57A 4JBMA 4HJ5A 1D5ZC 4KN4C 3SVMA 1TY2A 5FJ8G 3OTOL 4FNFA 4HMIA 1SMYD 2RF4A 3OW2A 3WOFA 2LFNA 1VF7A 2PW7A 2WIIB 5FLXE 3QOJA 1SN8A 1I6HB 1IKMA 1S5CD 4LF7Q 2DY8A 3R3OA 1UUPA 3M7GA 1FNVA 5IYBH 2BA1A 3H15A 2GVAA 3I56A 2A19A 4JG2A 4APVA 3CF5A 5JVG3 1C48A 2B2WC 2QDBA 1XXGA 3HOUB 4YWKA 1EIHA 1ILPA 4WORA 2PYKA 3TS0A 4RCOA 1YIJA 3EA6A 4A3FB 4RA8A 5D65A 5JEAH 2EYLA 4IUUA 1FGBD 4K0KL 3OYYA 4R8IA 3NWSA 4V190 1G6ZA 5C4HA 1XMQQ 2EY1A 1Y1VH 1MI2A 2IPKD 3MVVA 4OXPA 4V0BA 4MN3A 2NYZD 2XGTA 3MXNB 4POFA 2SOBA 3TP5A 3VR6A 1DOMA 1SXTA 4UP7A 2PNHA 3CRLC 1PHJA 1BO0A 1WTXA 1LUZA 1L1OC 1ENCA 2ID0A 3VDYA 2K5WA 1Y1VB 3Q22A 3W1GA 1VS0A 4JK1C 4JI6L 1E7ZA 1CKOA 3L0OA 2MNAA 2UXCQ 2UXBQ 2VB2X 3J7ZC 1UE1A 4L5SA 2E2IB 2CH4A 1BCPD 4YCUA 5M3MG 1QILA 3UDFA 1V43A 3K5MA 2E5LL 4LAAA 2ZTDA 4CDFC 3OHXC 3U9SA 4ZUJA 1W2BA 2HT1A 1CKNB 3HOUH 3VYTA 4P2CB 1HNWQ 1NJIC 1SRUA 1I94L 2EIFA 1PTOB 3S9WA 1ICFB 1SNOA 2N8NA 3T53B 1SROA 4IJLA 3PF4A 2F0OA 1PH9A 3FDTA 3NQIA 3Q6SA 4BA2I 3E3XA 3FKIH 2Q8TA 2RVLA 2HQLA 3JAME 2M2LA 3A8KE 4R4IA 1S3OA 2ZM6Q 1QNUA 1GD7A 1HR0L 4FF4A 3ERQA 2BOSA 2I5HA 2F0NA 1PFSA 4LFAQ 2A69D 1NCVA 1MGSA 2A74C 3G7LA 2JA6H 4BY7H 1EIYB 3A56A 1DOLA 1N9WA 4QIWB 5M5YH 2IT1A 3RLOA 2KUMA 4XYOA 1TXYA 1RHPA 5DM73 4K8IA 2B3GA 2UUCL 3NP8A 3DM1A 3OTOQ 4ZK9B 3J7YW 4A3IG 4R4QA 1HNXQ 1R4PB 2EJGC 4UHVA 1L2FA 3AYHB 3I73A 1B50A 3PO3B 4LF7L 1HJPA 1EQTA 3I2ZA 1TS3A 3P20A 1KXLA 2Z9HA 1AP0A 3SK8A 1K3BC 2F0SA 3LX0A 3J7AF 2NN6G 1YHQA 4YWMA 1IYUA 3BZDB 5GROA 3TRZA 2CQAA 3KUPA 5IT9E 3CCEA 1FNUA 4ME3A 4A93H 3HG9A 5F2DA 1I4GA 3PIOA 1XNQQ 3S2DH 1IXRA 2N55A 3CRKC 3ICEA 1STHA 4IOAA 2F0GA 2A6ED 1HA6A 2VUMH 4NP5A 4P75A 4CDCC 3MEFA 3Q0AA 2D5DA 5EQ0A 3JAMc 2VB3X 4KJOA 3J81L 1M90C 2K01A 3GTOH 4KHPL 2CWPA 2R3ZA 2RDFA 5IY0A 1BF4A 3HOVB 2OXPA 2UXDL 2ES2A 1V1QA 5IGGA 1Q1BA 1U4MA 4DXGA 4DK1A 1WTWA 1XPRA 2D9UA 4XTCS 1JORA 1ICWA 3FHWA 2FJ2A 3K5LA 1RIPA 3GV6A 4RHSA 4A3DB 1YHAA 1UAPA 3T13A 4B3RL 2CKZB 5J1ZA 1CQFA 1LT4D 1EWCA 5IYDH 2NVQB 5C5MA 1WOCA 1CKMA 3S24A 2KBNA 1IW7C 5JPMC 4QB4A 2NBFA 4A3DG 3DWPA 4BXXG 1U4RA 3RZDH 3PUVA 2SDFA 1AZPA 3JAML 4DR1L 3S1MB 1YHBA 5CBAE 2F0MA 2OCEA 4ODGA 1R9TB 2DJGC 2WACA 3I55A 3NBIA 4JI3L 2B63B 4A3MB 5IGFA 1IYJB 3HFZB 3NTKA 3X3MA 3I3CA 4IFDI 4OELB 3KJOA 2A68C 4LUOA 4X64Q 4NXML 5C0XG 3M4PA 4HSPA 1HNWL 4NXNQ 1K73C 3IL8A 5FK9C 4KHZA 2RA4A 2JA7B 1FGUA 2FMMA 2RHQB 1DM0B 1I6HH 4LFAL 1TS2A 3S1MH 1OO9B 1LYLA 4I7AA 1EOTA 5IP7G 1I5FA 2KOLA 3RR5A 4RWSC 5DM63 4A3JB 1C0AA 2WKDA 1F9PA 4FP5D 3ULPA 1CSPA 3QB3A 4GOPB 4KI0A 5IT9c 4G7ZC 1JMCA 3S1NB 1JJCB 4PNYA 1HQRD 4L6TB 2BE5D 4PQXA 4DPGA 5K36H 3HOWG 2WB1E 2F0UA 4BWGB 2E74C 3VA5A 1SSOA 4A3EH 3H0GB 2WKCA 5FLXc 2K14A 4XIGS 4MTKA 5NUCA 4DV0Q 2MP1A 2K28A 4OGQC 4A93B 2YYZA 1GUTA 4A3JH 2BDOA 1YJWA 5T1IA 5LL6S 2UUCQ 2E2HB 5I6YA 2GA4B 4IJHA 2R7DA 3M3YH 1G2SA 2XVSA 3GTQH 3J80c 1P16A 3VA7A 4XQQA 1JE5A 3RNUA 2WP8J 4ZRZA 3U4VA 1K28A 3KF8B 3MFGA 3MXPA 1XNQL 4LF6L 3PF5A 1WYDA 5IYCH 1I50B 2KEDA 3ND9A 5C4XB 1WTVA 4HN7A 5ELDA 3H3VH 1SFOB 4A3GH 4KTAA 4K2LA 1EY8A 1HA5A 3E0EA 4KY7A 3TZDA 1H9SB 3F2BA 4C56C 4KHPQ 2B63H 4BY1B 2MGSA 4DGZA 2OEOA 5J22A 2NVYB 4JBKA 3URYA 1XPOA 3CD6A 2JA5H 4HR7B 5HGTA 1GUSA 4F88A 1D2BA 3HRZC 2AMCB 3A8JE 4G7HC 4OWTB 2YTYA 2B2UA 2L11A 3S1QH 2FFKB 3QIAA 3V05A 4AQYQ 4HJ7A 3KJPA 4Y7NH 3DWAA 1LTBD 1H9MA 4F7XA 3B6YA 2IL8A 4U68A 4AYBB 2B39A 2IJ0A 3HOVG 1QUQA 2DUDA 2L55A 2Z8LA 1LTSD 1RODA 2K1BA 1B7YB 4GN3B 2RSNA 1GUNA 3C2PA 4DV7L 3CC7A 1BVSA 4BBRH 1VQKA 4LFCL 2F03A 3C46A 1VQEA 3HOYB 2EQSA 1Q7YC 3C3LA 1RL2A 1U0LA 4ZKCB 2MUYA 3G6JB 5DNFA 4DR7Q 2MO0A 2NZHA 4DAYA 3GP7A 3SK5A 5KNBA 3C1EA 4LF8L 4IQZA 2VW9A 4DV2Q 4X64L 3KYHC 3GTJH 1H9SA 4DR1Q 1PH4A 3I4NB 1BDOA 5BN4A 1PH8A 1UE6A 3DUZA 1TWHH 5A35A 4DV1Q 2F0QA 1Q8KA 1V1PA 4UDUC 4QQBX 4YY3L 4EQNA 4X65Q 3DWQA 1S40A 3D6WA 2IX0A 1B4OA 2ASBA 4DUYL 1VQAA 1F9QA 4LFBQ 4X62Q 5FKAC 1STGA 3F2CA 2R92H 2JSOA 3K0XA 3CCUA 4H13C 1KNAA 1LLRD 5EBDA 3NK9A 1VQDA 1FYCA 2D0OA 4ZUIA 4DK6C 5A2QE 2E2JB 2CFMA 1IBML 1ZYRC 1JOKA 1GO3E 1AZQA 2CCZA 1BKBA 3OWEB 2NN6H 1K83B
chains in the Genus database with same CATH topology
4GLAC 1VQIA 2DGYA 4OWWB 4DV1L 2UUBL 4DR7L 1XMQQ 2Q2UA 1J6QA 3RZOH 1Y1VH 4IO9A 1PVOA 2E5LQ 4JOIA 1UE7A 2RHSB 1PYSB 2VL6A 4OXPA 5M3FG 1KIXA 4O2DA 2XGTA 3MXNB 3A74A 4POFA 1C7YA 4OONA 2VUMG 2R7ZG 3DLLA 1E22A 1PH3A 3HOWH 4B3MQ 4PMWA 1I94Q 1HR0Q 4A3BG 2H5XA 1G6PA 1Q81C 4UP7A 4JI1Q 2PNHA 3RLNA 4A4IA 4A3GG 1I3QH 5M5WH 2Y0SE 4A3EG 1PHJA 1OXSC 1YEZA 3D31A 1VQNA 1KAWA 2HIVA 4H02A 4Y52H 4HJ8A 1LUZA 1L1OC 1UWVA 2CQOA 2K50A 2D0PA 3I4MG 1K3RA 4J15A 4RG1A 4X65L 1QVFA 2ID0A 2ALYB 4DV6L 3VDYA 4LW1A 2ZM6L 4A3FG 4LNQA 5C4JH 2RCNA 1IBLQ 3W1GA 3T1YL 1VS0A 1QVGA 4JI6L 1CKNA 1E7ZA 1CKOA 3L0OA 2MNAA 1XMOL 2PQAA 3J7ZC 2WB1G 2UXCQ 1UE1A 4L5SA 3JAMi 4X66Q 1VQLA 4DUZL 3CPFA 2VQFQ 3PCOB 4YCUA 5M3MG 1IBKL 1VCIA 2JJQA 3UDFA 4ALPA 3NELA 1V43A 2KHJA 3EN2A 3CMAA 1W3SA 5IYDG 1N34Q 2E5LL 2ZTDA 3I7FA 2K5HA 3UDXA 3F8TA 4JI5L 1W2BA 2HT1A 1CKNB 3HOUH 1IBMQ 5C0XI 3HOXG 3HKSA 2IX1A 3PO2G 3PSIA 2KHIA 3STBC 4DR4L 2LSSA 1VQFA 2ZJQA 1HNWQ 1NJIC 1SRUA 1I94L 2EIFA 4JBWA 3U4ZA 1G51A 1WI5A 2NVYH 4L5QA 2N8NA 2LXKA 1SROA 4IJLA 2A1AA 3HOYH 3W1BA 3PF4A 1Q1EA 1OTCA 2JA8G 3S14H 2R93H 4UY8C 1PH9A 3BZCA 2B63G 1PV4A 4A76A 4BA2I 3CQZH 2JEBI 3FKIH 4JBJA 1OXUA 2HQLA 4IPHA 3CCQA 1QZGA 2R7FA 1VQ4A 4IFDJ 3CMEA 4R4IA 3HOZH 1S3OA 1CUKA 2ZM6Q 4EX5A 4LFCQ 4MNOA 1GD7A 1HR0L 2D62A 2UXCL 5FLMG 1L1OA 3CCSA 3TEHB 2I5HA 4BBSH 4K0KL 2EXDA 1PFSA 4LFAQ 4GNXB 2E2JH 3J81i 5AJ3Q 4A75A 3I4NH 1WJJA 4JI4L 4X6AH 2K5VA 3CP0A 3AFQA 5GAHC 2JA6H 4BY7H 1EIYB 1A8VA 3A5ZB 4DNIA 3CCLA 3K7AH 1A62A 4PZ7A 5JEAJ 3KF6A 3S16H 1N9WA 4LUZA 5M5YH 3CW2C 2JA7H 2IT1A 4YWLA 3RLOA 5C3EH 1TXYA 4LF5L 1KL9A 1MKHA 1XMOQ 2B3GA 3F1ZA 1YZ6A 3AEVA 4A3MG 5EAYA 4DR6L 2WAQE 4DV4Q 2UUCL 4JI2L 1Q12A 3M7NA 3AFPA 3OTOQ 1YBYA 2FXQA 1X3EA 3K80C 4A3IG 3ZJYC 4R4QA 1X54A 1HNXQ 4LF8Q 3GTGH 4GKKQ 4JI5Q 1NE3A 3H0GG 4TQUS 1QUQB 3GTPH 3G48A 5K36G 3ER0A 3J81j 1L2FA 5J3BA 3AYHB 3CXCA 4JYAL 4IOCA 1N8RC 4A3KG 1X65A 1PA6A 4A3CG 3CCRA 1FVIA 2Z6KA 2HIXA 3S1RH 2KCMA 4LF7L 3I4OA 3CCVA 1HJPA 4AYBG 1V9PA 3I2ZA 5C4XG 1KXLA 3DM3A 3E9HA 4HIKA 1QVCA 1WCMH 1N36Q 2OTJA 2JE6I 4YY3Q 2NN6G 1VQ9A 2I0QA 4A3JG 4DR5Q 1YHQA 1D7QA 3SGIA 4YWMA 3UE1A 1Y14B 1NBWA 2ZTEA 3L7ZC 5GROA 1KD1C 3TRZA 2JA5G 4LF9Q 4LFBL 1JJGA 2YV5A 3CCEA 1I50H 1WFQA 4ME3A 4A93H 4L5TA 2PI2E 1KC8C 1Y1VG 3GTMH 3PIOA 1XNQQ 3S2DH 1IXRA 2PI2A 5GQOA 1VQHA 5M3FH 3EBEA 4LUVA 5E7NA 4BA1I 2OQKA 4BY1H 4GNXA 3ICEA 5ELOA 5IP9H 1HZAA 3PIPA 4GNXC 4IOAA 2N78A 2R7ZH 2VUMH 1ASZA 4JI8Q 4P75A 2MQHA 1DGSA 5IYBG 1XNRL 1NMFA 3MEFA 4JI7L 2JA9A 3JAMc 4GS3A 2Z0SA 2NVTH 2R92G 1M90C 1LM0A 1X55A 5IYCG 3GTOH 1K8GA 4KHPL 2CWPA 1N32Q 5IY0A 1TWFH 3HOVH 1Z47A 2UXDL 4C3HH 1V1QA 3AQQA 2ES2A 1Q1BA 4FDBA 4QGUA 4R4TA 5BR8Q 4DR6Q 3RN2A 1XPRA 4OX9L 1P8LA 5LMNL 1M1KC 4JI3Q 4BBRG 4C2MH 1UEBA 3A5UA 4IPCA 3T1HQ 4XTCS 3GDEA 1EUJA 2V1CC 5GADC 1N33Q 2MFIA 2BA0A 3FHWA 4JOIC 4AIMA 1E3PA 1RIPA 1YHAA 3NEMA 1J5EL 1VQMA 2MO1A 4NB3A 1VQ5A 4JYAQ 4B3ML 4B3RL 2Q2TA 5C44G 1IBLL 2CKZB 1GM5A 4JI0L 1UE5A 2PQAB 1EOVA 5IYDH 3H3VI 4YCWA 4X66L 2VQFL 3K81C 3HOUG 1C9OA 1WOCA 1CKMA 3CC2A 1FL0A 3S24A 2IY5B 2KBNA 5LMUL 2K4KA 1YJNA 4UPAA 4JI8L 4DR5L 5IE8A 2JEAI 4DV6Q 1PH1A 2UUAL 4A3DG 4BXXG 3PUXA 3K8AA 2VZAA 3RZDH 3PUVA 1E1OA 4YCVA 4B3TL 2R93G 2AWNA 3J80i 5FJ8H 2KCTA 4R4CA 4DR1L 2VY3A 2E8GA 1YHBA 2BH2A 2OCEA 4A3LH 1KRSA 4DV0L 2F52A 2UXDQ 1HZCA 3RLFA 3FKIG 2JQOA 4AH6A 4QJFA 1IZ6A 1IBKQ 4DR3Q 2K5NA 4DR2Q 3I55A 1VQBA 4JI3L 1IYJB 1EYGA 1EQQA 3HFZB 3U58A 4IFDI 2PMZE 2A8VA 3KJOA 4LUOA 1X9NA 1PH6A 1AH9A 4X64Q 5GAGC 4BBSG 1U5KA 4UP9A 2NVQH 4NXML 4GN5A 3M4PA 3UE0A 4R4OA 5C0XG 1GVPA 3G4SA 1VQ8A 2YU9H 3I4NG 1HZBA 4NXNQ 1K73C 1HNWL 4JCVE 2VNUD 1LTLA 2HHHQ 1Y1WH 3KLWA 2Z6KC 1VQJA 4KHZA 5BR8L 4LF6Q 1FGUA 1TWGH 2RHQB 4OWXB 4OX9Q 3HKZG 2VQEQ 4GOPA 4LFAL 3S1MH 1I6HH 1OXVA 1EIFA 3BU2A 4GLVB 1MIUA 2Q2HA 1LYLA 1EQRA 5JEAG 1PH2A 3PO3G 3EIVA 4OO1G 4DAMA 2NN6I 2Y0SG 3Q8DA 2QEXA 1H95A 5IP7G 1B70B 1I5FA 3M85A 2UU9Q 1K8AC 2IHEA 2E2HH 2UXBQ 3RR5A 2IHFA 5IWAQ 2OTLA 2I5LX 1KQSA 4MZ9A 4B3RQ 1C0AA 2AKWB 1E24A 1KHIA 1R9TH 3ULPA 4JI0Q 1CSPA 3TQYA 2WFWA 4KI0A 2GVBA 5IT9c 2AWOA 4GOPB 4EQ5A 1MJEA 1JMCA 2NVXH 3CCMA 1JJCB 1TWAH 3PGZA 4WJ4A 1YITA 4LF4Q 4L5RC 3GTLH 3KFUA 3NBHB 4QIWE 4DPGA 4JI2Q 1XMQL 1SE8A 2NZOA 3HOWG 2WB1E 3TS2A 1A63A 5JJKA 1B8AA 4P71A 4A3BH 3KDFB 3UDGA 3BJUA 4A3EH 4HIMA 4B3TQ 5C4XH 4P73A 5FLXc 2K14A 4XIGS 3UDIA 2E2IH 4NXMQ 4LF5Q 4BY7G 3M4OH 4NXNL 4DV0Q 1VQPA 1VQGA 3RN5A 4HJ9A 3S15H 2YYZA 2OWOA 2F4VQ 4P72A 1XTDA 4A3JH 4C3IH 1YJWA 2K52A 1X3GA 2GN5A 5H1SE 1MJCA 3CCJA 2UUCQ 2JA7G 4IPGA 3ERSX 1Q82C 1L1OB 3K7UC 4A3FH 4IJHA 2JK8A 2R7DA 1JB7A 3M3YH 4O0AA 4A93G 1AE2A 3GTQH 2R6GA 1A0IA 4GKKL 4A3MH 3J80c 1P16A 1JE5A 3RNUA 2WP8J 3M9BA 1CSQA 3U4VA 1XJVA 4B3SQ 5IP9G 3S1NH 3HKZE 3KF6B 3KF8B 1O7IA 3T1YQ 1HZ9A 1G291 4AQYL 1Q86C 2F3IA 1XNQL 2N49A 1PH5A 4LF6L 1VQOA 2XTIA 4DKAC 4P74A 1NY4A 1VQ7A 3PF5A 1OXTA 4LF4L 1WYDA 5IYCH 2ZTCA 3A0JA 3STBD 1N36L 4A3CH 4QY7A 4PZ6A 1SFOH 3H3VH 4A3GH 2K75A 1EFWA 3S2HH 2UU9L 3E0EA 5IWAL 4DV7Q 3F2BA 4DV3Q 1BBWA 1FJGQ 1WCMG 4KHPQ 2B63H 2Q2IA 3PUYA 4JI6Q 2I5MX 3KOJA 1YJ9A 3I4MH 4KLKA 3BZKA 2CWAA 4JBKA 1T9HA 2F4VL 1D8LA 3L2PA 1X56A 1XPOA 1SLJA 2JA5H 3CD6A 1NMGA 1GKHA 3HOZG 4HIDA 4RMFA 2B29A 4QL5A 4DV5L 2YTXA 1K9MC 5C44H 1Z9FA 2AMCB 3KDFA 4JI7Q 4DV2L 5FLMH 4BY1G 4JV5Q 4GKJL 2OQ0A 5DLQE 5M3MH 2QA4A 4OWTB 2YTYA 3GTKH 3CAMA 4C3JH 4GOPC 4TVAB 4DR4Q 3S1QH 3ULJA 4HIOA 3WWVA 4UP8A 5C0XJ 4HJ7A 4AQYQ 2JA6G 3KJPA 4Y7NH 2QGQA 4A3DH 2N3SA 1Q46A 3HOXH 3PO2H 1NTGA 3D0FA 3B6YA 5LMNQ 5AJ3L 4BXXH 1JT8A 1K0RA 5C3EG 2C35B 3HOVG 2VS1A 1TWCH 1QUQA 3PV0A 2DUDA 3W5OA 3T1HL 3S17H 1ASYA 3E9IA 1N33L 4A3LG 3GO5A 1B7YB 3HOYG 4GN3B 2UUAQ 4DAYB 1PH7A 1KRTA 5LMNW 2KENA 4DUYQ 2JA8H 1J5EQ 4DV7L 3CC7A 1BVSA 1HH2P 4BBRH 4X62L 4LFCL 1VQKA 3CC4A 4B3SL 4DK3C 1HNZL 2LXJA 1VQEA 4NPSA 2EQSA 1Q7YC 4K0KQ 1RL2A 1U0LA 1S72A 1YI2A 3H0GH 4JI4Q 4DV4L 5M5XH 5GAEC 2UUBQ 2MO0A 1OXXK 5LMUQ 4DR3L 3G71A 2NZHA 1IL2A 4DR7Q 3G6EA 4DV5Q 3NENA 3ULLA 4A3KH 3U50C 5HGQA 4OO1I 3TREA 1HNXL 2VW9A 4DV2Q 4LF8L 4GKJQ 2YTVA 4JV5L 1EWIA 4X64L 3KYHC 3GTJH 4DV3L 3F2DA 1FJGL 3M4QA 4DR1Q 2WAQG 2ZJPA 1PH4A 4HJAA 1PH8A 4YHHL 3PO3H 1X3FA 4GLXA 1UE6A 4JBMA 4HJ5A 1TWHH 1K83H 1X6OA 2L15A 5IP7H 4DV1Q 3LGJA 5FJ8G 2VQEL 4R1JA 3OTOL 4DR2L 1Q8KA 3JC66 3PUZA 4QQBX 3OW2A 2RF4A 1SMXA 3CPWA 4YY3L 4JC0A 4IFDG 1E1TA 4X65Q 1SN8A 1S40A 1BBUA 2IX0A 2ASBA 1VQCA 4DUYL 1VQAA 4AYBE 2ATWA 4LF9L 4X62Q 4LFBQ 4IPDA 2AHOB 4A3IH 3J7A5 4JI1L 2HHHL 4LF7Q 1YNXA 4LWCA 4PG3A 5IYBH 3GD7A 1PYBA 2BA1A 4GN4B 3F2CA 4DUZQ 3H15A 2GVAA 3I56A 2ZJRA 2R92H 2A19A 4JG2A 5JJIA 1XPUA 4APVA 3K0XA 3CF5A 3CCUA 3J81c 4POGA 1QZHA 1SR3A 1Y1WG 4YWKA 1N34L 1AE3A 1VQDA 4MTNA 1XNRQ 1JJ2A 5JJLA 2BH8A 3TS0A 4PZ8A 2D0OA 4DK6C 3IRBA 1YIJA 5ELNA 4WJ3M 1YVCA 2CFMA 1IBML 1L0WA 1GO3E 3FP9A 2CCZA 1BKBA 1N32L 1HNZQ 3PUWA 2UXBL 5HY6A 4YHHQ 1HR0W 1VQ6A 3OYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLA C;  1VQI A;  2DGY A;  4OWW B;  4DV1 L;  2UUB L;  4DR7 L;  1XMQ Q;  2Q2U A;  1J6Q A;  3RZO H;  1Y1V H;  4IO9 A;  1PVO A;  2E5L Q;  4JOI A;  1UE7 A;  2RHS B;  1PYS B;  2VL6 A;  4OXP A;  5M3F G;  1KIX A;  4O2D A;  2XGT A;  3MXN B;  3A74 A;  4POF A;  1C7Y A;  4OON A;  2VUM G;  2R7Z G;  3DLL A;  1E22 A;  1PH3 A;  3HOW H;  4B3M Q;  4PMW A;  1I94 Q;  1HR0 Q;  4A3B G;  2H5X A;  1G6P A;  1Q81 C;  4UP7 A;  4JI1 Q;  2PNH A;  3RLN A;  4A4I A;  4A3G G;  1I3Q H;  5M5W H;  2Y0S E;  4A3E G;  1PHJ A;  1OXS C;  1YEZ A;  3D31 A;  1VQN A;  1KAW A;  2HIV A;  4H02 A;  4Y52 H;  4HJ8 A;  1LUZ A;  1L1O C;  1UWV A;  2CQO A;  2K50 A;  2D0P A;  3I4M G;  1K3R A;  4J15 A;  4RG1 A;  4X65 L;  1QVF A;  2ID0 A;  2ALY B;  4DV6 L;  3VDY A;  4LW1 A;  2ZM6 L;  4A3F G;  4LNQ A;  5C4J H;  2RCN A;  1IBL Q;  3W1G A;  3T1Y L;  1VS0 A;  1QVG A;  4JI6 L;  1CKN A;  1E7Z A;  1CKO A;  3L0O A;  2MNA A;  1XMO L;  2PQA A;  3J7Z C;  2WB1 G;  2UXC Q;  1UE1 A;  4L5S A;  3JAM i;  4X66 Q;  1VQL A;  4DUZ L;  3CPF A;  2VQF Q;  3PCO B;  4YCU A;  5M3M G;  1IBK L;  1VCI A;  2JJQ A;  3UDF A;  4ALP A;  3NEL A;  1V43 A;  2KHJ A;  3EN2 A;  3CMA A;  1W3S A;  5IYD G;  1N34 Q;  2E5L L;  2ZTD A;  3I7F A;  2K5H A;  3UDX A;  3F8T A;  4JI5 L;  1W2B A;  2HT1 A;  1CKN B;  3HOU H;  1IBM Q;  5C0X I;  3HOX G;  3HKS A;  2IX1 A;  3PO2 G;  3PSI A;  2KHI A;  3STB C;  4DR4 L;  2LSS A;  1VQF A;  2ZJQ A;  1HNW Q;  1NJI C;  1SRU A;  1I94 L;  2EIF A;  4JBW A;  3U4Z A;  1G51 A;  1WI5 A;  2NVY H;  4L5Q A;  2N8N A;  2LXK A;  1SRO A;  4IJL A;  2A1A A;  3HOY H;  3W1B A;  3PF4 A;  1Q1E A;  1OTC A;  2JA8 G;  3S14 H;  2R93 H;  4UY8 C;  1PH9 A;  3BZC A;  2B63 G;  1PV4 A;  4A76 A;  4BA2 I;  3CQZ H;  2JEB I;  3FKI H;  4JBJ A;  1OXU A;  2HQL A;  4IPH A;  3CCQ A;  1QZG A;  2R7F A;  1VQ4 A;  4IFD J;  3CME A;  4R4I A;  3HOZ H;  1S3O A;  1CUK A;  2ZM6 Q;  4EX5 A;  4LFC Q;  4MNO A;  1GD7 A;  1HR0 L;  2D62 A;  2UXC L;  5FLM G;  1L1O A;  3CCS A;  3TEH B;  2I5H A;  4BBS H;  4K0K L;  2EXD A;  1PFS A;  4LFA Q;  4GNX B;  2E2J H;  3J81 i;  5AJ3 Q;  4A75 A;  3I4N H;  1WJJ A;  4JI4 L;  4X6A H;  2K5V A;  3CP0 A;  3AFQ A;  5GAH C;  2JA6 H;  4BY7 H;  1EIY B;  1A8V A;  3A5Z B;  4DNI A;  3CCL A;  3K7A H;  1A62 A;  4PZ7 A;  5JEA J;  3KF6 A;  3S16 H;  1N9W A;  4LUZ A;  5M5Y H;  3CW2 C;  2JA7 H;  2IT1 A;  4YWL A;  3RLO A;  5C3E H;  1TXY A;  4LF5 L;  1KL9 A;  1MKH A;  1XMO Q;  2B3G A;  3F1Z A;  1YZ6 A;  3AEV A;  4A3M G;  5EAY A;  4DR6 L;  2WAQ E;  4DV4 Q;  2UUC L;  4JI2 L;  1Q12 A;  3M7N A;  3AFP A;  3OTO Q;  1YBY A;  2FXQ A;  1X3E A;  3K80 C;  4A3I G;  3ZJY C;  4R4Q A;  1X54 A;  1HNX Q;  4LF8 Q;  3GTG H;  4GKK Q;  4JI5 Q;  1NE3 A;  3H0G G;  4TQU S;  1QUQ B;  3GTP H;  3G48 A;  5K36 G;  3ER0 A;  3J81 j;  1L2F A;  5J3B A;  3AYH B;  3CXC A;  4JYA L;  4IOC A;  1N8R C;  4A3K G;  1X65 A;  1PA6 A;  4A3C G;  3CCR A;  1FVI A;  2Z6K A;  2HIX A;  3S1R H;  2KCM A;  4LF7 L;  3I4O A;  3CCV A;  1HJP A;  4AYB G;  1V9P A;  3I2Z A;  5C4X G;  1KXL A;  3DM3 A;  3E9H A;  4HIK A;  1QVC A;  1WCM H;  1N36 Q;  2OTJ A;  2JE6 I;  4YY3 Q;  2NN6 G;  1VQ9 A;  2I0Q A;  4A3J G;  4DR5 Q;  1YHQ A;  1D7Q A;  3SGI A;  4YWM A;  3UE1 A;  1Y14 B;  1NBW A;  2ZTE A;  3L7Z C;  5GRO A;  1KD1 C;  3TRZ A;  2JA5 G;  4LF9 Q;  4LFB L;  1JJG A;  2YV5 A;  3CCE A;  1I50 H;  1WFQ A;  4ME3 A;  4A93 H;  4L5T A;  2PI2 E;  1KC8 C;  1Y1V G;  3GTM H;  3PIO A;  1XNQ Q;  3S2D H;  1IXR A;  2PI2 A;  5GQO A;  1VQH A;  5M3F H;  3EBE A;  4LUV A;  5E7N A;  4BA1 I;  2OQK A;  4BY1 H;  4GNX A;  3ICE A;  5ELO A;  5IP9 H;  1HZA A;  3PIP A;  4GNX C;  4IOA A;  2N78 A;  2R7Z H;  2VUM H;  1ASZ A;  4JI8 Q;  4P75 A;  2MQH A;  1DGS A;  5IYB G;  1XNR L;  1NMF A;  3MEF A;  4JI7 L;  2JA9 A;  3JAM c;  4GS3 A;  2Z0S A;  2NVT H;  2R92 G;  1M90 C;  1LM0 A;  1X55 A;  5IYC G;  3GTO H;  1K8G A;  4KHP L;  2CWP A;  1N32 Q;  5IY0 A;  1TWF H;  3HOV H;  1Z47 A;  2UXD L;  4C3H H;  1V1Q A;  3AQQ A;  2ES2 A;  1Q1B A;  4FDB A;  4QGU A;  4R4T A;  5BR8 Q;  4DR6 Q;  3RN2 A;  1XPR A;  4OX9 L;  1P8L A;  5LMN L;  1M1K C;  4JI3 Q;  4BBR G;  4C2M H;  1UEB A;  3A5U A;  4IPC A;  3T1H Q;  4XTC S;  3GDE A;  1EUJ A;  2V1C C;  5GAD C;  1N33 Q;  2MFI A;  2BA0 A;  3FHW A;  4JOI C;  4AIM A;  1E3P A;  1RIP A;  1YHA A;  3NEM A;  1J5E L;  1VQM A;  2MO1 A;  4NB3 A;  1VQ5 A;  4JYA Q;  4B3M L;  4B3R L;  2Q2T A;  5C44 G;  1IBL L;  2CKZ B;  1GM5 A;  4JI0 L;  1UE5 A;  2PQA B;  1EOV A;  5IYD H;  3H3V I;  4YCW A;  4X66 L;  2VQF L;  3K81 C;  3HOU G;  1C9O A;  1WOC A;  1CKM A;  3CC2 A;  1FL0 A;  3S24 A;  2IY5 B;  2KBN A;  5LMU L;  2K4K A;  1YJN A;  4UPA A;  4JI8 L;  4DR5 L;  5IE8 A;  2JEA I;  4DV6 Q;  1PH1 A;  2UUA L;  4A3D G;  4BXX G;  3PUX A;  3K8A A;  2VZA A;  3RZD H;  3PUV A;  1E1O A;  4YCV A;  4B3T L;  2R93 G;  2AWN A;  3J80 i;  5FJ8 H;  2KCT A;  4R4C A;  4DR1 L;  2VY3 A;  2E8G A;  1YHB A;  2BH2 A;  2OCE A;  4A3L H;  1KRS A;  4DV0 L;  2F52 A;  2UXD Q;  1HZC A;  3RLF A;  3FKI G;  2JQO A;  4AH6 A;  4QJF A;  1IZ6 A;  1IBK Q;  4DR3 Q;  2K5N A;  4DR2 Q;  3I55 A;  1VQB A;  4JI3 L;  1IYJ B;  1EYG A;  1EQQ A;  3HFZ B;  3U58 A;  4IFD I;  2PMZ E;  2A8V A;  3KJO A;  4LUO A;  1X9N A;  1PH6 A;  1AH9 A;  4X64 Q;  5GAG C;  4BBS G;  1U5K A;  4UP9 A;  2NVQ H;  4NXM L;  4GN5 A;  3M4P A;  3UE0 A;  4R4O A;  5C0X G;  1GVP A;  3G4S A;  1VQ8 A;  2YU9 H;  3I4N G;  1HZB A;  4NXN Q;  1K73 C;  1HNW L;  4JCV E;  2VNU D;  1LTL A;  2HHH Q;  1Y1W H;  3KLW A;  2Z6K C;  1VQJ A;  4KHZ A;  5BR8 L;  4LF6 Q;  1FGU A;  1TWG H;  2RHQ B;  4OWX B;  4OX9 Q;  3HKZ G;  2VQE Q;  4GOP A;  4LFA L;  3S1M H;  1I6H H;  1OXV A;  1EIF A;  3BU2 A;  4GLV B;  1MIU A;  2Q2H A;  1LYL A;  1EQR A;  5JEA G;  1PH2 A;  3PO3 G;  3EIV A;  4OO1 G;  4DAM A;  2NN6 I;  2Y0S G;  3Q8D A;  2QEX A;  1H95 A;  5IP7 G;  1B70 B;  1I5F A;  3M85 A;  2UU9 Q;  1K8A C;  2IHE A;  2E2H H;  2UXB Q;  3RR5 A;  2IHF A;  5IWA Q;  2OTL A;  2I5L X;  1KQS A;  4MZ9 A;  4B3R Q;  1C0A A;  2AKW B;  1E24 A;  1KHI A;  1R9T H;  3ULP A;  4JI0 Q;  1CSP A;  3TQY A;  2WFW A;  4KI0 A;  2GVB A;  5IT9 c;  2AWO A;  4GOP B;  4EQ5 A;  1MJE A;  1JMC A;  2NVX H;  3CCM A;  1JJC B;  1TWA H;  3PGZ A;  4WJ4 A;  1YIT A;  4LF4 Q;  4L5R C;  3GTL H;  3KFU A;  3NBH B;  4QIW E;  4DPG A;  4JI2 Q;  1XMQ L;  1SE8 A;  2NZO A;  3HOW G;  2WB1 E;  3TS2 A;  1A63 A;  5JJK A;  1B8A A;  4P71 A;  4A3B H;  3KDF B;  3UDG A;  3BJU A;  4A3E H;  4HIM A;  4B3T Q;  5C4X H;  4P73 A;  5FLX c;  2K14 A;  4XIG S;  3UDI A;  2E2I H;  4NXM Q;  4LF5 Q;  4BY7 G;  3M4O H;  4NXN L;  4DV0 Q;  1VQP A;  1VQG A;  3RN5 A;  4HJ9 A;  3S15 H;  2YYZ A;  2OWO A;  2F4V Q;  4P72 A;  1XTD A;  4A3J H;  4C3I H;  1YJW A;  2K52 A;  1X3G A;  2GN5 A;  5H1S E;  1MJC A;  3CCJ A;  2UUC Q;  2JA7 G;  4IPG A;  3ERS X;  1Q82 C;  1L1O B;  3K7U C;  4A3F H;  4IJH A;  2JK8 A;  2R7D A;  1JB7 A;  3M3Y H;  4O0A A;  4A93 G;  1AE2 A;  3GTQ H;  2R6G A;  1A0I A;  4GKK L;  4A3M H;  3J80 c;  1P16 A;  1JE5 A;  3RNU A;  2WP8 J;  3M9B A;  1CSQ A;  3U4V A;  1XJV A;  4B3S Q;  5IP9 G;  3S1N H;  3HKZ E;  3KF6 B;  3KF8 B;  1O7I A;  3T1Y Q;  1HZ9 A;  1G29 1;  4AQY L;  1Q86 C;  2F3I A;  1XNQ L;  2N49 A;  1PH5 A;  4LF6 L;  1VQO A;  2XTI A;  4DKA C;  4P74 A;  1NY4 A;  1VQ7 A;  3PF5 A;  1OXT A;  4LF4 L;  1WYD A;  5IYC H;  2ZTC A;  3A0J A;  3STB D;  1N36 L;  4A3C H;  4QY7 A;  4PZ6 A;  1SFO H;  3H3V H;  4A3G H;  2K75 A;  1EFW A;  3S2H H;  2UU9 L;  3E0E A;  5IWA L;  4DV7 Q;  3F2B A;  4DV3 Q;  1BBW A;  1FJG Q;  1WCM G;  4KHP Q;  2B63 H;  2Q2I A;  3PUY A;  4JI6 Q;  2I5M X;  3KOJ A;  1YJ9 A;  3I4M H;  4KLK A;  3BZK A;  2CWA A;  4JBK A;  1T9H A;  2F4V L;  1D8L A;  3L2P A;  1X56 A;  1XPO A;  1SLJ A;  2JA5 H;  3CD6 A;  1NMG A;  1GKH A;  3HOZ G;  4HID A;  4RMF A;  2B29 A;  4QL5 A;  4DV5 L;  2YTX A;  1K9M C;  5C44 H;  1Z9F A;  2AMC B;  3KDF A;  4JI7 Q;  4DV2 L;  5FLM H;  4BY1 G;  4JV5 Q;  4GKJ L;  2OQ0 A;  5DLQ E;  5M3M H;  2QA4 A;  4OWT B;  2YTY A;  3GTK H;  3CAM A;  4C3J H;  4GOP C;  4TVA B;  4DR4 Q;  3S1Q H;  3ULJ A;  4HIO A;  3WWV A;  4UP8 A;  5C0X J;  4HJ7 A;  4AQY Q;  2JA6 G;  3KJP A;  4Y7N H;  2QGQ A;  4A3D H;  2N3S A;  1Q46 A;  3HOX H;  3PO2 H;  1NTG A;  3D0F A;  3B6Y A;  5LMN Q;  5AJ3 L;  4BXX H;  1JT8 A;  1K0R A;  5C3E G;  2C35 B;  3HOV G;  2VS1 A;  1TWC H;  1QUQ A;  3PV0 A;  2DUD A;  3W5O A;  3T1H L;  3S17 H;  1ASY A;  3E9I A;  1N33 L;  4A3L G;  3GO5 A;  1B7Y B;  3HOY G;  4GN3 B;  2UUA Q;  4DAY B;  1PH7 A;  1KRT A;  5LMN W;  2KEN A;  4DUY Q;  2JA8 H;  1J5E Q;  4DV7 L;  3CC7 A;  1BVS A;  1HH2 P;  4BBR H;  4X62 L;  4LFC L;  1VQK A;  3CC4 A;  4B3S L;  4DK3 C;  1HNZ L;  2LXJ A;  1VQE A;  4NPS A;  2EQS A;  1Q7Y C;  4K0K Q;  1RL2 A;  1U0L A;  1S72 A;  1YI2 A;  3H0G H;  4JI4 Q;  4DV4 L;  5M5X H;  5GAE C;  2UUB Q;  2MO0 A;  1OXX K;  5LMU Q;  4DR3 L;  3G71 A;  2NZH A;  1IL2 A;  4DR7 Q;  3G6E A;  4DV5 Q;  3NEN A;  3ULL A;  4A3K H;  3U50 C;  5HGQ A;  4OO1 I;  3TRE A;  1HNX L;  2VW9 A;  4DV2 Q;  4LF8 L;  4GKJ Q;  2YTV A;  4JV5 L;  1EWI A;  4X64 L;  3KYH C;  3GTJ H;  4DV3 L;  3F2D A;  1FJG L;  3M4Q A;  4DR1 Q;  2WAQ G;  2ZJP A;  1PH4 A;  4HJA A;  1PH8 A;  4YHH L;  3PO3 H;  1X3F A;  4GLX A;  1UE6 A;  4JBM A;  4HJ5 A;  1TWH H;  1K83 H;  1X6O A;  2L15 A;  5IP7 H;  4DV1 Q;  3LGJ A;  5FJ8 G;  2VQE L;  4R1J A;  3OTO L;  4DR2 L;  1Q8K A;  3JC6 6;  3PUZ A;  4QQB X;  3OW2 A;  2RF4 A;  1SMX A;  3CPW A;  4YY3 L;  4JC0 A;  4IFD G;  1E1T A;  4X65 Q;  1SN8 A;  1S40 A;  1BBU A;  2IX0 A;  2ASB A;  1VQC A;  4DUY L;  1VQA A;  4AYB E;  2ATW A;  4LF9 L;  4X62 Q;  4LFB Q;  4IPD A;  2AHO B;  4A3I H;  3J7A 5;  4JI1 L;  2HHH L;  4LF7 Q;  1YNX A;  4LWC A;  4PG3 A;  5IYB H;  3GD7 A;  1PYB A;  2BA1 A;  4GN4 B;  3F2C A;  4DUZ Q;  3H15 A;  2GVA A;  3I56 A;  2ZJR A;  2R92 H;  2A19 A;  4JG2 A;  5JJI A;  1XPU A;  4APV A;  3K0X A;  3CF5 A;  3CCU A;  3J81 c;  4POG A;  1QZH A;  1SR3 A;  1Y1W G;  4YWK A;  1N34 L;  1AE3 A;  1VQD A;  4MTN A;  1XNR Q;  1JJ2 A;  5JJL A;  2BH8 A;  3TS0 A;  4PZ8 A;  2D0O A;  4DK6 C;  3IRB A;  1YIJ A;  5ELN A;  4WJ3 M;  1YVC A;  2CFM A;  1IBM L;  1L0W A;  1GO3 E;  3FP9 A;  2CCZ A;  1BKB A;  1N32 L;  1HNZ Q;  3PUW A;  2UXB L;  5HY6 A;  4YHH Q;  1HR0 W;  1VQ6 A;  3OYY A; 
#chains in the Genus database with same CATH topology
 2EOT A;  3GQB A;  1VQI A;  2Z6B A;  1TQO A;  4K8J A;  2Q2U A;  3R8B A;  3ITP A;  1KAB A;  4MIU A;  4IO9 A;  4A3E B;  1STN A;  4JOI A;  1UE7 A;  2RHS B;  3H09 A;  2VL6 A;  5M3F G;  3OMC A;  1QJO A;  4M8A A;  5KYI A;  4OON A;  1E22 A;  1PH3 A;  1EY9 A;  1G6P A;  2HDL A;  2H5X A;  4JI1 Q;  3RLN A;  4A4I A;  5M5W B;  1WD0 A;  4DK0 A;  4GZY C;  1VQN A;  3OSO A;  5G3L D;  1EZ6 A;  2WB1 B;  2CQO A;  2D0P A;  1QVF A;  3A7L A;  1LTA D;  2ALY B;  1D1I A;  4DV6 L;  4LW1 A;  1KDA A;  5ISR A;  3HZX A;  2B2T A;  4CHT B;  1IBL Q;  1QVG A;  1XMO L;  2PQA A;  2EE1 A;  3JAM i;  1I4R A;  2J7Z A;  1VQL A;  5CV4 A;  4DA2 A;  2VQF Q;  1DON A;  5COR A;  3PCO B;  3IKJ A;  2PNR C;  3M4O B;  4EVO A;  2JJQ A;  5BN3 A;  1DJR D;  3A54 A;  3EN2 A;  2QKI C;  5IYD G;  3S2H B;  3I7F A;  1GUW A;  3HOX G;  2VUM B;  1VQF A;  4MHE A;  2G9D A;  4JBW A;  4OO1 H;  4L5Q A;  2NVY H;  2Y0S B;  2LXK A;  3HOY H;  3W1B A;  1LV9 A;  2O2L D;  4A76 A;  3CQZ H;  1CHQ D;  2JEB I;  2FMC A;  1QZG A;  2R7F A;  3HOX B;  3CQZ B;  2B2V A;  4IFD J;  2MJ8 A;  4LFC Q;  1RTO A;  2D62 A;  4ZCK A;  3QOL A;  1L1O A;  1Y69 U;  1F2L A;  3CCS A;  4Y7N B;  1EQV A;  2F0I A;  3S1R B;  4GNX B;  2E2J H;  1PZI D;  4DU9 A;  3J81 i;  3NHH A;  3CP0 A;  4JVZ A;  3CCL A;  1SAP A;  5JEA J;  1KTK A;  3MC0 B;  4LUZ A;  2JA7 H;  1AEX A;  4LF5 L;  2RCF A;  1YZ6 A;  2F0T A;  4DR6 L;  2WAQ E;  2H4O A;  1HQM C;  2EY6 A;  1YBY A;  5KND A;  5CV6 A;  1X3E A;  1YNJ D;  2XN9 C;  1B3Q A;  5FO9 B;  1YNN C;  3GTG B;  1X54 A;  4LF8 Q;  1NE3 A;  4TQU S;  4ILW A;  1QUQ B;  1PFB A;  4RKL A;  2JA6 B;  3J81 j;  1GUO A;  1TWH B;  4JYA L;  3I70 A;  3VYU A;  1PRT F;  1SYF A;  5JAV A;  1PA6 A;  5TSS A;  1FVI A;  3CCR A;  5KIX A;  4A3C G;  1TWF B;  2KCM A;  4JW0 A;  4K6D A;  3QR8 A;  4CDE C;  1QB5 D;  1EYA A;  4RHR A;  2WIN B;  3DM3 A;  3E9H A;  3K6O A;  4CKE A;  5CR3 A;  1WCM H;  1PDQ A;  2EJM A;  2JE6 I;  4YY3 Q;  1VQ9 A;  2I0Q A;  4DR5 Q;  1D7Q A;  3UE1 A;  5JJZ A;  1Y14 B;  1NBW A;  2ZTE A;  3LNN A;  4LMQ D;  4C3I B;  4LFB L;  2YV5 A;  2DNE A;  2EZV A;  3S15 B;  4L5T A;  4KKS A;  2PI2 E;  2R92 B;  3T4A C;  4DAP A;  2AQ1 B;  5E7N A;  2OQK A;  4GNX A;  5IP9 H;  3FPU B;  3PIP A;  2N78 A;  2R7Z H;  4JI8 Q;  2MQH A;  5ELC A;  4JI7 L;  2JA9 A;  4GS3 A;  1NUC A;  1HPC A;  1RD9 D;  3SHL A;  1T5X D;  3QO2 A;  5IYC G;  1KDC A;  1SE3 A;  4ULL A;  2CVR A;  2K32 A;  3ONA B;  5M5X B;  3GTL B;  2O4X A;  3AQQ A;  2G9H D;  3A5U A;  3BVG A;  1EUJ A;  2Z4H A;  1N33 Q;  1D6E C;  3CU7 A;  2KA7 A;  1PFM A;  1GXD C;  3A8I E;  2JA5 B;  1VQM A;  1VQ5 A;  2IW3 A;  1IBL L;  1JWS D;  1UE5 A;  2DNC A;  1X3P A;  3GTO B;  5I6W A;  2VQF L;  1MSG A;  1C9O A;  1VF5 C;  5M3M B;  2NUC A;  5IE8 A;  4K5W A;  1KDB A;  3FKI B;  4DV6 Q;  1PH1 A;  2UUA L;  3K8A A;  3D3R A;  4YCV A;  1TS4 A;  2AWN A;  3J80 i;  2KCT A;  4OIJ A;  2F0D A;  5IGC A;  3HP3 A;  4G4K A;  1FR3 A;  2ZXO A;  4HMJ A;  5E1F A;  4DR2 Q;  4BBR B;  3DXJ C;  2PMZ B;  3U58 A;  2A5H A;  4F87 A;  2PMZ E;  2NTT A;  3K59 A;  1PH6 A;  1AH9 A;  2JYO A;  5GAG C;  4BBS G;  4UP9 A;  1O78 A;  4UAI A;  1GVP A;  1Y8N B;  1LTL A;  1Y1W H;  2X6L A;  2X69 A;  3KLW A;  1VQJ A;  3R93 A;  2VQE Q;  2I07 B;  2D2C C;  5EPK A;  3BU2 A;  4GLV B;  1MIU A;  2Q2H A;  5JEA G;  1EQR A;  1PH2 A;  3PO3 G;  3EIV A;  5IOC A;  2NN6 I;  2Y0S G;  1HFG A;  1H95 A;  1Y8O B;  1B70 B;  2UU9 Q;  3E5S A;  2IHF A;  4JPB W;  5IWA Q;  4XYQ A;  1ET9 A;  1KQS A;  4KY5 A;  4MZ9 A;  4B3R Q;  2AKW B;  1R9T H;  1C4Q A;  3TQY A;  2EYF A;  1MJE A;  1C8C A;  1SYB A;  4WJ4 A;  1SBB B;  4I65 A;  3KFU A;  3NBH B;  4QIW E;  1CA6 A;  1SE8 A;  1A3U A;  1X3Q A;  3BVZ A;  1A63 A;  1B8A A;  1RKN A;  3QWN A;  4A3B H;  3KDF B;  1WCM B;  3N6R A;  3BJU A;  2L5T A;  4A3B B;  5C4X H;  2CHB D;  4P73 A;  2E2I H;  1JR0 D;  4LF5 Q;  3U9O A;  2TMP A;  1VQP A;  3RN5 A;  4HJ9 A;  1F2M A;  3S15 H;  1H9R A;  1XTD A;  2J0T D;  3HOW B;  2CH4 W;  2K52 A;  1MJC A;  1Q82 C;  1L1O B;  4A3F H;  1O7Z A;  1STE A;  1WTQ A;  4ZYS A;  1D5X C;  2NVT B;  1LTT D;  1WTH A;  5HUR A;  3KLR A;  2ENB A;  1CZG A;  2SNS A;  3Q23 A;  1XJV A;  4CJ1 B;  3S1N H;  1Q86 C;  3A55 A;  1CQV A;  3MXU A;  4K5X A;  3TP8 A;  1PH5 A;  4DKA C;  1B53 A;  4C3H B;  1JQY D;  3TBI B;  1OXT A;  4LF4 L;  2AQ2 B;  2ZXP A;  2ZTC A;  3A0J A;  1EY5 A;  4C3J B;  3EJI A;  4ZKB B;  4IZ8 A;  3S2H H;  1W6J A;  2I46 A;  1FJG Q;  1YNJ C;  3PUY A;  3I90 A;  1EIG A;  1BCP F;  4HSV A;  2CWA A;  4C1N I;  1T9H A;  2F4V L;  1D8L A;  5M9O A;  2LKV A;  1X56 A;  1SLJ A;  4IUR A;  5FOB B;  1NMG A;  4EQO A;  2YU9 B;  2Q8R E;  4H7B A;  4DV5 L;  3ERO A;  3KDF A;  4JI7 Q;  4BY1 G;  4JV5 Q;  4GKJ L;  5M3M H;  2QA4 A;  4H0L C;  3CAM A;  4C3J H;  4GOP C;  4TVA B;  3KK7 A;  1IKL A;  3H91 A;  4RGT A;  4J6H A;  4IN3 A;  3D6C A;  2N3S A;  1Q46 A;  3PIP 3;  3HOX H;  2QIL A;  5AJ3 L;  3K5O A;  5C3E G;  2VS1 A;  3W5O A;  3D4W A;  2KEE A;  1N33 L;  4RFB A;  1QWY A;  1D1K A;  4A3L G;  2F0W A;  3VYR A;  2UUA Q;  2KHS A;  5LMN W;  1Q3L A;  1U4L A;  3MHB A;  3CC4 A;  4DK3 C;  5JVH 3;  1HNZ L;  1SJE D;  3OIP A;  3FEW X;  3I4L A;  4NPS A;  1S72 A;  1YI2 A;  3W3A A;  5E4X A;  4JI4 Q;  2UUB Q;  1OXX K;  1IW7 D;  2V4D A;  4KKT A;  3U50 C;  2EYP A;  2PQE A;  3J7A V;  2YTV A;  1BQQ T;  5C5L A;  1Q8I A;  3FVQ A;  3R2I A;  2C9O A;  2ZJP A;  5C4Z A;  2A6E C;  2QW7 A;  4GLX A;  3NSW A;  1EU3 A;  1X6O A;  1ESF A;  3PQI A;  3LGJ A;  5FO7 B;  2VQE L;  4DR2 L;  1GOZ A;  3BG3 A;  2PPB C;  1ILQ A;  3CPW A;  2FHT A;  1GHJ A;  1BBU A;  1EWH A;  2ZXR A;  1VQC A;  2QF7 A;  4AYB E;  1H9K A;  4LF9 L;  2ATW A;  1CFM A;  1VMP A;  4A3I H;  3MFY A;  3J7A 5;  4PG3 A;  1PYB A;  4GN4 B;  4DUZ Q;  5JJI A;  1XPU A;  1K8M A;  3VR5 A;  3J81 c;  4A3K B;  4POG A;  2E75 C;  1N34 L;  4FO2 A;  1XNR Q;  1JJ2 A;  1F2Z A;  4FXG C;  4PZ8 A;  1I4H A;  5ELN A;  5C6A A;  2NTS A;  3FP9 A;  1TVX A;  1N32 L;  3BYY B;  4ZLT F;  2UXB L;  5HY6 A;  4XQJ A;  1LO5 D;  4YHH Q;  1VQ6 A;  1CZW A;  4GLA C;  3MTS A;  4K14 A;  3MAQ A;  2DGY A;  2K04 A;  4DR7 L;  1G2T A;  1DCZ A;  4O42 A;  4XT3 B;  3RZO H;  1PVO A;  2E5L Q;  4J8Q A;  1PYS B;  3MWY W;  5ELE A;  2PZW A;  1ZKO A;  2N88 A;  3A74 A;  4QUF A;  3SDZ A;  4G7O C;  2VUM G;  1SNQ A;  1TT2 A;  3HOW H;  1EFI D;  1I94 Q;  4DN4 M;  1Q81 C;  1KAA A;  1I3Q H;  1SDF A;  2A69 C;  2B8G A;  2Y0S E;  4A3E G;  1OXS C;  1YEZ A;  3D31 A;  2HD3 A;  2HIV A;  3LWU A;  1I6V C;  1CHP D;  1XWE A;  3T16 A;  4Y52 H;  5EPL A;  4RCN A;  1EU4 A;  2XWB B;  3I4M G;  1K3R A;  4J15 A;  4X65 L;  1II3 A;  2ZM6 L;  2RCN A;  1IYV A;  4HTH A;  3OMG A;  2K5D A;  4HAE A;  2H1E A;  1CKN A;  1ESR A;  3V2T A;  3PMF A;  2WB1 G;  5EKK A;  1B9N A;  4ID6 A;  1ENA A;  3CPF A;  3VR3 A;  1G91 A;  1K0S A;  1IBK L;  3OIQ A;  1I4X A;  4CJ2 C;  3IAY A;  2KHJ A;  2HUG A;  3N52 A;  3UDX A;  2OT2 A;  2EY2 A;  4JI5 L;  1S5D D;  1Z7T A;  1IBM Q;  5C0X I;  4WJW A;  3PSI A;  2KHI A;  2R7Z B;  2LSS A;  2RBM A;  1HHV A;  3BDO A;  3S14 B;  3U4Z A;  1G51 A;  3NQT A;  2A1A A;  3S14 H;  1Q1E A;  4A3I B;  2JA8 G;  1BOS A;  4UY8 C;  4Q0F A;  3BZC A;  3VR2 A;  2B63 G;  2LMC B;  3HEJ A;  4JBJ A;  1OXU A;  4IPH A;  5CV5 A;  3DMU A;  1M4V A;  5EBC A;  4N9T A;  3CME A;  3HOZ H;  2L1B A;  2EY5 A;  4EX5 A;  5DEH A;  5C3W A;  2KJX A;  3FRP B;  5A2Q L;  2P5Z X;  3K58 A;  2UXC L;  5FLM G;  3TEH B;  4B08 A;  3CHB D;  2EXD A;  5AJ3 Q;  1WD1 A;  1WJJ A;  3BDC A;  4JI4 L;  2K5V A;  2K5Q A;  4DNT B;  3S16 B;  3NTH A;  2B2Y C;  3I72 A;  1RTN A;  1A8V A;  3A5Z B;  3QG1 A;  3BYT B;  1A62 A;  3SK6 A;  1TII D;  2NB0 A;  4Z9C B;  5JPN C;  1MKH A;  1XMO Q;  4N8F A;  4KY6 A;  1UNS A;  2K03 A;  4ME5 A;  1G8Z D;  4IFD H;  4KJN A;  4A3M G;  2F0J A;  2EJF C;  4JI2 L;  3AFP A;  3J80 L;  2FXQ A;  2KCC A;  4C1N K;  1JIC A;  4CKC A;  3GTG H;  2F0V A;  4GKK Q;  3H0G G;  2PO4 A;  3GTP H;  1TWC B;  5K36 G;  3ER0 A;  1U4P A;  3CXC A;  5J3B A;  1V8Q A;  1B44 D;  4IOC A;  1N8R C;  4A3K G;  1X65 A;  1O7Y A;  2HIX A;  3S1R H;  3I4O A;  3CCV A;  1LT5 D;  2XRQ D;  4G57 A;  1Y8P B;  4QF4 A;  4HIK A;  5AFW A;  1N36 Q;  2EPB A;  2OTJ A;  3VR4 A;  4A3J G;  3SGI A;  1RDP D;  2TSS A;  2JA5 G;  4LF9 Q;  5ELB A;  1JJG A;  2AQ3 B;  1I50 H;  1WFQ A;  3C1F A;  5C3X A;  4B9X A;  1KC8 C;  3TN2 A;  1Y1V G;  5LL6 X;  3GTM H;  3AB9 A;  3K5N A;  2PI2 A;  1LTI D;  4QCL A;  3EBE A;  4S3S A;  4LUV A;  4XDX A;  1S5E D;  3I4M B;  1HZA A;  4GNX C;  1WTP A;  5FLX L;  1UEA B;  1ASZ A;  4OHJ A;  5D3D A;  5IYB G;  1XNR L;  5D3I B;  2R92 G;  3GTQ B;  2Z0S A;  1NR4 A;  4DF7 A;  2JN4 A;  3NUC A;  1K8G A;  1LT6 D;  3TP7 A;  4FYD A;  1N32 Q;  1TWF H;  1F9R A;  1Z47 A;  4C3H H;  4KK7 A;  4FDB A;  3RUZ A;  5BR8 Q;  2BE5 C;  5I9P A;  4DR6 Q;  2JP1 A;  2CW0 C;  4OIK A;  4L63 B;  1P8L A;  4OX9 L;  5LMN L;  3E6Z X;  1TY0 A;  4K5V A;  1SMY C;  4BBR G;  1UEB A;  1M1K C;  4JI3 Q;  3T1H Q;  2A6H C;  1EY4 A;  2MFI A;  1HXY D;  1RF2 D;  1QNK A;  4JOI C;  1JWM D;  4AIM A;  5FO8 B;  1J5E L;  2MO1 A;  1I3Q B;  2QDL A;  4NB3 A;  1PTO H;  4JYA Q;  2Q2T A;  4RH6 A;  4DAV A;  4JI0 L;  1STA A;  5KNC A;  2PQA B;  3H3V I;  4YCW A;  3HOU G;  3NPP A;  2IY5 B;  1FL0 A;  1DOK A;  5LMU L;  2R61 A;  2K4K A;  4K2K A;  1YJN A;  2OF1 A;  1EYD A;  4DR5 L;  2JEA I;  1FD7 D;  2HCI A;  1EY0 A;  1BNZ A;  2VZA A;  4CKB A;  1E1O A;  4B3T L;  2R93 G;  5FJ8 H;  3RD4 A;  3HGB A;  4R4C A;  2VY3 A;  3WDN A;  1KRS A;  2UXD Q;  1ZYR D;  1HZC A;  3RLF A;  1QG7 A;  2WV6 D;  3D4R A;  2JQO A;  4AH6 A;  1IZ6 A;  1IBK Q;  1LAC A;  4DR3 Q;  3HKZ B;  1VQB A;  1EYG A;  1CM9 A;  2VXW A;  3IFT A;  2RKS A;  2A8V A;  4BS9 A;  3TZU A;  3VYS A;  1WVL A;  1U5K A;  2NVQ H;  4GN5 A;  3G4S A;  4R4O A;  2YU9 H;  3I4N G;  4XQN A;  1HZB A;  4JCV E;  5I9O A;  5ELF A;  2HHH Q;  1VDZ A;  3H94 A;  2EXZ A;  4K6L A;  4OWX B;  3HKZ G;  5CYU A;  4GOP A;  1OXV A;  1EIF A;  3H6M A;  3TME A;  1PZJ D;  1DZ1 A;  2F0L A;  4OO1 G;  4DAM A;  3Q8D A;  1SYG A;  4IUN A;  3T56 B;  2E2H H;  1EYC A;  2OTL A;  4NMZ A;  1E24 A;  1KHI A;  2J4X A;  2WFW A;  2GVB A;  2NVX H;  4EQ5 A;  4CBV A;  3CCM A;  1TWA H;  3PGZ A;  4L5R C;  3GTL H;  2RQX A;  4CGY B;  4JI2 Q;  2NZO A;  3TS2 A;  5CC4 A;  5EGT A;  5JJK A;  4P71 A;  3SXH A;  3KBG A;  3UDG A;  4FXD A;  2F0E A;  1NAP A;  1TWG B;  4NXM Q;  3UI2 A;  1ML0 D;  3P7J A;  3S2D B;  4BY7 G;  4NXN L;  3MZ5 A;  5DAU A;  1VQG A;  2PCF B;  3SE0 A;  5KGU A;  3E0J A;  3DHQ A;  2GN5 A;  1S4Z A;  3CCJ A;  1NR2 A;  1GJX A;  4FF3 A;  3K7U C;  2JK8 A;  1JB7 A;  3M3Y B;  2KQ3 A;  4O0A A;  1DXM A;  4A93 G;  1AE2 A;  1ZXT A;  1A0I A;  4GKK L;  3R2T A;  1ONL A;  3MXN A;  2A73 B;  4R8N A;  1CSQ A;  3ZYY X;  4B3S Q;  3HKZ E;  1O7I A;  3T1Y Q;  1HZ9 A;  4AQY L;  1IL8 A;  1BXT A;  2F3I A;  2N49 A;  2XTI A;  2K7V A;  1NY4 A;  2K33 A;  1VQ7 A;  2K05 A;  1N36 L;  3RMH A;  3STB D;  1STY A;  4QY7 A;  3OPO A;  1SFO H;  4A3G B;  2SNM A;  1HUN A;  1HTP A;  5J39 A;  3J80 E;  2UU9 L;  1EY7 A;  3KF8 A;  1SNP A;  3NE5 B;  1EEI D;  1IHZ A;  5COY A;  5IWA L;  4DV7 Q;  4DV3 Q;  1BBW A;  2KVM A;  3SK4 A;  4CJ0 B;  2I5M X;  1YJ9 A;  1SE4 A;  3SEB A;  1PYW D;  3L2P A;  1R4Q B;  1JB3 A;  2MHV A;  4F8M A;  2O5I C;  1PLF A;  4EGV A;  3Q24 A;  2YTX A;  1K9M C;  5C44 H;  1B9M A;  5CV7 A;  1Z9F A;  4DV2 L;  1SJH D;  2OQ0 A;  5DLQ E;  5C44 B;  3GTK H;  4X3K A;  1SYE A;  1LTR D;  4DR4 Q;  1A2T A;  3A7A B;  3ULJ A;  5E3F A;  4UP8 A;  3WWV A;  5C0X J;  2JA6 G;  3AU7 A;  2QGQ A;  2SEB D;  1SND A;  1KLG D;  4A3D H;  4FF2 A;  5LMN Q;  4BXX H;  1K0R A;  4N9P A;  1AN8 A;  2C35 B;  2E76 C;  3T1H L;  2JA8 B;  1ASY A;  1RCV D;  3PIO 3;  3GO5 A;  3HOY G;  4DAY B;  1PH7 A;  2JA8 H;  2KEN A;  2KEC A;  3K0Y A;  4DUY Q;  1J5E Q;  4X62 L;  1PFN A;  4FVM A;  1A3V A;  1DYQ A;  5C3E B;  4K0K Q;  1PRT B;  2DY7 A;  4DV4 L;  1PTO D;  1Q90 A;  5GAE C;  4DR3 L;  5LMU Q;  1IL2 A;  3G71 A;  3HOZ B;  3G6E A;  3NEN A;  3ULL A;  5HGQ A;  5KRU A;  4OO1 I;  3TRE A;  5CGK A;  1EWI A;  1FJG L;  2WAQ G;  1SYD A;  4HJA A;  4BBS B;  1JCK B;  1K83 H;  5IP7 H;  2L15 A;  1PRT C;  4R1J A;  3JC6 6;  3PUZ A;  1SMX A;  4QMG A;  4KKU A;  4IFD G;  4JC0 A;  1E1T A;  1JC7 A;  4BY7 B;  3H3V C;  2Q8I B;  4KD4 A;  4IPD A;  2AHO B;  1NNX A;  4JI1 L;  2HHH L;  4M1U B;  4LWC A;  1YNX A;  1V1P B;  2Z1C A;  3GD7 A;  1WTR A;  2L0C A;  1ENF A;  1MHW C;  2Z4I A;  3EFX D;  2ZJR A;  2DN8 A;  3NBH A;  1YNN D;  2EYJ A;  2XRS D;  3P1H A;  1HTL D;  4NDX A;  1QZH A;  1SR3 A;  1Y1W G;  1O7L A;  3TSS A;  1AE3 A;  3CKI B;  4MTN A;  5JJL A;  2BH8 A;  4NKL A;  3IRB A;  4C3I G;  4WJ3 M;  1YVC A;  1L0W A;  1HNZ Q;  3PUW A;  1SEB D;  1QOH A;  1HR0 W;  1F9S A;  4TKO B;  4OWW B;  1EEF D;  5I2Y A;  5T1G A;  4DV1 L;  2UUB L;  4TRD A;  5CV9 A;  1J6Q A;  1JWU D;  5IOD A;  1KIX A;  4O2D A;  1J8I A;  1BCP B;  1C7Y A;  4N8X 1;  2R7Z G;  3DLL A;  4B3M Q;  4PMW A;  1HR0 Q;  4A3B G;  5M3F B;  4A3G G;  2K6A A;  5M5W H;  3GTP B;  1KAW A;  5CV8 A;  1Z6H A;  5KYL A;  5I2X A;  4H02 A;  2O5J C;  5IGB A;  4HJ8 A;  1UWV A;  2K50 A;  1SE2 A;  4RG1 A;  1CA5 A;  2AUK A;  4TSS A;  4WRD A;  3L3O C;  4A3F G;  4LNQ A;  5C4J H;  3FMC A;  3T1Y L;  2LY7 A;  4XXE A;  2ICE C;  4X66 Q;  4DUZ L;  1HRJ A;  1VCI A;  4ALP A;  3NEL A;  3CMA A;  2F3V A;  1BUV T;  1W3S A;  1N34 Q;  4FF1 A;  3NWT A;  2K5H A;  3F8T A;  2FIN B;  3PO2 G;  3HKS A;  2IX1 A;  3STB C;  4DR4 L;  2ZJQ A;  2M9V A;  2R93 B;  1WI5 A;  4XT1 B;  4IAL A;  2R93 H;  1OTC A;  2B2V C;  5I4D A;  1PV4 A;  3CCQ A;  1PZK D;  1VQ4 A;  3PO2 B;  1CUK A;  1S5B D;  3EQL C;  4MNO A;  2F1M A;  1CT1 D;  3P75 A;  3V96 A;  2PW5 A;  4BBS H;  2ZT9 C;  1LTG D;  4X3S A;  4A75 A;  3I4N H;  4X6A H;  3AFQ A;  2G5D A;  5GAH C;  3S17 B;  1E0B A;  2XIW A;  4DNI A;  3K7A H;  3S16 H;  4PZ7 A;  3KF6 A;  1L0Y B;  2HQE A;  3CW2 C;  1A2U A;  2DJF C;  4YWL A;  5C3E H;  4H44 C;  2PZU A;  4KMU C;  2NZ1 D;  1KL9 A;  1L0X B;  1XYI A;  1TS5 A;  3ND8 A;  3D4D A;  3F1Z A;  3EVQ A;  4WFN 3;  1V1O A;  3AEV A;  1Y1W B;  5EAY A;  2EYM A;  5IGE A;  4DV4 Q;  2M00 A;  1Q12 A;  3M7N A;  1BR9 A;  1JOQ A;  1EL0 A;  4ZQ3 A;  4J1M A;  5IIF A;  3WOE A;  3K80 C;  1HFN A;  3ZJY C;  3AMU A;  4JI5 Q;  4RGO S;  2F3W A;  3G48 A;  3SR1 A;  1H9J A;  2C5C A;  2KCN A;  2Z6K A;  3NXW A;  2IWH A;  4AYB G;  2JXM B;  1V9P A;  3D8G A;  5C4X G;  3MEH A;  1MD2 D;  1QVC A;  3OOC A;  2EDG A;  3L7Z C;  1KD1 C;  4Q5V A;  3BS1 A;  1HCZ A;  3GTM B;  4DXF A;  5GQO A;  1PRT D;  1VQH A;  4RGN A;  5M3F H;  2MPM A;  4FXK C;  1KNE A;  4BA1 I;  1WTO A;  4BY1 H;  3DEO A;  5ELO A;  2LS0 1;  1T5E A;  3BDL A;  1RJT A;  1DGS A;  3DEP A;  4NW2 A;  1NMF A;  1FNW A;  2ICI A;  3IFD A;  1BCP C;  2NVT H;  1LM0 A;  1X32 A;  1X55 A;  2EYH A;  3HOV H;  1PTO C;  4KN7 C;  5E4W C;  4QGU A;  4R4T A;  3RN2 A;  2HDM A;  4C2M H;  3RZD B;  3GV3 A;  4IPC A;  3GDE A;  2V1C C;  5GAD C;  1B2T A;  2BA0 A;  4X3T A;  2XWJ B;  1K8O A;  1E3P A;  1TU2 B;  3NEM A;  4B3M L;  1D5M C;  5C44 G;  5BN5 A;  1GM5 A;  1EOV A;  2X6G A;  4OL7 A;  4LK1 C;  4X66 L;  3K81 C;  4C3J G;  5M5Y B;  3CC2 A;  4QUC A;  1GHK A;  4UPA A;  4JI8 L;  3PUX A;  4R9W A;  2B8F A;  4B9W A;  3I91 A;  5G3L F;  2E8G A;  4U67 3;  5EKL A;  2BH2 A;  1I4Q A;  4A3L H;  4DV0 L;  2F52 A;  3S1Q B;  3FKI G;  1GUG A;  1MSH A;  4PMB A;  1SNC A;  4QJF A;  2K5N A;  1E2Z A;  1EQQ A;  3HS0 C;  1PXU A;  4KD3 A;  1X9N A;  3UE0 A;  3L9A X;  5L37 A;  1VQ8 A;  1QE6 A;  1E2W A;  2VNU D;  3I8Z A;  4HCS A;  2Z6K C;  5BR8 L;  4LF6 Q;  1TWG H;  4IUT A;  4OX9 Q;  1SNM A;  2L12 A;  4L8J A;  3MXG A;  2QCP X;  4ABN A;  1KLU D;  2IX3 A;  2QEX A;  4C2M B;  3M85 A;  2QEJ C;  2IHE A;  1K8A C;  1QCB D;  2I5L X;  2L4N A;  2BCO A;  4JI0 Q;  5LHY 1;  1BBX C;  3J81 E;  3O13 A;  2AWO A;  2F0F A;  4E6I A;  1YIT A;  4LF4 Q;  1LT3 D;  1XMQ L;  1AFP A;  4HED A;  4IUQ A;  2F0P A;  3OW7 A;  1W6K A;  3K7A B;  2B2Y A;  1CTM A;  3T51 B;  4HIM A;  4B3T Q;  4PMC A;  3UDI A;  2NWG A;  4KV6 A;  2PZT A;  3M4O H;  2OWO A;  5CBE E;  2F4V Q;  2XNA C;  4P72 A;  1A6X A;  1TKW B;  4C3I H;  5H1S E;  1X3G A;  2RDG A;  2JA7 G;  3F2U A;  4IPG A;  3ERS X;  4DNR B;  2F0H A;  5K5P A;  2E2D C;  1F77 A;  1PTO F;  2R6G A;  5EKI A;  2RDH A;  4A3M H;  1A15 A;  1VMC A;  1XTC D;  1M8A A;  3M9B A;  4ZAI A;  3KLS X;  5IP9 G;  4LJZ C;  2NVX B;  3KF6 B;  1J9O A;  1U9R A;  1G29 1;  2AUJ D;  1TWA B;  1B3A A;  1A3T A;  5EPJ A;  4CDD C;  1EY6 A;  1VQO A;  3GTK B;  4P74 A;  2A68 D;  2EVB A;  3W2D A;  5C4J B;  1EZ8 A;  1JE4 A;  4A3C H;  4PZ6 A;  1CK1 A;  3MA2 B;  3RZO B;  2K75 A;  4X3U A;  1EFW A;  1XX8 A;  2HCC A;  1I4P A;  5EJW A;  1WCM G;  2BDN A;  4YIJ A;  2Q2I A;  4JI6 Q;  4RGM A;  3KOJ A;  3I4M H;  5KEE A;  4KLK A;  3BZK A;  4RAU C;  2RSO A;  1S5F D;  3TDQ A;  4EQP A;  2B2W A;  1ET6 A;  4IUP A;  5JOB A;  1GKH A;  3TP6 A;  4HID A;  1NSN S;  3HOZ G;  2XSC A;  4RMF A;  2B29 A;  4QL5 A;  4PV1 C;  4DFA A;  5FLM H;  1CI3 M;  1HUM A;  1TR5 A;  2WAQ B;  2B2U C;  3NTI A;  2EYO A;  4HIO A;  4RKB A;  3X3N A;  5IGD A;  3LWE A;  2L9H A;  3PO2 H;  1F2Y A;  1NTG A;  3D0F A;  4I7Z C;  3QJY A;  1JT8 A;  1LAB A;  5CMD A;  1TWC H;  3PV0 A;  4C3H G;  1JOO A;  3S17 H;  3E9I A;  1KRT A;  5D14 A;  1HH2 P;  1O80 A;  2A6H D;  3KBX A;  4B3S L;  2F0K A;  4O1N A;  1DD2 A;  2LXJ A;  1STB A;  2CW0 D;  3H0G H;  1B1Z A;  2B2T C;  5M5X H;  1ZEQ X;  1SYC A;  3KLS A;  4IUV A;  5C0X H;  4DV5 Q;  1PMR A;  1AW7 A;  1E2V A;  3GTJ B;  4A3K H;  5IT9 L;  1HNX L;  4OEM B;  4GKJ Q;  4JV5 L;  4DV3 L;  4HCE A;  3M4Y A;  4KHV A;  3F2D A;  3M4Q A;  1MBY A;  3BVM A;  3FPP A;  2F4I A;  4YHH L;  3PO3 H;  1X3F A;  3OWF A;  3K57 A;  4JBM A;  4HJ5 A;  1D5Z C;  4KN4 C;  3SVM A;  1TY2 A;  5FJ8 G;  3OTO L;  4FNF A;  4HMI A;  1SMY D;  2RF4 A;  3OW2 A;  3WOF A;  2LFN A;  1VF7 A;  2PW7 A;  2WII B;  5FLX E;  3QOJ A;  1SN8 A;  1I6H B;  1IKM A;  1S5C D;  4LF7 Q;  2DY8 A;  3R3O A;  1UUP A;  3M7G A;  1FNV A;  5IYB H;  2BA1 A;  3H15 A;  2GVA A;  3I56 A;  2A19 A;  4JG2 A;  4APV A;  3CF5 A;  5JVG 3;  1C48 A;  2B2W C;  2QDB A;  1XXG A;  3HOU B;  4YWK A;  1EIH A;  1ILP A;  4WOR A;  2PYK A;  3TS0 A;  4RCO A;  1YIJ A;  3EA6 A;  4A3F B;  4RA8 A;  5D65 A;  5JEA H;  2EYL A;  4IUU A;  1FGB D;  4K0K L;  3OYY A;  4R8I A;  3NWS A;  4V19 0;  1G6Z A;  5C4H A;  1XMQ Q;  2EY1 A;  1Y1V H;  1MI2 A;  2IPK D;  3MVV A;  4OXP A;  4V0B A;  4MN3 A;  2NYZ D;  2XGT A;  3MXN B;  4POF A;  2SOB A;  3TP5 A;  3VR6 A;  1DOM A;  1SXT A;  4UP7 A;  2PNH A;  3CRL C;  1PHJ A;  1BO0 A;  1WTX A;  1LUZ A;  1L1O C;  1ENC A;  2ID0 A;  3VDY A;  2K5W A;  1Y1V B;  3Q22 A;  3W1G A;  1VS0 A;  4JK1 C;  4JI6 L;  1E7Z A;  1CKO A;  3L0O A;  2MNA A;  2UXC Q;  2UXB Q;  2VB2 X;  3J7Z C;  1UE1 A;  4L5S A;  2E2I B;  2CH4 A;  1BCP D;  4YCU A;  5M3M G;  1QIL A;  3UDF A;  1V43 A;  3K5M A;  2E5L L;  4LAA A;  2ZTD A;  4CDF C;  3OHX C;  3U9S A;  4ZUJ A;  1W2B A;  2HT1 A;  1CKN B;  3HOU H;  3VYT A;  4P2C B;  1HNW Q;  1NJI C;  1SRU A;  1I94 L;  2EIF A;  1PTO B;  3S9W A;  1ICF B;  1SNO A;  2N8N A;  3T53 B;  1SRO A;  4IJL A;  3PF4 A;  2F0O A;  1PH9 A;  3FDT A;  3NQI A;  3Q6S A;  4BA2 I;  3E3X A;  3FKI H;  2Q8T A;  2RVL A;  2HQL A;  3JAM E;  2M2L A;  3A8K E;  4R4I A;  1S3O A;  2ZM6 Q;  1QNU A;  1GD7 A;  1HR0 L;  4FF4 A;  3ERQ A;  2BOS A;  2I5H A;  2F0N A;  1PFS A;  4LFA Q;  2A69 D;  1NCV A;  1MGS A;  2A74 C;  3G7L A;  2JA6 H;  4BY7 H;  1EIY B;  3A56 A;  1DOL A;  1N9W A;  4QIW B;  5M5Y H;  2IT1 A;  3RLO A;  2KUM A;  4XYO A;  1TXY A;  1RHP A;  5DM7 3;  4K8I A;  2B3G A;  2UUC L;  3NP8 A;  3DM1 A;  3OTO Q;  4ZK9 B;  3J7Y W;  4A3I G;  4R4Q A;  1HNX Q;  1R4P B;  2EJG C;  4UHV A;  1L2F A;  3AYH B;  3I73 A;  1B50 A;  3PO3 B;  4LF7 L;  1HJP A;  1EQT A;  3I2Z A;  1TS3 A;  3P20 A;  1KXL A;  2Z9H A;  1AP0 A;  3SK8 A;  1K3B C;  2F0S A;  3LX0 A;  3J7A F;  2NN6 G;  1YHQ A;  4YWM A;  1IYU A;  3BZD B;  5GRO A;  3TRZ A;  2CQA A;  3KUP A;  5IT9 E;  3CCE A;  1FNU A;  4ME3 A;  4A93 H;  3HG9 A;  5F2D A;  1I4G A;  3PIO A;  1XNQ Q;  3S2D H;  1IXR A;  2N55 A;  3CRK C;  3ICE A;  1STH A;  4IOA A;  2F0G A;  2A6E D;  1HA6 A;  2VUM H;  4NP5 A;  4P75 A;  4CDC C;  3MEF A;  3Q0A A;  2D5D A;  5EQ0 A;  3JAM c;  2VB3 X;  4KJO A;  3J81 L;  1M90 C;  2K01 A;  3GTO H;  4KHP L;  2CWP A;  2R3Z A;  2RDF A;  5IY0 A;  1BF4 A;  3HOV B;  2OXP A;  2UXD L;  2ES2 A;  1V1Q A;  5IGG A;  1Q1B A;  1U4M A;  4DXG A;  4DK1 A;  1WTW A;  1XPR A;  2D9U A;  4XTC S;  1JOR A;  1ICW A;  3FHW A;  2FJ2 A;  3K5L A;  1RIP A;  3GV6 A;  4RHS A;  4A3D B;  1YHA A;  1UAP A;  3T13 A;  4B3R L;  2CKZ B;  5J1Z A;  1CQF A;  1LT4 D;  1EWC A;  5IYD H;  2NVQ B;  5C5M A;  1WOC A;  1CKM A;  3S24 A;  2KBN A;  1IW7 C;  5JPM C;  4QB4 A;  2NBF A;  4A3D G;  3DWP A;  4BXX G;  1U4R A;  3RZD H;  3PUV A;  2SDF A;  1AZP A;  3JAM L;  4DR1 L;  3S1M B;  1YHB A;  5CBA E;  2F0M A;  2OCE A;  4ODG A;  1R9T B;  2DJG C;  2WAC A;  3I55 A;  3NBI A;  4JI3 L;  2B63 B;  4A3M B;  5IGF A;  1IYJ B;  3HFZ B;  3NTK A;  3X3M A;  3I3C A;  4IFD I;  4OEL B;  3KJO A;  2A68 C;  4LUO A;  4X64 Q;  4NXM L;  5C0X G;  3M4P A;  4HSP A;  1HNW L;  4NXN Q;  1K73 C;  3IL8 A;  5FK9 C;  4KHZ A;  2RA4 A;  2JA7 B;  1FGU A;  2FMM A;  2RHQ B;  1DM0 B;  1I6H H;  4LFA L;  1TS2 A;  3S1M H;  1OO9 B;  1LYL A;  4I7A A;  1EOT A;  5IP7 G;  1I5F A;  2KOL A;  3RR5 A;  4RWS C;  5DM6 3;  4A3J B;  1C0A A;  2WKD A;  1F9P A;  4FP5 D;  3ULP A;  1CSP A;  3QB3 A;  4GOP B;  4KI0 A;  5IT9 c;  4G7Z C;  1JMC A;  3S1N B;  1JJC B;  4PNY A;  1HQR D;  4L6T B;  2BE5 D;  4PQX A;  4DPG A;  5K36 H;  3HOW G;  2WB1 E;  2F0U A;  4BWG B;  2E74 C;  3VA5 A;  1SSO A;  4A3E H;  3H0G B;  2WKC A;  5FLX c;  2K14 A;  4XIG S;  4MTK A;  5NUC A;  4DV0 Q;  2MP1 A;  2K28 A;  4OGQ C;  4A93 B;  2YYZ A;  1GUT A;  4A3J H;  2BDO A;  1YJW A;  5T1I A;  5LL6 S;  2UUC Q;  2E2H B;  5I6Y A;  2GA4 B;  4IJH A;  2R7D A;  3M3Y H;  1G2S A;  2XVS A;  3GTQ H;  3J80 c;  1P16 A;  3VA7 A;  4XQQ A;  1JE5 A;  3RNU A;  2WP8 J;  4ZRZ A;  3U4V A;  1K28 A;  3KF8 B;  3MFG A;  3MXP A;  1XNQ L;  4LF6 L;  3PF5 A;  1WYD A;  5IYC H;  1I50 B;  2KED A;  3ND9 A;  5C4X B;  1WTV A;  4HN7 A;  5ELD A;  3H3V H;  1SFO B;  4A3G H;  4KTA A;  4K2L A;  1EY8 A;  1HA5 A;  3E0E A;  4KY7 A;  3TZD A;  1H9S B;  3F2B A;  4C56 C;  4KHP Q;  2B63 H;  4BY1 B;  2MGS A;  4DGZ A;  2OEO A;  5J22 A;  2NVY B;  4JBK A;  3URY A;  1XPO A;  3CD6 A;  2JA5 H;  4HR7 B;  5HGT A;  1GUS A;  4F88 A;  1D2B A;  3HRZ C;  2AMC B;  3A8J E;  4G7H C;  4OWT B;  2YTY A;  2B2U A;  2L11 A;  3S1Q H;  2FFK B;  3QIA A;  3V05 A;  4AQY Q;  4HJ7 A;  3KJP A;  4Y7N H;  3DWA A;  1LTB D;  1H9M A;  4F7X A;  3B6Y A;  2IL8 A;  4U68 A;  4AYB B;  2B39 A;  2IJ0 A;  3HOV G;  1QUQ A;  2DUD A;  2L55 A;  2Z8L A;  1LTS D;  1ROD A;  2K1B A;  1B7Y B;  4GN3 B;  2RSN A;  1GUN A;  3C2P A;  4DV7 L;  3CC7 A;  1BVS A;  4BBR H;  1VQK A;  4LFC L;  2F03 A;  3C46 A;  1VQE A;  3HOY B;  2EQS A;  1Q7Y C;  3C3L A;  1RL2 A;  1U0L A;  4ZKC B;  2MUY A;  3G6J B;  5DNF A;  4DR7 Q;  2MO0 A;  2NZH A;  4DAY A;  3GP7 A;  3SK5 A;  5KNB A;  3C1E A;  4LF8 L;  4IQZ A;  2VW9 A;  4DV2 Q;  4X64 L;  3KYH C;  3GTJ H;  1H9S A;  4DR1 Q;  1PH4 A;  3I4N B;  1BDO A;  5BN4 A;  1PH8 A;  1UE6 A;  3DUZ A;  1TWH H;  5A35 A;  4DV1 Q;  2F0Q A;  1Q8K A;  1V1P A;  4UDU C;  4QQB X;  4YY3 L;  4EQN A;  4X65 Q;  3DWQ A;  1S40 A;  3D6W A;  2IX0 A;  1B4O A;  2ASB A;  4DUY L;  1VQA A;  1F9Q A;  4LFB Q;  4X62 Q;  5FKA C;  1STG A;  3F2C A;  2R92 H;  2JSO A;  3K0X A;  3CCU A;  4H13 C;  1KNA A;  1LLR D;  5EBD A;  3NK9 A;  1VQD A;  1FYC A;  2D0O A;  4ZUI A;  4DK6 C;  5A2Q E;  2E2J B;  2CFM A;  1IBM L;  1ZYR C;  1JOK A;  1GO3 E;  1AZQ A;  2CCZ A;  1BKB A;  3OWE B;  2NN6 H;  1K83 B; 
#chains in the Genus database with same CATH homology
 4GLA C;  1VQI A;  2DGY A;  4OWW B;  4DV1 L;  2UUB L;  4DR7 L;  1XMQ Q;  2Q2U A;  1J6Q A;  3RZO H;  1Y1V H;  4IO9 A;  1PVO A;  2E5L Q;  4JOI A;  1UE7 A;  2RHS B;  1PYS B;  2VL6 A;  4OXP A;  5M3F G;  1KIX A;  4O2D A;  2XGT A;  3MXN B;  3A74 A;  4POF A;  1C7Y A;  4OON A;  2VUM G;  2R7Z G;  3DLL A;  1E22 A;  1PH3 A;  3HOW H;  4B3M Q;  4PMW A;  1I94 Q;  1HR0 Q;  4A3B G;  2H5X A;  1G6P A;  1Q81 C;  4UP7 A;  4JI1 Q;  2PNH A;  3RLN A;  4A4I A;  4A3G G;  1I3Q H;  5M5W H;  2Y0S E;  4A3E G;  1PHJ A;  1OXS C;  1YEZ A;  3D31 A;  1VQN A;  1KAW A;  2HIV A;  4H02 A;  4Y52 H;  4HJ8 A;  1LUZ A;  1L1O C;  1UWV A;  2CQO A;  2K50 A;  2D0P A;  3I4M G;  1K3R A;  4J15 A;  4RG1 A;  4X65 L;  1QVF A;  2ID0 A;  2ALY B;  4DV6 L;  3VDY A;  4LW1 A;  2ZM6 L;  4A3F G;  4LNQ A;  5C4J H;  2RCN A;  1IBL Q;  3W1G A;  3T1Y L;  1VS0 A;  1QVG A;  4JI6 L;  1CKN A;  1E7Z A;  1CKO A;  3L0O A;  2MNA A;  1XMO L;  2PQA A;  3J7Z C;  2WB1 G;  2UXC Q;  1UE1 A;  4L5S A;  3JAM i;  4X66 Q;  1VQL A;  4DUZ L;  3CPF A;  2VQF Q;  3PCO B;  4YCU A;  5M3M G;  1IBK L;  1VCI A;  2JJQ A;  3UDF A;  4ALP A;  3NEL A;  1V43 A;  2KHJ A;  3EN2 A;  3CMA A;  1W3S A;  5IYD G;  1N34 Q;  2E5L L;  2ZTD A;  3I7F A;  2K5H A;  3UDX A;  3F8T A;  4JI5 L;  1W2B A;  2HT1 A;  1CKN B;  3HOU H;  1IBM Q;  5C0X I;  3HOX G;  3HKS A;  2IX1 A;  3PO2 G;  3PSI A;  2KHI A;  3STB C;  4DR4 L;  2LSS A;  1VQF A;  2ZJQ A;  1HNW Q;  1NJI C;  1SRU A;  1I94 L;  2EIF A;  4JBW A;  3U4Z A;  1G51 A;  1WI5 A;  2NVY H;  4L5Q A;  2N8N A;  2LXK A;  1SRO A;  4IJL A;  2A1A A;  3HOY H;  3W1B A;  3PF4 A;  1Q1E A;  1OTC A;  2JA8 G;  3S14 H;  2R93 H;  4UY8 C;  1PH9 A;  3BZC A;  2B63 G;  1PV4 A;  4A76 A;  4BA2 I;  3CQZ H;  2JEB I;  3FKI H;  4JBJ A;  1OXU A;  2HQL A;  4IPH A;  3CCQ A;  1QZG A;  2R7F A;  1VQ4 A;  4IFD J;  3CME A;  4R4I A;  3HOZ H;  1S3O A;  1CUK A;  2ZM6 Q;  4EX5 A;  4LFC Q;  4MNO A;  1GD7 A;  1HR0 L;  2D62 A;  2UXC L;  5FLM G;  1L1O A;  3CCS A;  3TEH B;  2I5H A;  4BBS H;  4K0K L;  2EXD A;  1PFS A;  4LFA Q;  4GNX B;  2E2J H;  3J81 i;  5AJ3 Q;  4A75 A;  3I4N H;  1WJJ A;  4JI4 L;  4X6A H;  2K5V A;  3CP0 A;  3AFQ A;  5GAH C;  2JA6 H;  4BY7 H;  1EIY B;  1A8V A;  3A5Z B;  4DNI A;  3CCL A;  3K7A H;  1A62 A;  4PZ7 A;  5JEA J;  3KF6 A;  3S16 H;  1N9W A;  4LUZ A;  5M5Y H;  3CW2 C;  2JA7 H;  2IT1 A;  4YWL A;  3RLO A;  5C3E H;  1TXY A;  4LF5 L;  1KL9 A;  1MKH A;  1XMO Q;  2B3G A;  3F1Z A;  1YZ6 A;  3AEV A;  4A3M G;  5EAY A;  4DR6 L;  2WAQ E;  4DV4 Q;  2UUC L;  4JI2 L;  1Q12 A;  3M7N A;  3AFP A;  3OTO Q;  1YBY A;  2FXQ A;  1X3E A;  3K80 C;  4A3I G;  3ZJY C;  4R4Q A;  1X54 A;  1HNX Q;  4LF8 Q;  3GTG H;  4GKK Q;  4JI5 Q;  1NE3 A;  3H0G G;  4TQU S;  1QUQ B;  3GTP H;  3G48 A;  5K36 G;  3ER0 A;  3J81 j;  1L2F A;  5J3B A;  3AYH B;  3CXC A;  4JYA L;  4IOC A;  1N8R C;  4A3K G;  1X65 A;  1PA6 A;  4A3C G;  3CCR A;  1FVI A;  2Z6K A;  2HIX A;  3S1R H;  2KCM A;  4LF7 L;  3I4O A;  3CCV A;  1HJP A;  4AYB G;  1V9P A;  3I2Z A;  5C4X G;  1KXL A;  3DM3 A;  3E9H A;  4HIK A;  1QVC A;  1WCM H;  1N36 Q;  2OTJ A;  2JE6 I;  4YY3 Q;  2NN6 G;  1VQ9 A;  2I0Q A;  4A3J G;  4DR5 Q;  1YHQ A;  1D7Q A;  3SGI A;  4YWM A;  3UE1 A;  1Y14 B;  1NBW A;  2ZTE A;  3L7Z C;  5GRO A;  1KD1 C;  3TRZ A;  2JA5 G;  4LF9 Q;  4LFB L;  1JJG A;  2YV5 A;  3CCE A;  1I50 H;  1WFQ A;  4ME3 A;  4A93 H;  4L5T A;  2PI2 E;  1KC8 C;  1Y1V G;  3GTM H;  3PIO A;  1XNQ Q;  3S2D H;  1IXR A;  2PI2 A;  5GQO A;  1VQH A;  5M3F H;  3EBE A;  4LUV A;  5E7N A;  4BA1 I;  2OQK A;  4BY1 H;  4GNX A;  3ICE A;  5ELO A;  5IP9 H;  1HZA A;  3PIP A;  4GNX C;  4IOA A;  2N78 A;  2R7Z H;  2VUM H;  1ASZ A;  4JI8 Q;  4P75 A;  2MQH A;  1DGS A;  5IYB G;  1XNR L;  1NMF A;  3MEF A;  4JI7 L;  2JA9 A;  3JAM c;  4GS3 A;  2Z0S A;  2NVT H;  2R92 G;  1M90 C;  1LM0 A;  1X55 A;  5IYC G;  3GTO H;  1K8G A;  4KHP L;  2CWP A;  1N32 Q;  5IY0 A;  1TWF H;  3HOV H;  1Z47 A;  2UXD L;  4C3H H;  1V1Q A;  3AQQ A;  2ES2 A;  1Q1B A;  4FDB A;  4QGU A;  4R4T A;  5BR8 Q;  4DR6 Q;  3RN2 A;  1XPR A;  4OX9 L;  1P8L A;  5LMN L;  1M1K C;  4JI3 Q;  4BBR G;  4C2M H;  1UEB A;  3A5U A;  4IPC A;  3T1H Q;  4XTC S;  3GDE A;  1EUJ A;  2V1C C;  5GAD C;  1N33 Q;  2MFI A;  2BA0 A;  3FHW A;  4JOI C;  4AIM A;  1E3P A;  1RIP A;  1YHA A;  3NEM A;  1J5E L;  1VQM A;  2MO1 A;  4NB3 A;  1VQ5 A;  4JYA Q;  4B3M L;  4B3R L;  2Q2T A;  5C44 G;  1IBL L;  2CKZ B;  1GM5 A;  4JI0 L;  1UE5 A;  2PQA B;  1EOV A;  5IYD H;  3H3V I;  4YCW A;  4X66 L;  2VQF L;  3K81 C;  3HOU G;  1C9O A;  1WOC A;  1CKM A;  3CC2 A;  1FL0 A;  3S24 A;  2IY5 B;  2KBN A;  5LMU L;  2K4K A;  1YJN A;  4UPA A;  4JI8 L;  4DR5 L;  5IE8 A;  2JEA I;  4DV6 Q;  1PH1 A;  2UUA L;  4A3D G;  4BXX G;  3PUX A;  3K8A A;  2VZA A;  3RZD H;  3PUV A;  1E1O A;  4YCV A;  4B3T L;  2R93 G;  2AWN A;  3J80 i;  5FJ8 H;  2KCT A;  4R4C A;  4DR1 L;  2VY3 A;  2E8G A;  1YHB A;  2BH2 A;  2OCE A;  4A3L H;  1KRS A;  4DV0 L;  2F52 A;  2UXD Q;  1HZC A;  3RLF A;  3FKI G;  2JQO A;  4AH6 A;  4QJF A;  1IZ6 A;  1IBK Q;  4DR3 Q;  2K5N A;  4DR2 Q;  3I55 A;  1VQB A;  4JI3 L;  1IYJ B;  1EYG A;  1EQQ A;  3HFZ B;  3U58 A;  4IFD I;  2PMZ E;  2A8V A;  3KJO A;  4LUO A;  1X9N A;  1PH6 A;  1AH9 A;  4X64 Q;  5GAG C;  4BBS G;  1U5K A;  4UP9 A;  2NVQ H;  4NXM L;  4GN5 A;  3M4P A;  3UE0 A;  4R4O A;  5C0X G;  1GVP A;  3G4S A;  1VQ8 A;  2YU9 H;  3I4N G;  1HZB A;  4NXN Q;  1K73 C;  1HNW L;  4JCV E;  2VNU D;  1LTL A;  2HHH Q;  1Y1W H;  3KLW A;  2Z6K C;  1VQJ A;  4KHZ A;  5BR8 L;  4LF6 Q;  1FGU A;  1TWG H;  2RHQ B;  4OWX B;  4OX9 Q;  3HKZ G;  2VQE Q;  4GOP A;  4LFA L;  3S1M H;  1I6H H;  1OXV A;  1EIF A;  3BU2 A;  4GLV B;  1MIU A;  2Q2H A;  1LYL A;  1EQR A;  5JEA G;  1PH2 A;  3PO3 G;  3EIV A;  4OO1 G;  4DAM A;  2NN6 I;  2Y0S G;  3Q8D A;  2QEX A;  1H95 A;  5IP7 G;  1B70 B;  1I5F A;  3M85 A;  2UU9 Q;  1K8A C;  2IHE A;  2E2H H;  2UXB Q;  3RR5 A;  2IHF A;  5IWA Q;  2OTL A;  2I5L X;  1KQS A;  4MZ9 A;  4B3R Q;  1C0A A;  2AKW B;  1E24 A;  1KHI A;  1R9T H;  3ULP A;  4JI0 Q;  1CSP A;  3TQY A;  2WFW A;  4KI0 A;  2GVB A;  5IT9 c;  2AWO A;  4GOP B;  4EQ5 A;  1MJE A;  1JMC A;  2NVX H;  3CCM A;  1JJC B;  1TWA H;  3PGZ A;  4WJ4 A;  1YIT A;  4LF4 Q;  4L5R C;  3GTL H;  3KFU A;  3NBH B;  4QIW E;  4DPG A;  4JI2 Q;  1XMQ L;  1SE8 A;  2NZO A;  3HOW G;  2WB1 E;  3TS2 A;  1A63 A;  5JJK A;  1B8A A;  4P71 A;  4A3B H;  3KDF B;  3UDG A;  3BJU A;  4A3E H;  4HIM A;  4B3T Q;  5C4X H;  4P73 A;  5FLX c;  2K14 A;  4XIG S;  3UDI A;  2E2I H;  4NXM Q;  4LF5 Q;  4BY7 G;  3M4O H;  4NXN L;  4DV0 Q;  1VQP A;  1VQG A;  3RN5 A;  4HJ9 A;  3S15 H;  2YYZ A;  2OWO A;  2F4V Q;  4P72 A;  1XTD A;  4A3J H;  4C3I H;  1YJW A;  2K52 A;  1X3G A;  2GN5 A;  5H1S E;  1MJC A;  3CCJ A;  2UUC Q;  2JA7 G;  4IPG A;  3ERS X;  1Q82 C;  1L1O B;  3K7U C;  4A3F H;  4IJH A;  2JK8 A;  2R7D A;  1JB7 A;  3M3Y H;  4O0A A;  4A93 G;  1AE2 A;  3GTQ H;  2R6G A;  1A0I A;  4GKK L;  4A3M H;  3J80 c;  1P16 A;  1JE5 A;  3RNU A;  2WP8 J;  3M9B A;  1CSQ A;  3U4V A;  1XJV A;  4B3S Q;  5IP9 G;  3S1N H;  3HKZ E;  3KF6 B;  3KF8 B;  1O7I A;  3T1Y Q;  1HZ9 A;  1G29 1;  4AQY L;  1Q86 C;  2F3I A;  1XNQ L;  2N49 A;  1PH5 A;  4LF6 L;  1VQO A;  2XTI A;  4DKA C;  4P74 A;  1NY4 A;  1VQ7 A;  3PF5 A;  1OXT A;  4LF4 L;  1WYD A;  5IYC H;  2ZTC A;  3A0J A;  3STB D;  1N36 L;  4A3C H;  4QY7 A;  4PZ6 A;  1SFO H;  3H3V H;  4A3G H;  2K75 A;  1EFW A;  3S2H H;  2UU9 L;  3E0E A;  5IWA L;  4DV7 Q;  3F2B A;  4DV3 Q;  1BBW A;  1FJG Q;  1WCM G;  4KHP Q;  2B63 H;  2Q2I A;  3PUY A;  4JI6 Q;  2I5M X;  3KOJ A;  1YJ9 A;  3I4M H;  4KLK A;  3BZK A;  2CWA A;  4JBK A;  1T9H A;  2F4V L;  1D8L A;  3L2P A;  1X56 A;  1XPO A;  1SLJ A;  2JA5 H;  3CD6 A;  1NMG A;  1GKH A;  3HOZ G;  4HID A;  4RMF A;  2B29 A;  4QL5 A;  4DV5 L;  2YTX A;  1K9M C;  5C44 H;  1Z9F A;  2AMC B;  3KDF A;  4JI7 Q;  4DV2 L;  5FLM H;  4BY1 G;  4JV5 Q;  4GKJ L;  2OQ0 A;  5DLQ E;  5M3M H;  2QA4 A;  4OWT B;  2YTY A;  3GTK H;  3CAM A;  4C3J H;  4GOP C;  4TVA B;  4DR4 Q;  3S1Q H;  3ULJ A;  4HIO A;  3WWV A;  4UP8 A;  5C0X J;  4HJ7 A;  4AQY Q;  2JA6 G;  3KJP A;  4Y7N H;  2QGQ A;  4A3D H;  2N3S A;  1Q46 A;  3HOX H;  3PO2 H;  1NTG A;  3D0F A;  3B6Y A;  5LMN Q;  5AJ3 L;  4BXX H;  1JT8 A;  1K0R A;  5C3E G;  2C35 B;  3HOV G;  2VS1 A;  1TWC H;  1QUQ A;  3PV0 A;  2DUD A;  3W5O A;  3T1H L;  3S17 H;  1ASY A;  3E9I A;  1N33 L;  4A3L G;  3GO5 A;  1B7Y B;  3HOY G;  4GN3 B;  2UUA Q;  4DAY B;  1PH7 A;  1KRT A;  5LMN W;  2KEN A;  4DUY Q;  2JA8 H;  1J5E Q;  4DV7 L;  3CC7 A;  1BVS A;  1HH2 P;  4BBR H;  4X62 L;  4LFC L;  1VQK A;  3CC4 A;  4B3S L;  4DK3 C;  1HNZ L;  2LXJ A;  1VQE A;  4NPS A;  2EQS A;  1Q7Y C;  4K0K Q;  1RL2 A;  1U0L A;  1S72 A;  1YI2 A;  3H0G H;  4JI4 Q;  4DV4 L;  5M5X H;  5GAE C;  2UUB Q;  2MO0 A;  1OXX K;  5LMU Q;  4DR3 L;  3G71 A;  2NZH A;  1IL2 A;  4DR7 Q;  3G6E A;  4DV5 Q;  3NEN A;  3ULL A;  4A3K H;  3U50 C;  5HGQ A;  4OO1 I;  3TRE A;  1HNX L;  2VW9 A;  4DV2 Q;  4LF8 L;  4GKJ Q;  2YTV A;  4JV5 L;  1EWI A;  4X64 L;  3KYH C;  3GTJ H;  4DV3 L;  3F2D A;  1FJG L;  3M4Q A;  4DR1 Q;  2WAQ G;  2ZJP A;  1PH4 A;  4HJA A;  1PH8 A;  4YHH L;  3PO3 H;  1X3F A;  4GLX A;  1UE6 A;  4JBM A;  4HJ5 A;  1TWH H;  1K83 H;  1X6O A;  2L15 A;  5IP7 H;  4DV1 Q;  3LGJ A;  5FJ8 G;  2VQE L;  4R1J A;  3OTO L;  4DR2 L;  1Q8K A;  3JC6 6;  3PUZ A;  4QQB X;  3OW2 A;  2RF4 A;  1SMX A;  3CPW A;  4YY3 L;  4JC0 A;  4IFD G;  1E1T A;  4X65 Q;  1SN8 A;  1S40 A;  1BBU A;  2IX0 A;  2ASB A;  1VQC A;  4DUY L;  1VQA A;  4AYB E;  2ATW A;  4LF9 L;  4X62 Q;  4LFB Q;  4IPD A;  2AHO B;  4A3I H;  3J7A 5;  4JI1 L;  2HHH L;  4LF7 Q;  1YNX A;  4LWC A;  4PG3 A;  5IYB H;  3GD7 A;  1PYB A;  2BA1 A;  4GN4 B;  3F2C A;  4DUZ Q;  3H15 A;  2GVA A;  3I56 A;  2ZJR A;  2R92 H;  2A19 A;  4JG2 A;  5JJI A;  1XPU A;  4APV A;  3K0X A;  3CF5 A;  3CCU A;  3J81 c;  4POG A;  1QZH A;  1SR3 A;  1Y1W G;  4YWK A;  1N34 L;  1AE3 A;  1VQD A;  4MTN A;  1XNR Q;  1JJ2 A;  5JJL A;  2BH8 A;  3TS0 A;  4PZ8 A;  2D0O A;  4DK6 C;  3IRB A;  1YIJ A;  5ELN A;  4WJ3 M;  1YVC A;  2CFM A;  1IBM L;  1L0W A;  1GO3 E;  3FP9 A;  2CCZ A;  1BKB A;  1N32 L;  1HNZ Q;  3PUW A;  2UXB L;  5HY6 A;  4YHH Q;  1HR0 W;  1VQ6 A;  3OYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...