2I5LX

Crystal structure of bacillus subtilis cold shock protein variant bs-cspb m1r/e3k/k65i
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
RLKGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock protein cspB
publication title Optimized variants of the cold shock protein from in vitro selection: structural basis of their high thermostability.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5lX00
3HKZG 5GQOA 2CQOA 4GNXA 2E2JH 4L5SA 4DR7L 4IFDG 1CKNA 3T1YQ 3JC66 2DGYA 1BVSA 4DUZL 2R7DA 2ZM6L 4B3RL 1L1OA 3GTJH 3UDFA 1PYSB 2PNHA 2RCNA 1XJVA 1KAWA 2HHHL 1UE7A 3PV0A 3W5OA 1Z47A 4UP7A 1PH4A 4A3JG 4LF6Q 4LF7L 4DR4L 2R92G 1HNXQ 3BZKA 3PIOA 3M9BA 5C0XG 4B3TQ 3S17H 4C2MH 3UDIA 4K0KL 4BY1G 3ZJYC 4B3ML 2IHEA 2ID0A 4OONA 4R4QA 4RG1A 1YJWA 3GD7A 5FJ8H 1X3FA 3KOJA 1Q1EA 3HOZG 2FXQA 1QZHA 4KI0A 4JOIC 4DV7L 1Y1WH 1TWCH 2KENA 4JI8Q 1VS0A 4JI2Q 1C7YA 4JI1Q 4DUYQ 1P16A 2NVXH 1IBKQ 3M85A 2OWOA 3KFUA 2KHIA 3A0JA 4APVA 1X3EA 5H1SE 4A3DH 2LXKA 1X55A 3KYHC 4LF5L 1WOCA 3S1RH 2KBNA 2CWAA 3HFZB 3BJUA 4A3LH 1IBLL 5IYDH 4LFCL 4JI7Q 3OTOL 4A76A 1X6OA 1FVIA 1QZGA 2Z6KA 1C0AA 3I4NH 1I3QH 1HNWL 2YTVA 4IFDJ 2VL6A 2VY3A 4UP9A 2QEXA 4GN4B 5C4JH 1XNRQ 3FKIH 3RZOH 2A1AA 4B3SL 1ASYA 1SR3A 1XPRA 4JI0L 2NZOA 4DV2Q 1VCIA 4DV4Q 1XMOQ 1VQ9A 2UXBQ 3K0XA 4J15A 1IBMQ 1SE8A 2JA7G 5ELOA 1FGUA 4UY8C 2EXDA 3AYHB 3PUZA 2E5LL 1OXUA 3CCQA 1L1OB 2JK8A 1GD7A 2QGQA 1VQLA 5C0XJ 4KHPL 3TS2A 3EBEA 3AQQA 1K3RA 2WB1E 3PUYA 4MNOA 4JI6Q 2KCTA 3S1NH 2WAQE 2Y0SE 3I55A 4HIMA 1KRTA 3A5ZB 5C3EG 1WFQA 4IPHA 4R4CA 5GAEC 4LF4L 1I6HH 5HY6A 4OWTB 1M90C 3KJPA 4DV3Q 4HIKA 5JJIA 2NVTH 1XPOA 3J81j 3STBC 2JA6G 1IYJB 4A3FG 1E7ZA 3M3YH 4BXXH 3H0GG 2Q2HA 2WFWA 1N36Q 4QIWE 2VZAA 2UUCQ 4JI4L 4KHZA 3F2CA 1XNQQ 4IOCA 3HOYG 1BBWA 5C4XG 1JJ2A 2NN6G 1N32L 5M5XH 4JYAQ 4OO1G 4NXNL 2N3SA 3HOUG 4BBSG 1YJ9A 1DGSA 1EUJA 3E9IA 1GM5A 4X65L 5M3MG 1HR0Q 2JEAI 1EOVA 2I5MX 3CPWA 1G291 4X64L 3BZCA 4GKKQ 1Q86C 5BR8Q 4O2DA 3GTGH 1Q12A 3F8TA 1PH9A 4DR3Q 1RIPA 1X54A 3CMEA 4HJ9A 2R93H 3M4PA 1Q8KA 3D31A 3F2DA 3CP0A 2AKWB 2ZJRA 3T1HQ 4DV0Q 5E7NA 5GAHC 1V9PA 1EWIA 1AE2A 1FL0A 3CCSA 2UUBL 3PCOB 1G6PA 2YV5A 1UWVA 1V1QA 1Q46A 1YBYA 1LYLA 3U4ZA 1C9OA 1D8LA 1NJIC 4DR2Q 3I4MG 4YHHL 5LMNQ 1SFOH 3PGZA 2Q2UA 2CCZA 2MFIA 3CC2A 1Y14B 4PZ6A 1EYGA 2B63H 4YCWA 3BU2A 4AYBE 4KLKA 4IOAA 1EIFA 1HJPA 1IL2A 4YCVA 3UDGA 1G51A 1KL9A 2I0QA 2NVQH 2RHQB 2XGTA 3TS0A 2JA5H 3HOWG 2N8NA 4LW1A 4OO1I 3PO2H 4GOPB 2YTXA 3HOVH 1EIYB 5IWAQ 4A3EH 3U58A 2UUAQ 4X66L 4HJ7A 1YJNA 1XMQQ 4BBRH 2UXDL 3DM3A 4BA2I 3UE0A 4A3CH 4DR6Q 2R7ZG 1Y1VH 4QY7A 3MEFA 1QVFA 2BA1A 3HKSA 3H15A 4P71A 4UPAA 4HIOA 4A3KH 4LF8L 4JV5Q 4RMFA 5JJKA 2VQEQ 4DK3C 1X3GA 1VQDA 2AMCB 4JI2L 4JC0A 2VQFL 5C44H 3Q8DA 4EX5A 5M3FG 4C3JH 4JI3Q 1VQBA 3E9HA 1HZCA 4HJAA 2UU9L 2F4VL 1PVOA 1M1KC 1VQIA 1KD1C 4P72A 4YY3L 3CCEA 1W2BA 2Q2IA 3RLNA 4A4IA 4JI7L 2EQSA 1OTCA 1N34L 4A3MH 1MKHA 2JE6I 1X65A 3TEHB 5HGQA 1I5FA 5LMNW 2I5HA 1I94L 4GOPC 4PMWA 3M7NA 2C35B 3UE1A 1XNRL 1WJJA 1E1OA 4UP8A 4GKJQ 2JA8H 4OX9L 4GN5A 1HNZQ 5IYDG 4AQYL 3KF8B 5LMUQ 2PMZE 1YHBA 3K80C 2IY5B 4DNIA 5GADC 4LF7Q 4WJ4A 1TWFH 4POGA 3CF5A 2PQAA 1BBUA 3PUXA 3B6YA 5AJ3Q 3HOXG 1K83H 4GS3A 4A3IH 3PSIA 2RHSB 4A3JH 3GTPH 2BH2A 4DR1L 1Q7YC 1N33Q 1KRSA 3OYYA 3F1ZA 3S14H 3JAMc 1N9WA 4LUOA 2R92H 2K14A 4IFDI 5K36G 1CSPA 2I5LX 4DUZQ 2ZM6Q 1S40A 4B3RQ 4Y52H 1KIXA 3ERSX 4QGUA 2VUMG 5GROA 3A74A 2HHHQ 1VQJA 3CC7A 1VQ6A 4PZ8A 2WB1G 4H02A 1FJGL 3JAMi 4DR4Q 2ASBA 3H3VI 4GNXB 1A8VA 2IHFA 2WAQG 2Y0SG 3KDFA 1YHAA 3NENA 1CKNB 2AWOA 4TQUS 1PV4A 3PF4A 1B8AA 1L0WA 3CCRA 1A63A 1CKMA 4DV5L 2ZJPA 4K0KQ 2D62A 2YTYA 2ALYB 1PH2A 4A3GG 4B3MQ 4YWKA 5C0XI 5FLMG 3PIPA 2OQKA 1JB7A 2F3IA 3EIVA 3K81C 1QUQA 4OWXB 3RLOA 4LFBL 3FP9A 3G48A 4NB3A 4JI5L 2H5XA 4DV7Q 1KXLA 4MZ9A 1VQ4A 4BXXG 3S1QH 2HQLA 2UXCL 2A8VA 1HZBA 4DV1L 5IP7G 4DR5L 4YWMA 3J7A5 4XTCS 4LF5Q 3ULLA 3GO5A 4A93G 3GTLH 4LF9L 2ZJQA 2WP8J 1IBLQ 4LFCQ 5ELNA 3OTOQ 4C3IH 1VQPA 3S1MH 4GNXC 2OCEA 1OXSC 1NBWA 1OXTA 5IYBH 2KHJA 1HNWQ 2K5HA 1L1OC 1OXXK 3NEMA 1J5EL 2IT1A 3A5UA 1D7QA 1CSQA 1U5KA 2PQAB 4B3SQ 4JI0Q 2BA0A 2MO0A 4IO9A 4BY7G 1NMFA 2E8GA 2AHOB 2IX1A 4LFAL 1E22A 1AE3A 1YNXA 4NPSA 4ME3A 4GN3B 5DLQE 4NXML 3PF5A 1VQFA 4TVAB 3DLLA 2CFMA 2E5LQ 4GLXA 4OWWB 3CCLA 3M4QA 4KHPQ 3KF6A 4JOIA 3K7AH 3TREA 1NTGA 1OXVA 2LSSA 5J3BA 1Q82C 1PH8A 1UEBA 4X62L 3U50C 4A3FH 1V43A 5IYCG 2PI2A 2ES2A 4LF4Q 3W1GA 3AEVA 4IPDA 4AYBG 3NBHB 3RLFA 3WWVA 5C4XH 4DV6L 3HOYH 2F52A 4L5QA 2B63G 1WI5A 1YZ6A 1QVGA 4IPGA 3G6EA 1TWAH 4IJHA 2R6GA 4LUVA 4JBKA 1QUQB 1WYDA 1E3PA 1KHIA 4R4IA 4JBWA 3CCJA 3T1YL 2JA5G 3J80c 1QVCA 4LUZA 5M3MH 2Z6KC 1O7IA 2Z0SA 4JI4Q 1YEZA 2VS1A 3CW2C 4JG2A 5JJLA 2KCMA 3PUVA 1PA6A 1N32Q 1IZ6A 3STBD 4NXNQ 1SLJA 4LF6L 3J80i 2NN6I 3GDEA 2OTJA 2L15A 4P73A 3PO3H 1Y1VG 2ZTEA 3I7FA 1HNXL 5JEAG 4B3TL 4X65Q 3L2PA 4A3KG 1HZAA 4ALPA 4X64Q 1HR0W 2LXJA 2B3GA 3KJOA 3RNUA 4XIGS 5C44G 3CXCA 2K75A 3AFQA 1JJGA 1TWHH 4C3HH 2OTLA 5IP9H 3VDYA 4R1JA 4JI8L 3AFPA 4JI1L 1B70B 4DUYL 1HZ9A 4A3BH 1IBKL 1K0RA 4YWLA 2UUBQ 1TXYA 2K4KA 2IX0A 5IE8A 3PUWA 5FJ8G 2YYZA 3CQZH 1NMGA 1X9NA 3ICEA 2OQ0A 2CKZB 4DK6C 1PHJA 1JT8A 1YIJA 1WCMH 1Y1WG 3TQYA 4YHHQ 3CAMA 3HOWH 2MNAA 2JA8G 1J6QA 1RL2A 3RZDH 1PH1A 1GVPA 4IPCA 3UDXA 4A3DG 2NZHA 3I56A 4A3LG 2N49A 4DV2L 4DV4L 1XMOL 2HIVA 4DKAC 1R9TH 4JCVE 2R7ZH 2UXBL 2JJQA 1IBML 4A3IG 1XTDA 3HKZE 3MXNB 4GLVB 1PH7A 3I4NG 3TRZA 2D0PA 1E1TA 1W3SA 4MTNA 4O0AA 3FKIG 3H3VH 1GKHA 1U0LA 3KLWA 4PZ7A 5JEAJ 4X66Q 2UXDQ 1LTLA 1JE5A 3G71A 5M3FH 2NVYH 4DR7Q 4JI6L 2N78A 1E24A 2DUDA 1A0IA 3RR5A 1YVCA 2GVAA 4DAYB 4LF8Q 1EFWA 4BA1I 4BY1H 4AIMA 1P8LA 4HIDA 2XTIA 2ZTCA 3ER0A 4DV3L 2VQFQ 1NY4A 1CUKA 3HOZH 3E0EA 3SGIA 4HJ5A 3OW2A 3J81c 1SMXA 4QQBX 1K8GA 4L5TA 2UU9Q 2F4VQ 3CCMA 3J7ZC 4YY3Q 2GN5A 1N36L 4JBMA 2UUCL 3S15H 1N34Q 1XNQL 1SN8A 2R7FA 3J81i 3S24A 4JYAL 1MIUA 1I94Q 3W1BA 1I50H 3HOXH 1YHQA 2HIXA 3K7UC 1PH3A 1JMCA 5IY0A 3GTOH 3S2DH 4A75A 3L7ZC 2E2IH 3CPFA 1KQSA 3I2ZA 3CCVA 1HR0L 1PFSA 4OX9Q 4DAMA 1UE1A 4AQYQ 1VQ8A 4GKKL 1LM0A 3CCUA 5BR8L 4R4TA 1EQQA 2V1CC 4Y7NH 3CMAA 4DPGA 4DR3L 5IYBG 2VUMH 1NE3A 1VQHA 1S3OA 2JQOA 3RN5A 1JJCB 1SRUA 2JA7H 1VQ7A 1UE6A 4GLAC 3FHWA 4DV0L 3T1HL 4DR1Q 2GVBA 2VNUD 1AH9A 1VQAA 3U4VA 2E2HH 4IJLA 4A3GH 2R93G 5FLMH 1T9HA 2B29A 1FJGQ 3IRBA 1UE5A 1MJCA 4DR2L 5LMNL 1K8AC 5C3EH 3CC4A 2BH8A 3LGJA 4LNQA 3NELA 4P75A 4DV5Q 3GTKH 3S2HH 4GOPA 3EN2A 3L0OA 4R4OA 1K73C 2RF4A 5IP7H 5IT9c 1SROA 2JA6H 4LFBQ 3KDFB 1YI2A 4A93H 3H0GH 2UXCQ 4JI5Q 1YITA 2A19A 1IXRA 3I4OA 1A62A 3GTQH 5M5YH 3S16H 5IWAL 1Q1BA 1Z9FA 4P74A 1KC8C 2UUAL 1XMQL 5GAGC 3F2BA 1PH6A 3HOUH 1N8RC 4DV1Q 4BBSH 4DR5Q 4DR6L 4YCUA 2CWPA 3D0FA 2PI2E 1ASZA 4LF9Q 1TWGH 1PYBA 4BY7H 4JV5L 1H95A 1EQRA 3PO3G 4AH6A 3PO2G 1Q81C 2ATWA 2VQEL 4X6AH 1X56A 3HOVG 4A3EG 4POFA 1XPUA 4L5RC 4BBRG 1GO3E 4QJFA 4LWCA 5FLXc 1J5EQ 4A3CG 4JI3L 4QL5A 2K5VA 3ULJA 2VW9A 2K50A 1VQ5A 4LFAQ 2JEBI 5IP9G 3M4OH 5IYCH 2YU9H 1VQEA 1B7YB 4NXMQ 4A3BG 3G4SA 2ZTDA 4JBJA 1CKOA 1MJEA 3GTMH 4WJ3M 2JA9A 1HH2P 1BKBA 1L2FA 3K8AA 4FDBA 3I4MH 1S72A 1VQNA 4GKJL 1VQCA 2AWNA 1HNZL 3ULPA 1K9MC 1WCMG 4X62Q 3RN2A 1VQGA 5LMUL 3CD6A 4A3MG 2MQHA 4HJ8A 2QA4A 1VQMA 4PG3A 2MO1A 4DV6Q 5AJ3L 3KF6B 2EIFA 5EAYA 5M5WH 1PH5A 4OXPA 1LUZA 2Q2TA 1VQOA 1VQKA 2K52A 2HT1A 2K5NA 4EQ5A 2D0OA 1N33L
chains in the Genus database with same CATH superfamily
3HKZG 1I6VC 1L0YB 1CKNA 1ESFA 2ZM6L 4B3RL 1L1OA 2EZVA 2F0NA 4BY7B 4DA2A 4LF7L 1I4XA 2PYKA 2R92G 4XQJA 1HNXQ 3PIOA 5C0XG 3ZJYC 2IHEA 2ID0A 3SEBA 4BWGB 5FJ8H 3KOJA 5CV6A 1Q1EA 3HOZG 4EGVA 1QZHA 4KI0A 2NWGA 1Y1WH 1SNMA 1VS0A 4JI2Q 2B8GA 1C7YA 1GJXA 1SYCA 4DFAA 2I07B 3M85A 3KFUA 2KHIA 3MFGA 1X3EA 2JA5B 2R61A 3HFZB 1EEID 2M9VA 4LFCL 3V2TA 4DAVA 1QZGA 4NKLA 2F0QA 4IFDJ 1D5MC 2VY3A 2QEXA 2MJ8A 1XNRQ 1JE4A 3A7AB 2A1AA 4MIUA 2EYJA 4F7XA 1WTPA 4ZKCB 3DEOA 2EJGC 4JI0L 2AUKA 3D4WA 1VCIA 3WOEA 1IHZA 1XMOQ 1VQ9A 2UXBQ 5K36H 2OF1A 1JWSD 3P7JA 1STYA 1I4QA 1GD7A 1VQLA 1BUVT 3EBEA 3PUYA 1ILQA 3SDZA 2WAQE 4HIMA 3A5ZB 1WFQA 4R4CA 5GAEC 2E74C 2Z8LA 2G5DA 1Y1WB 1H9SA 1PMRA 5JJIA 1A15A 1AEXA 2EY1A 1XPOA 3NPPA 3STBC 4N9TA 4A3FG 1E7ZA 3M3YH 1GUNA 2Q2HA 2WFWA 2K5QA 2VZAA 1YNND 1BR9A 5KNDA 4KHZA 1XNQQ 3HOYG 2KCNA 1N32L 4A3IB 1ICWA 4NXNL 1EL0A 1ENCA 4BBSG 4L63B 3E9IA 1HR0Q 1KLUD 4X65L 1QG7A 3DM1A 4X64L 3BZCA 1U9RA 2K32A 3GTGH 3F8TA 2R93H 3M4PA 1Q8KA 3D31A 1EWIA 1HTLD 1V1PB 4RHRA 2F0JA 1YBYA 1GOZA 2RDGA 3LWUA 5LMNQ 2Q2UA 1BCPD 3CC2A 4HEDA 5IT9E 3QG1A 3NSWA 1EWHA 2K01A 2NUCA 3R3OA 3JAML 2BCOA 3M3YB 1U4MA 1EIFA 1G51A 3RMHA 2I0QA 5EBDA 2NVQH 3U9OA 3CHBD 1A3VA 2IPKD 4LW1A 5JOBA 1ZKOA 4HMIA 3MEHA 4CDCC 3HOVH 1HXYD 2PCFB 2UUAQ 1XMQQ 1GUGA 2KCCA 4U68A 3UE0A 3H15A 4TRDA 4UPAA 4A3KH 2F3WA 4LF8L 4JV5Q 4RMFA 2MP1A 2R93B 3BDLA 1STEA 1PZJD 5EKIA 3MXUA 3SHLA 4JI2L 5D14A 3NK9A 3BVGA 1NUCA 5FOBB 1VQBA 2UU9L 1QNKA 2TMPA 4YY3L 2XRQD 3RLNA 5FKAC 5FO8B 1EOTA 3A8JE 5EKKA 1O7LA 1MKHA 2JE6I 1X65A 4A3MH 5HGQA 4RA8A 1I94L 3GV3A 2C35B 1XNRL 2B2UA 4V190 4UP8A 4GKJQ 2J0TD 1TVXA 4GN5A 4ZK9B 4OX9L 1HNZQ 1GUSA 2PMZE 1S5FD 5GADC 3O13A 4POGA 1JOOA 5EKLA 3KBXA 3HOVB 3PSIA 3BYTB 1NCVA 1N33Q 5CC4A 3OYYA 1E2ZA 1N9WA 4IFDI 2A68D 2I5LX 1SEBD 4ZRZA 5GROA 4A3KB 1JOKA 2I46A 1VQ6A 4H02A 3T16A 2RVLA 3KDFA 1KABA 1EZ8A 2SNSA 1CKNB 3NENA 1A63A 3CCRA 1HFGA 1Z6HA 4K2LA 2XWJB 4LK1C 3TP6A 1VF7A 4IZ8A 4A3GG 3KBGA 1PFNA 5FLMG 1K3BC 4I65A 2F3IA 4LFBL 4DK1A 4A3MB 3N52A 5I6YA 4QUCA 4DV7Q 4MTKA 1VQ4A 1B3AA 4LMQD 2HQLA 5J39A 2A8VA 2CQAA 1O7YA 3ULLA 3GO5A 4A93G 1D1KA 2WP8J 3OOCA 5ELNA 3OTOQ 4C3IH 4WJWA 4G4KA 1NBWA 1GHJA 1EYCA 1WTOA 1L1OC 1OXXK 4ULLA 1WD1A 3QB3A 1PTOH 4BY7G 1NMFA 3D3RA 2FHTA 2RA4A 5DLQE 2E5LQ 4GLXA 4FO2A 3CCLA 5IOCA 1JORA 4JOIA 1O78A 1OXVA 2LSSA 3QJYA 1Q82C 1UEBA 4IURA 1L0XB 3U50C 5IYCG 3K5LA 2QW7A 1IKLA 5CBAE 4L5QA 1GXDC 2AUJD 1QVGA 2F0HA 4IPGA 4JBKA 2R6GA 1QUQB 1E3PA 1KHIA 2JA5G 1CA6A 2L12A 2Z0SA 1H9SB 2EE1A 4C3IB 3PUVA 2V4DA 4X3TA 4QUFA 3PO3H 2WKDA 5I2YA 3J7AV 5JEAG 3L2PA 1HZAA 1KDCA 2LXJA 5C5LA 1ET6A 1STHA 3AFQA 1QE6A 3H94A 1SSOA 4C3HH 4C3JG 1JJGA 2H1EA 1LT3D 4JI8L 2PW5A 2X69A 3R2TA 4DUYL 4A3BH 1PLFA 1K0RA 3D4DA 2K4KA 3ERQA 5FJ8G 1JC7A 2DJGC 4DK6C 1PHJA 1UNSA 1WCMH 1Y1WG 4YHHQ 3S16B 3HOWH 3OSOA 5KNCA 2MNAA 1RL2A 3HOUB 4CKBA 4MHEA 2Q8RE 3BDCA 4IPCA 3UDXA 1PTOC 1H9MA 3M7GA 4DV2L 4DV4L 2C9OA 2HIVA 1R9TH 4A3IG 2F03A 2D0PA 4K2KA 2XN9C 1E1TA 4O0AA 3PO3B 1GKHA 1U0LA 3OIPA 3NXWA 1CTMA 5M3FH 1B9NA 4JI6L 4O42A 1A0IA 5C0XH 1SE3A 4FXKC 4AIMA 1P8LA 4HIDA 4C3HB 2ZTCA 3ER0A 5CGKA 2VQFQ 3HOZH 4A3BB 1H9JA 3EFXD 4HCSA 1LLRD 1K8GA 1ZYRC 1F77A 2HCCA 3CCMA 5E4WC 1PRTB 2M2LA 1N34Q 3HRZC 1WCMB 2R7FA 3HOWB 2QEJC 2FMMA 1DOMA 1PH3A 3K7UC 3K0YA 3EVQA 3CPFA 5JAVA 1PFSA 4OELB 1UE1A 3P20A 1BOSA 1LM0A 4KY5A 3CCUA 1QB5D 4R4TA 1R9TB 4Y7NH 4DR3L 2K6AA 1MHWC 3RN5A 1SRUA 2IJ0A 2BE5D 3QOJA 1UE6A 4GLAC 3FHWA 3RUZA 2KQ3A 4DR1Q 5C3XA 4E6IA 2F0LA 2EYFA 5M3FB 1AH9A 1QNUA 2E2HH 1PRTC 2R93G 2VXWA 4H0LC 2HDMA 3S9WA 2QILA 1K8AC 3K5NA 1LTAD 3CC4A 3HOZB 1S4ZA 3NELA 3GTKH 4CHTB 3S2HH 3R93A 3EN2A 1ILPA 1CI3M 3KDFB 1YI2A 2F0TA 1QILA 2B2UC 4JI5Q 4DNRB 1IXRA 4ABNA 1A62A 2F0UA 2PQEA 1EYAA 5G3LF 4X3UA 5IWAL 1Z9FA 3DWQA 3ND9A 2UXCQ 2K04A 1N8RC 4DV1Q 4BBSH 4DR6L 4YCUA 3GV6A 1HQMC 5TSSA 3TZUA 4LF9Q 1TWGH 1G6ZA 4X6AH 2ATWA 3FPUB 1ONLA 1X56A 5C4ZA 3HOVG 1XPUA 5DM73 3ONAB 2WAQB 4M8AA 4QJFA 1J5EQ 4XT1B 2K5VA 5BN4A 3ULJA 2E2HB 2K50A 3BG3A 1EIGA 4MN3A 3M4OH 1B7YB 4M1UB 3F2UA 1MJEA 4JBJA 3GTMH 3FMCA 2AQ1B 2JA9A 4FDBA 1BKBA 3GTKB 1X32A 1FNWA 4CGYB 1VQNA 4BS9A 3CD6A 2GA4B 4A3MG 4HJ8A 5NUCA 1AW7A 4OXPA 1VQOA 2QGQA 2K52A 2A19A 2K5NA 2HT1A 1SMYC 2CQOA 4NW2A 4HCEA 5GQOA 2E2JH 4IFDG 3DMUA 3T1YQ 4QF4A 1KAAA 3GTJH 3J7AF 2RCNA 3NBIA 2CVRA 4DR4L 5CR3A 4XQQA 3PIO3 1E0BA 1LTGD 3BZKA 3S17H 4C2MH 4BY1G 2FMCA 4R4QA 1YJWA 4CDEC 5DEHA 3M4OB 1DD2A 4JOIC 1BQQT 1TWCH 2WIIB 2OT2A 3I70A 1B50A 2NVXH 1PYWD 4KKUA 5H1SE 3NHHA 2LXKA 4LF5L 4OGQC 2KBNA 2O5JC 3BJUA 4UAIA 1FVIA 1MI2A 1II3A 2Z6KA 4KY6A 5EBCA 2K33A 1EY0A 1I3QH 1HNWL 2KHSA 4NP5A 2E2JB 1Y1VB 5EQ0A 3CKIB 4B3SL 3VA5A 2NZOA 3K0XA 1STNA 5ELOA 1EEFD 4R8NA 2EXDA 3G6JB 3PUZA 1OXUA 3CCQA 3CRLC 3NBHA 1NSNS 4DN4M 3AQQA 1K3RA 4C2MB 4MNOA 3S17B 2N55A 3M4YA 2WACA 1MD2D 4IPHA 1EQVA 4LF4L 1M90C 4DV3Q 1W6JA 2NVTH 1F2LA 2PMZB 3FDTA 2NVXB 1PZID 3NTHA 1IYJB 2FFKB 1TS2A 4JI4L 1JICA 2A69C 1JJ2A 1SJHD 3A54A 4JYAQ 2N3SA 3HOUG 1YJ9A 1I3QB 1DGSA 1EUJA 1KDBA 1SYFA 2MPMA 1G291 3NWSA 2E2DC 4GKKQ 1MSGA 1Q12A 1DOKA 3VR2A 4HJ9A 3F2DA 3T1HQ 4RGOS 4DV0Q 2F0SA 5GAHC 1RTOA 1V9PA 2HCIA 1AE2A 3PCOB 1JR0D 1V8QA 3U4ZA 3BS1A 5ELDA 4EVOA 4C3HG 3A55A 1D8LA 1NJIC 1PRTF 3I4MG 2CHBD 3PGZA 2PZWA 2CCZA 3I73A 2NVTB 2PPBC 1A6XA 4OIJA 1EYGA 4AYBE 2PZTA 2QDLA 3WOFA 1IL2A 1KL9A 3S1MB 1ENAA 1PZKD 2RHQB 3TS0A 2JA5H 3HOWG 1D6EC 3E5SA 1RTNA 4OO1I 3PO2H 5ELEA 1SYDA 2BOSA 5KYLA 5I6WA 4A3EH 4UHVA 1EIYB 2NB0A 3U58A 4X66L 1KNEA 1VF5C 2F0MA 4BA2I 5HURA 1QVFA 2KUMA 5JEAH 4HIOA 5JJKA 2VQEQ 1CK1A 1QCBD 1VQDA 2LY7A 3TMEA 4JC0A 1XYIA 2RBMA 1SBBB 5M3FG 4C3JH 1VMPA 3E9HA 1HZCA 3T51B 2F4VL 1VQIA 1KD1C 3CCEA 2KJXA 2IWHA 1OTCA 1HA5A 1TIID 1SYEA 2I5HA 2LKVA 3M7NA 1SNCA 1K8MA 1XTCD 1SNOA 2RSNA 2P5ZX 3MTSA 2DJFC 2K05A 4AQYL 3KF8B 3K80C 4DNIA 3LNNA 1K0SA 3PO2B 1LTRD 4A3IH 4A3JH 4A3EB 3PMFA 4OIKA 2K14A 2NBFA 4DUZQ 2JSOA 2F0WA 2HHHQ 1B4OA 1TWHB 4Q0FA 1FJGL 5CV8A 3GQBA 1A8VA 2WAQG 1YHAA 4TQUS 1BCPB 4DV5L 3MXPA 4C3JB 4K0KQ 4K6DA 2D62A 2ALYB 4TKOB 5FO7B 1D1IA 2CH4A 1PH2A 4YWKA 4B3MQ 5IGEA 2OQKA 3RLOA 4OWXB 1QUQA 4NB3A 1SJED 2H5XA 2QF7A 2F3VA 2L5TA 4DR5L 5KGUA 4YWMA 1JQYD 1J9OA 2XSCA 1IBLQ 2OCEA 4K5WA 3TBIB 4A3JB 2K5HA 2NVYB 1D7QA 3A5UA 3Q0AA 2L11A 2BA0A 1CQFA 1GUOA 4LFAL 4KD3A 4RGNA 3TP7A 4ME3A 2NYZD 1K28A 2JYOA 1DONA 4OWWB 1LABA 1XWEA 3R2IA 3M4QA 4KHPQ 3KF6A 5KIXA 3TREA 1NTGA 5J3BA 2A6EC 3MZ5A 1G91A 3S15B 1ENFA 2ES2A 4ME5A 2WKCA 3AEVA 4IPDA 3NBHB 3WWVA 5C4XH 4ILWA 1YZ6A 4LUVA 2EYOA 1EIHA 1WYDA 4IUQA 4R4IA 3Q22A 3CCJA 1FR3A 1QVCA 1M4VA 2J7ZA 4LUZA 5M3MH 2Z6KC 1SXTA 1YEZA 3CW2C 1FYCA 1D2BA 1PA6A 3STBD 1SLJA 2NN6I 3GDEA 2L15A 4P73A 5L37A 1Y1VG 4IUUA 1HNXL 5CV7A 5T1IA 4ALPA 2B3GA 4RGTA 4RCNA 3CXCA 2K75A 3A56A 1B70B 2BDOA 4N9PA 4YWLA 2UUBQ 1TXYA 1JOQA 2IX0A 2JA6B 2YYZA 3CQZH 2EXZA 2IW3A 2OQ0A 3OHXC 2F0IA 3QO2A 1XX8A 5C4XB 4HAEA 1CHPD 1PH1A 3RZDH 3SK8A 5F2DA 3ZYYX 4ZCKA 3DUZA 1GVPA 4R8IA 5A2QE 2NZHA 3H09A 3W2DA 2N49A 5M3MB 1HTPA 1XMOL 4IFDH 4DKAC 2UXBL 3T56B 1PH7A 3TRZA 2ZXPA 3VR5A 1ZXTA 3KLWA 4PZ7A 4I7ZC 2UXDQ 3NUCA 1OO9B 1IW7C 1HUMA 1KDAA 2KOLA 4JW0A 4L8JA 2GVAA 4DAYB 4BY1H 3LWEA 2XTIA 5AFWA 2H4OA 4DAPA 1A2UA 3CQZB 4QB4A 2ENBA 1B9MA 1XNQL 4XT3B 1SN8A 4L6TB 3S24A 3Q24A 5DM63 1I50H 2D9UA 3RZDB 3KLSX 2F0OA 3I72A 3T13A 4A75A 3CCVA 1HR0L 1PFMA 2G9HD 2CW0C 2V1CC 1DJRD 4DPGA 2VUMH 1VDZA 1VQHA 3C1FA 4FNFA 2RKSA 4J8QA 1EU3A 2MGSA 4F88A 2D2CC 4XYOA 1VQAA 1XXGA 1I4HA 4IJLA 1B3QA 4BY1B 1MJCA 3LX0A 5LMNL 4ZKBB 1O7ZA 2A6HD 2BH8A 4R4OA 5IP7H 2B8FA 1QOHA 2RDHA 3CU7A 1I50B 2WV6D 3IFTA 3S16H 1Q1BA 1SNPA 2UUAL 1XMQL 1PH6A 3HOUH 4K5VA 1TR5A 1K8OA 4G7OC 2XIWA 2PI2E 4TSSA 1HRJA 4JV5L 2VUMB 4AH6A 3PO2G 3NTKA 4XQNA 2RQXA 4A3EG 1KTKA 5IGCA 2SNMA 3KLSA 1EY7A 1D5XC 4FP5D 2VW9A 4EQNA 1I6HB 4KN7C 2YU9H 4NXMQ 1AZPA 1Q8IA 3G4SA 3R8BA 3H91A 4WJ3M 3I4MH 1S72A 4GKJL 1HNZL 1UEAB 4X62Q 4PNYA 3VA7A 2Z9HA 5M5XB 2RCFA 1VQMA 4DV6Q 1GUWA 3KF6B 3HEJA 5M5WH 1PH5A 5J1ZA 4EQ5A 1N33L 4L5SA 3K59A 2EYMA 3UDFA 1PYSB 2PNHA 1XJVA 4IUPA 1UE7A 3K6OA 2HD3A 1Z47A 4RKBA 4A3JG 1PH4A 4LF6Q 1LO5D 5IODA 1EY9A 2F0EA 4B3TQ 3M9BA 1WTRA 2B2YA 5C3WA 1Y69U 2F0PA 1W6KA 1X3FA 5IT9L 2YU9B 2M00A 4DV7L 4AYBB 2KENA 2B63B 1JB3A 2XNAC 2BE5C 4JI1Q 3I4MB 1P16A 1KLGD 1IBKQ 2OWOA 3SK5A 3PQIA 4HSVA 4APVA 4A3DH 1PFBA 1X55A 3KYHC 4A3LH 3C1EA 2CWAA 4JI7Q 1F9RA 3OTOL 1X6OA 3DHQA 5M5WB 2YTVA 3FKIH 4KMUC 1SR3A 1XPRA 1SYGA 5CV5A 2E75C 3MWYW 1IBMQ 4J15A 3NE5B 1HCZA 2JA7G 1Y8PB 1FGUA 1FNUA 4UY8C 3PIP3 2E5LL 1HUNA 1LTID 1MBYA 1PTOD 2WB1E 2KCTA 3IFDA 2Y0SE 3I55A 3S1NH 1KRTA 5IIFA 3QR8A 3KJPA 5A2QL 4HIKA 2JA8B 4B9WA 3K5OA 2JA6G 5J22A 4FF3A 3H0GG 4A3DB 2DY8A 5EGTA 4QIWE 1N36Q 1TWFB 4KN4C 4QMGA 2UUCQ 3F2CA 5C4XG 4IOCA 1BBWA 2X6GA 2VB2X 2J4XA 2NN6G 4J1MA 3E6ZX 3FKIB 1GM5A 2JEAI 2XWBB 5M3MG 3D6CA 1EOVA 2I5MX 2ZXRA 1BF4A 3D8GA 5BR8Q 4ZUJA 5CV4A 1RIPA 2L4NA 3MFYA 2AKWB 4FF4A 2B2TA 4U673 5E7NA 2QDBA 1VMCA 1GHKA 3CCSA 1LT4D 5CORA 2YV5A 1F9SA 3S1NB 3C3LA 1LYLA 1U4LA 4R9WA 3TSSA 1SDFA 4DR2Q 4YHHL 1E2WA 3KF8A 3Q23A 1Y14B 1AFPA 3MXNA 1LTBD 1Q3LA 1RJTA 4PZ6A 1EZ6A 2L0CA 3GTLB 1HJPA 4YCVA 1AP0A 1I4GA 5K5PA 2MUYA 1JWUD 3SK4A 3J80E 2YTXA 3L3OC 4BBRH 4A3CH 1Y1VH 4QY7A 4C56C 1TKWB 4P71A 1U4RA 3MXGA 3TZDA 2EPBA 2VQFL 3Q8DA 3D6WA 4RAUC 1LT6D 2E76C 4JI3Q 4HJAA 1NNXA 1PVOA 3V96A 4P72A 2B2VA 4A4IA 4JI7L 3AMUA 1N34L 3TEHB 5LMNW 1FGBD 1I5FA 4CJ2C 3EQLC 4PMWA 1WJJA 2F4IA 4KK7A 2B2WA 2LFNA 5IYDG 1GUTA 5LMUQ 1YHBA 1F9PA 1BBUA 2K5WA 3CRKC 5AJ3Q 1K83H 3HGBA 1IYVA 3GTPH 4DR1L 1Q7YC 2EJFC 3F1ZA 1UAPA 4BBRB 3JAMc 4LUOA 3S14H 3MC0B 2DNEA 4Y52H 2ZM6Q 4B3RQ 3ERSX 4DU9A 1ET9A 2VUMG 4PZ8A 3JAMi 1SMYD 2ASBA 4LF7Q 2IHFA 3H3VI 3PF4A 3HG9A 3SK6A 1TS4A 1B8AA 1L0WA 1CKMA 3AU7A 5BN3A 2ZJPA 3DEPA 4IN3A 2YTYA 3A7LA 1H9RA 3PIPA 2DY7A 3EIVA 4DK0A 1AN8A 5KNBA 3FP9A 3J81E 4JI5L 2EY5A 1KXLA 1EWCA 5FO9B 4BXXG 2UXCL 5LL6X 4DV1L 1LTTD 5IP7G 3NP8A 2NZ1D 4XTCS 4HR7B 3VYSA 4LF9L 2ZJQA 4LFCQ 3FVQA 3T4AC 3S1MH 1OXSC 1K83B 1OXTA 2KHJA 3OWFA 3GTPB 1EQTA 3S14B 2EYLA 1J5EL 4CDFC 1CSQA 2PQAB 3W3AA 4JI0Q 2MO0A 1STBA 2E8GA 2IX1A 1AE3A 1YNXA 2O2LD 4NPSA 3DWPA 4GN3B 4DF7A 2WINB 1X3PA 4WFN3 3PF5A 1G2SA 1YNJC 2L55A 1WTHA 5ISRA 3A8IE 1CA5A 1Q90A 1V43A 2KECA 1EYDA 1BO0A 4AYBG 4WORA 2B63G 1WI5A 4OO1H 1CHQD 4IJHA 3EROA 4FF1A 3T1YL 4DGZA 1PDQA 4HSPA 4H13C 4IALA 1O7IA 2VS1A 4DNTB 4JG2A 2L1BA 5JJLA 2KCMA 1SYBA 5EPJA 1N32Q 3BDOA 4NXNQ 1TY0A 4DAYA 4KKTA 1BDOA 3I7FA 4X65Q 2A69D 4X64Q 5A35A 3HP3A 4RHSA 3KJOA 5C3EB 3RNUA 5FLXE 5C44G 1TWHH 2KA7A 1EY8A 3VDYA 2OTLA 4R1JA 3AFPA 5DAUA 4LAAA 1EY5A 5KEEA 2HDLA 3PUWA 1WTXA 1X9NA 3ICEA 5DNFA 4S3SA 1JT8A 1T5XD 1YIJA 2EYHA 5M5YB 3CAMA 2JA8G 1J6QA 5JVH3 1DYQA 1Z7TA 1R4PB 4A3DG 4IQZA 4O1NA 4A3LG 3MA2B 2R7ZH 4RWSC 4FYDA 1XTDA 2F0FA 3HKZE 3MXNB 4GLVB 4KJNA 5KRUA 3KK7A 1W3SA 4MTNA 3FKIG 1LTSD 3SXHA 2AQ3B 2K28A 1LTLA 1JE5A 2C5CA 3G71A 2NVYH 4DR7Q 2N78A 1E24A 4LF8Q 1EFWA 2B2TC 1YNNC 2NTTA 5CV9A 4DV3L 1EFID 4GZYC 3E0EA 3EJIA 3SGIA 1A2TA 3J7YW 2UU9Q 1PXUA 3J7ZC 4YY3Q 2GN5A 3J80L 5C6AA 3S15H 1ESRA 4FF2A 4Z9CB 4JYAL 1I94Q 3NTIA 2ZXOA 3HOXH 3GTOH 3DXJC 5IY0A 3L7ZC 3SE0A 4HMJA 5CYUA 1HPCA 4OX9Q 3HZXA 4GKKL 4DXGA 2R7ZB 1LT5D 4KY7A 5IYBG 3MHBA 1S3OA 2HQEA 2JA7H 1VQ7A 3T1HL 4DV0L 1C48A 1NR4A 1BCPC 1RKNA 2GVBA 4RCOA 1WVLA 4IUNA 4PQXA 3I90A 4ID6A 3FRPB 2VNUD 2LS01 3U4VA 1G2TA 1JCKB 4ODGA 1T9HA 2B29A 3IRBA 1BNZA 3LGJA 4LNQA 5D3IB 1RODA 3AB9A 4GOPA 2B2VC 1K73C 2F0DA 2K03A 2RF4A 4H44C 3K5MA 5IT9c 2JA6H 4LFBQ 4XXEA 3H0GH 2A5HA 4HN7A 3OIQA 3VR4A 1YITA 3GTQH 3I4OA 2B2WC 3HOXB 3GTOB 2PNRC 5E3FA 2NN6H 1KC8C 3F2BA 2D5DA 1PYBA 1H95A 1EQRA 1MGSA 1Q81C 2VQEL 4CKEA 2WB1B 1RD9D 4POFA 2Z6BA 2JA7B 4L5RC 2Y0SB 3VYUA 4BBRG 1GO3E 1M8AA 2OXPA 4A3CG 4QL5A 2F0GA 3J81L 4FVMA 5D65A 5IGDA 1VQ5A 3OW7A 2JEBI 4K8IA 5IP9G 5IGGA 2A74C 2EVBA 2ZTDA 3X3MA 4QIWB 3K8AA 1HH2P 5C5MA 1L2FA 5BN5A 1CT1D 2AWNA 3ULPA 1FNVA 2MQHA 4RGMA 2A68C 3H0GB 4I7AA 2QA4A 5EAYA 3GTQB 2Q2TA 1VQKA 2A6ED 2JN4A 4GNXA 4DR7L 3JC66 2DGYA 3GTGB 1BVSA 4DUZL 2R7DA 1T5EA 3U9SA 4B9XA 1KAWA 2EY6A 2HHHL 3K58A 3PV0A 3W5OA 4UP7A 5T1GA 3Q6SA 5C4HA 2DN8A 4DXFA 4K0KL 3UDIA 1WTWA 5ELBA 2N88A 3MVVA 4B3ML 4OONA 4YIJA 4RG1A 3GD7A 2FXQA 4EQOA 1NAPA 2Z4IA 4JI8Q 3NQTA 2ICIA 4DUYQ 4B08A 1HFNA 2FINB 3A0JA 3BYYB 2NVQB 1B2TA 2B39A 4UDUC 1WOCA 5LL6S 2A73B 3S1RH 1IBLL 5IYDH 1U4PA 4A76A 4RKLA 1C0AA 3I4NH 2VL6A 2A6HC 4UP9A 1TQOA 4GN4B 5C4JH 3RZOH 5FLXL 1ASYA 4CKCA 3SVMA 4DV2Q 4ZAIA 4DV4Q 5EJWA 1SE8A 1S5CD 3I8ZA 2KEEA 3AYHB 1L1OB 2OEOA 2JK8A 1DXMA 4KHPL 5C0XJ 3TS2A 5I9OA 4JI6Q 2EOTA 4OEMB 3P75A 3L9AX 5C3EG 4C1NI 1LACA 1H9KA 1I6HH 1TS3A 2F1MA 4OWTB 5HY6A 4G7HC 1EY4A 4CBVA 1IW7D 4RH6A 3J81j 1A3UA 5LHY1 5CMDA 2EY2A 4BXXH 4JK1C 4J6HA 3S1RB 3EA6A 3I4LA 5M5XH 4OO1G 3I4NB 4NMZA 1CQVA 4X3KA 3V05A 5C4JB 2BDNA 1ICFB 5CBEE 3RZOB 2TSSA 3CPWA 1Q86C 4O2DA 5G3LD 1PH9A 4DR3Q 1X54A 3CMEA 4XDXA 1S5ED 1JWMD 3CP0A 1STGA 2ZJRA 1TT2A 3G7LA 2CW0D 1FL0A 3K57A 2UUBL 1G6PA 1Q46A 1UWVA 1V1QA 2Q8IB 1BCPF 1C9OA 4WRDA 1SFOH 2XVSA 2MFIA 2B63H 4YCWA 3BU2A 4LJZC 1ZEQX 4KLKA 4IOAA 1B1ZA 3QWNA 1C4QA 5I9PA 3UDGA 2XGTA 2N8NA 4GOPB 5IWAQ 3NWTA 4HJ7A 1YJNA 4EQPA 2UXDL 1PTOB 1V1OA 3DM3A 3X3NA 4DR6Q 2R7ZG 3MEFA 2BA1A 3HKSA 1O80A 2MHVA 4DK3C 1X3GA 1WTQA 2AMCB 3VR3A 1F9QA 5C44H 4EX5A 4K6LA 1M1KC 1CM9A 1MSHA 1W2BA 2Q2IA 4K8JA 1F2YA 3N6RA 4G57A 1Y8OB 2EQSA 2ZT9C 1QJOA 5JVG3 2O5IC 1SFOB 4GOPC 4ZUIA 3UE1A 1E1OA 2RSOA 4CJ1B 2JA8H 3IKJA 3MAQA 3BVZA 1Y8NB 1F2MA 2IY5B 4WJ4A 4FXDA 4CDDC 1TWFH 3CF5A 2PQAA 3PUXA 3B6YA 3HOXG 4GS3A 2RHSB 4ZLTF 2BH2A 1SAPA 1EU4A 1KRSA 2CH4W 4OL7A 2R92H 2IX3A 5K36G 1CZWA 1CSPA 1S40A 3I3CA 1KIXA 4QGUA 3A74A 2NTSA 1DZ1A 1VQJA 3CC7A 2WB1G 5HGTA 3IAYA 4DR4Q 4GNXB 1NR2A 2Y0SG 2AWOA 1PV4A 5C44B 2PZUA 4F8MA 1HHVA 5C0XI 4H7BA 1JB7A 1G8ZD 4K14A 3K81C 3HS0C 2EDGA 3FEWX 3G48A 4MZ9A 1B44D 1J8IA 4QCLA 3S1QH 2R3ZA 1HZBA 3HKZB 3J7A5 2XRSD 1SNQA 4LF5Q 3GTLH 1CZGA 2SEBD 1KNAA 2KVMA 1VQPA 1RF2D 4GNXC 4K5XA 5IYBH 1HNWQ 4JVZA 1ZYRD 3NEMA 2JP1A 3IL8A 2IT1A 2VB3X 2R92B 1U5KA 4B3SQ 2G9DA 4IO9A 2AHOB 3OMCA 1E22A 2K5DA 1D5ZC 4CJ0B 4NXML 1VQFA 4TVAB 3DLLA 2CFMA 1FD7D 3K7AH 1PH8A 3OPOA 3D4RA 1IYUA 4KV6A 1TS5A 4X62L 4A3FH 1S5BD 2PI2A 4LF4Q 3W1GA 3OMGA 2O4XA 4N8FA 5EPLA 3SR1A 3RLFA 4DV6L 3KLRA 3HOYH 2F52A 3P1HA 5IGFA 5JJZA 3S1QB 3G6EA 1TWAH 4PV1C 1PRTD 4JBWA 3OWEB 3J80c 4Y7NB 1R4QB 3BZDB 4JI4Q 5JPMC 2FJ2A 1IZ6A 4LF6L 3J80i 2OTJA 1RDPD 5KYIA 2ZTEA 2EYPA 2Z1CA 1CFMA 4B3TL 4A3KG 1HR0W 2QCPX 1IL8A 4XIGS 1SE2A 1RHPA 4HTHA 4KHVA 5IP9H 3S2HB 1I4RA 4JI1L 1EY6A 3UI2A 1HZ9A 3K7AB 1IBKL 1DOLA 1TU2B 5IE8A 1NMGA 4A3FB 3E3XA 2CKZB 1STAA 3TQYA 3HOYB 3VYRA 3URYA 1TWAB 4BBSB 1UUPA 2EJMA 4FXGC 5ELFA 3I56A 5I2XA 1TWGB 3H6MA 3NQIA 4JCVE 2JJQA 3RD4A 1IBML 1B53A 5IGBA 3I4NG 2RDFA 4V0BA 3H3VH 3C46A 5JEAJ 4X66Q 2K7VA 3KUPA 1C8CA 3FPPA 4XYQA 3RR5A 2DUDA 2L9HA 4C1NK 1YVCA 2HUGA 4BA1I 1F2ZA 3GTMB 1HA6A 1NY4A 1CUKA 2ICEC 4OHJA 1WD0A 5JPNC 4HJ5A 3OW2A 3J81c 1SMXA 4QQBX 4L5TA 2F4VQ 4N8X1 5I4DA 1N36L 5E4XA 4JBMA 2UUCL 1BBXC 3J81i 2F0KA 2Q8TA 1MIUA 4IUTA 3W1BA 1YHQA 1JMCA 3S2DH 2HIXA 5D3DA 4KJOA 1SE4A 2E2IH 1KQSA 3I2ZA 3GTJB 3BVMA 3T53B 4DAMA 4AQYQ 4PMCA 1V1PA 3VR6A 4C3IG 1AZQA 1PTOF 5BR8L 1VQ8A 1EQQA 3CMAA 3C2PA 3JAME 1NE3A 3I91A 5E1FA 2JQOA 4G7ZC 1JJCB 1DM0B 3VYTA 1LV9A 1DCZA 1TY2A 2DNCA 4A3GH 1QWYA 5FLMH 2F0VA 3ITPA 1FJGQ 1UE5A 4DR2L 1TWCB 2AQ2B 5C3EH 4P75A 4DV5Q 3TN2A 2B2YC 3L0OA 4KTAA 1I4PA 1S5DD 2QKIC 3TDQA 1SROA 2LMCB 1ML0D 4Q5VA 4A93H 3DWAA 3TP8A 2PW7A 2IL8A 2KEDA 2JXMB 5M5YH 3GP7A 3H3VC 3S2DB 4P74A 5ELCA 5GAGC 2E2IB 1RCVD 4DR5Q 4PMBA 2PO4A 1E2VA 4ZQ3A 5FK9C 2SOBA 1X3QA 2CWPA 3D0FA 1BXTA 1HQRD 2Z4HA 4JPBW 4NDXA 4ZYSA 1ASZA 4BY7H 3PO3G 3E0JA 4F87A 4LWCA 5FLXc 1IKMA 4IUVA 4JI3L 3WDNA 4KD4A 5M9OA 5COYA 2X6LA 1WTVA 4A3GB 4LFAQ 3A8KE 4RFBA 5IYCH 1VQEA 4A3BG 1CKOA 1A3TA 1SNDA 3QOLA 1VQCA 4X3SA 1K9MC 1WCMG 4KKSA 3RN2A 1VQGA 5LMUL 3TP5A 1YNJD 4A93B 4PG3A 2MO1A 5AJ3L 2EIFA 5EPKA 4P2CB 3QIAA 2SDFA 1LUZA 3ND8A 2K1BA 2D0OA
chains in the Genus database with same CATH topology
3HKZG 5GQOA 2CQOA 4GNXA 2E2JH 4L5SA 4DR7L 4IFDG 1CKNA 3T1YQ 3JC66 2DGYA 1BVSA 4DUZL 2R7DA 2ZM6L 4B3RL 1L1OA 3GTJH 3UDFA 1PYSB 2PNHA 2RCNA 1XJVA 1KAWA 2HHHL 1UE7A 3PV0A 3W5OA 1Z47A 4UP7A 1PH4A 4A3JG 4LF6Q 4LF7L 4DR4L 2R92G 1HNXQ 3BZKA 3PIOA 3M9BA 5C0XG 4B3TQ 3S17H 4C2MH 3UDIA 4K0KL 4BY1G 3ZJYC 4B3ML 2IHEA 2ID0A 4OONA 4R4QA 4RG1A 1YJWA 3GD7A 5FJ8H 1X3FA 3KOJA 1Q1EA 3HOZG 2FXQA 1QZHA 4KI0A 4JOIC 4DV7L 1Y1WH 1TWCH 2KENA 4JI8Q 1VS0A 4JI2Q 1C7YA 4JI1Q 4DUYQ 1P16A 2NVXH 1IBKQ 3M85A 2OWOA 3KFUA 2KHIA 3A0JA 4APVA 1X3EA 5H1SE 4A3DH 2LXKA 1X55A 3KYHC 4LF5L 1WOCA 3S1RH 2KBNA 2CWAA 3HFZB 3BJUA 4A3LH 1IBLL 5IYDH 4LFCL 4JI7Q 3OTOL 4A76A 1X6OA 1FVIA 1QZGA 2Z6KA 1C0AA 3I4NH 1I3QH 1HNWL 2YTVA 4IFDJ 2VL6A 2VY3A 4UP9A 2QEXA 4GN4B 5C4JH 1XNRQ 3FKIH 3RZOH 2A1AA 4B3SL 1ASYA 1SR3A 1XPRA 4JI0L 2NZOA 4DV2Q 1VCIA 4DV4Q 1XMOQ 1VQ9A 2UXBQ 3K0XA 4J15A 1IBMQ 1SE8A 2JA7G 5ELOA 1FGUA 4UY8C 2EXDA 3AYHB 3PUZA 2E5LL 1OXUA 3CCQA 1L1OB 2JK8A 1GD7A 2QGQA 1VQLA 5C0XJ 4KHPL 3TS2A 3EBEA 3AQQA 1K3RA 2WB1E 3PUYA 4MNOA 4JI6Q 2KCTA 3S1NH 2WAQE 2Y0SE 3I55A 4HIMA 1KRTA 3A5ZB 5C3EG 1WFQA 4IPHA 4R4CA 5GAEC 4LF4L 1I6HH 5HY6A 4OWTB 1M90C 3KJPA 4DV3Q 4HIKA 5JJIA 2NVTH 1XPOA 3J81j 3STBC 2JA6G 1IYJB 4A3FG 1E7ZA 3M3YH 4BXXH 3H0GG 2Q2HA 2WFWA 1N36Q 4QIWE 2VZAA 2UUCQ 4JI4L 4KHZA 3F2CA 1XNQQ 4IOCA 3HOYG 1BBWA 5C4XG 1JJ2A 2NN6G 1N32L 5M5XH 4JYAQ 4OO1G 4NXNL 2N3SA 3HOUG 4BBSG 1YJ9A 1DGSA 1EUJA 3E9IA 1GM5A 4X65L 5M3MG 1HR0Q 2JEAI 1EOVA 2I5MX 3CPWA 1G291 4X64L 3BZCA 4GKKQ 1Q86C 5BR8Q 4O2DA 3GTGH 1Q12A 3F8TA 1PH9A 4DR3Q 1RIPA 1X54A 3CMEA 4HJ9A 2R93H 3M4PA 1Q8KA 3D31A 3F2DA 3CP0A 2AKWB 2ZJRA 3T1HQ 4DV0Q 5E7NA 5GAHC 1V9PA 1EWIA 1AE2A 1FL0A 3CCSA 2UUBL 3PCOB 1G6PA 2YV5A 1UWVA 1V1QA 1Q46A 1YBYA 1LYLA 3U4ZA 1C9OA 1D8LA 1NJIC 4DR2Q 3I4MG 4YHHL 5LMNQ 1SFOH 3PGZA 2Q2UA 2CCZA 2MFIA 3CC2A 1Y14B 4PZ6A 1EYGA 2B63H 4YCWA 3BU2A 4AYBE 4KLKA 4IOAA 1EIFA 1HJPA 1IL2A 4YCVA 3UDGA 1G51A 1KL9A 2I0QA 2NVQH 2RHQB 2XGTA 3TS0A 2JA5H 3HOWG 2N8NA 4LW1A 4OO1I 3PO2H 4GOPB 2YTXA 3HOVH 1EIYB 5IWAQ 4A3EH 3U58A 2UUAQ 4X66L 4HJ7A 1YJNA 1XMQQ 4BBRH 2UXDL 3DM3A 4BA2I 3UE0A 4A3CH 4DR6Q 2R7ZG 1Y1VH 4QY7A 3MEFA 1QVFA 2BA1A 3HKSA 3H15A 4P71A 4UPAA 4HIOA 4A3KH 4LF8L 4JV5Q 4RMFA 5JJKA 2VQEQ 4DK3C 1X3GA 1VQDA 2AMCB 4JI2L 4JC0A 2VQFL 5C44H 3Q8DA 4EX5A 5M3FG 4C3JH 4JI3Q 1VQBA 3E9HA 1HZCA 4HJAA 2UU9L 2F4VL 1PVOA 1M1KC 1VQIA 1KD1C 4P72A 4YY3L 3CCEA 1W2BA 2Q2IA 3RLNA 4A4IA 4JI7L 2EQSA 1OTCA 1N34L 4A3MH 1MKHA 2JE6I 1X65A 3TEHB 5HGQA 1I5FA 5LMNW 2I5HA 1I94L 4GOPC 4PMWA 3M7NA 2C35B 3UE1A 1XNRL 1WJJA 1E1OA 4UP8A 4GKJQ 2JA8H 4OX9L 4GN5A 1HNZQ 5IYDG 4AQYL 3KF8B 5LMUQ 2PMZE 1YHBA 3K80C 2IY5B 4DNIA 5GADC 4LF7Q 4WJ4A 1TWFH 4POGA 3CF5A 2PQAA 1BBUA 3PUXA 3B6YA 5AJ3Q 3HOXG 1K83H 4GS3A 4A3IH 3PSIA 2RHSB 4A3JH 3GTPH 2BH2A 4DR1L 1Q7YC 1N33Q 1KRSA 3OYYA 3F1ZA 3S14H 3JAMc 1N9WA 4LUOA 2R92H 2K14A 4IFDI 5K36G 1CSPA 2I5LX 4DUZQ 2ZM6Q 1S40A 4B3RQ 4Y52H 1KIXA 3ERSX 4QGUA 2VUMG 5GROA 3A74A 2HHHQ 1VQJA 3CC7A 1VQ6A 4PZ8A 2WB1G 4H02A 1FJGL 3JAMi 4DR4Q 2ASBA 3H3VI 4GNXB 1A8VA 2IHFA 2WAQG 2Y0SG 3KDFA 1YHAA 3NENA 1CKNB 2AWOA 4TQUS 1PV4A 3PF4A 1B8AA 1L0WA 3CCRA 1A63A 1CKMA 4DV5L 2ZJPA 4K0KQ 2D62A 2YTYA 2ALYB 1PH2A 4A3GG 4B3MQ 4YWKA 5C0XI 5FLMG 3PIPA 2OQKA 1JB7A 2F3IA 3EIVA 3K81C 1QUQA 4OWXB 3RLOA 4LFBL 3FP9A 3G48A 4NB3A 4JI5L 2H5XA 4DV7Q 1KXLA 4MZ9A 1VQ4A 4BXXG 3S1QH 2HQLA 2UXCL 2A8VA 1HZBA 4DV1L 5IP7G 4DR5L 4YWMA 3J7A5 4XTCS 4LF5Q 3ULLA 3GO5A 4A93G 3GTLH 4LF9L 2ZJQA 2WP8J 1IBLQ 4LFCQ 5ELNA 3OTOQ 4C3IH 1VQPA 3S1MH 4GNXC 2OCEA 1OXSC 1NBWA 1OXTA 5IYBH 2KHJA 1HNWQ 2K5HA 1L1OC 1OXXK 3NEMA 1J5EL 2IT1A 3A5UA 1D7QA 1CSQA 1U5KA 2PQAB 4B3SQ 4JI0Q 2BA0A 2MO0A 4IO9A 4BY7G 1NMFA 2E8GA 2AHOB 2IX1A 4LFAL 1E22A 1AE3A 1YNXA 4NPSA 4ME3A 4GN3B 5DLQE 4NXML 3PF5A 1VQFA 4TVAB 3DLLA 2CFMA 2E5LQ 4GLXA 4OWWB 3CCLA 3M4QA 4KHPQ 3KF6A 4JOIA 3K7AH 3TREA 1NTGA 1OXVA 2LSSA 5J3BA 1Q82C 1PH8A 1UEBA 4X62L 3U50C 4A3FH 1V43A 5IYCG 2PI2A 2ES2A 4LF4Q 3W1GA 3AEVA 4IPDA 4AYBG 3NBHB 3RLFA 3WWVA 5C4XH 4DV6L 3HOYH 2F52A 4L5QA 2B63G 1WI5A 1YZ6A 1QVGA 4IPGA 3G6EA 1TWAH 4IJHA 2R6GA 4LUVA 4JBKA 1QUQB 1WYDA 1E3PA 1KHIA 4R4IA 4JBWA 3CCJA 3T1YL 2JA5G 3J80c 1QVCA 4LUZA 5M3MH 2Z6KC 1O7IA 2Z0SA 4JI4Q 1YEZA 2VS1A 3CW2C 4JG2A 5JJLA 2KCMA 3PUVA 1PA6A 1N32Q 1IZ6A 3STBD 4NXNQ 1SLJA 4LF6L 3J80i 2NN6I 3GDEA 2OTJA 2L15A 4P73A 3PO3H 1Y1VG 2ZTEA 3I7FA 1HNXL 5JEAG 4B3TL 4X65Q 3L2PA 4A3KG 1HZAA 4ALPA 4X64Q 1HR0W 2LXJA 2B3GA 3KJOA 3RNUA 4XIGS 5C44G 3CXCA 2K75A 3AFQA 1JJGA 1TWHH 4C3HH 2OTLA 5IP9H 3VDYA 4R1JA 4JI8L 3AFPA 4JI1L 1B70B 4DUYL 1HZ9A 4A3BH 1IBKL 1K0RA 4YWLA 2UUBQ 1TXYA 2K4KA 2IX0A 5IE8A 3PUWA 5FJ8G 2YYZA 3CQZH 1NMGA 1X9NA 3ICEA 2OQ0A 2CKZB 4DK6C 1PHJA 1JT8A 1YIJA 1WCMH 1Y1WG 3TQYA 4YHHQ 3CAMA 3HOWH 2MNAA 2JA8G 1J6QA 1RL2A 3RZDH 1PH1A 1GVPA 4IPCA 3UDXA 4A3DG 2NZHA 3I56A 4A3LG 2N49A 4DV2L 4DV4L 1XMOL 2HIVA 4DKAC 1R9TH 4JCVE 2R7ZH 2UXBL 2JJQA 1IBML 4A3IG 1XTDA 3HKZE 3MXNB 4GLVB 1PH7A 3I4NG 3TRZA 2D0PA 1E1TA 1W3SA 4MTNA 4O0AA 3FKIG 3H3VH 1GKHA 1U0LA 3KLWA 4PZ7A 5JEAJ 4X66Q 2UXDQ 1LTLA 1JE5A 3G71A 5M3FH 2NVYH 4DR7Q 4JI6L 2N78A 1E24A 2DUDA 1A0IA 3RR5A 1YVCA 2GVAA 4DAYB 4LF8Q 1EFWA 4BA1I 4BY1H 4AIMA 1P8LA 4HIDA 2XTIA 2ZTCA 3ER0A 4DV3L 2VQFQ 1NY4A 1CUKA 3HOZH 3E0EA 3SGIA 4HJ5A 3OW2A 3J81c 1SMXA 4QQBX 1K8GA 4L5TA 2UU9Q 2F4VQ 3CCMA 3J7ZC 4YY3Q 2GN5A 1N36L 4JBMA 2UUCL 3S15H 1N34Q 1XNQL 1SN8A 2R7FA 3J81i 3S24A 4JYAL 1MIUA 1I94Q 3W1BA 1I50H 3HOXH 1YHQA 2HIXA 3K7UC 1PH3A 1JMCA 5IY0A 3GTOH 3S2DH 4A75A 3L7ZC 2E2IH 3CPFA 1KQSA 3I2ZA 3CCVA 1HR0L 1PFSA 4OX9Q 4DAMA 1UE1A 4AQYQ 1VQ8A 4GKKL 1LM0A 3CCUA 5BR8L 4R4TA 1EQQA 2V1CC 4Y7NH 3CMAA 4DPGA 4DR3L 5IYBG 2VUMH 1NE3A 1VQHA 1S3OA 2JQOA 3RN5A 1JJCB 1SRUA 2JA7H 1VQ7A 1UE6A 4GLAC 3FHWA 4DV0L 3T1HL 4DR1Q 2GVBA 2VNUD 1AH9A 1VQAA 3U4VA 2E2HH 4IJLA 4A3GH 2R93G 5FLMH 1T9HA 2B29A 1FJGQ 3IRBA 1UE5A 1MJCA 4DR2L 5LMNL 1K8AC 5C3EH 3CC4A 2BH8A 3LGJA 4LNQA 3NELA 4P75A 4DV5Q 3GTKH 3S2HH 4GOPA 3EN2A 3L0OA 4R4OA 1K73C 2RF4A 5IP7H 5IT9c 1SROA 2JA6H 4LFBQ 3KDFB 1YI2A 4A93H 3H0GH 2UXCQ 4JI5Q 1YITA 2A19A 1IXRA 3I4OA 1A62A 3GTQH 5M5YH 3S16H 5IWAL 1Q1BA 1Z9FA 4P74A 1KC8C 2UUAL 1XMQL 5GAGC 3F2BA 1PH6A 3HOUH 1N8RC 4DV1Q 4BBSH 4DR5Q 4DR6L 4YCUA 2CWPA 3D0FA 2PI2E 1ASZA 4LF9Q 1TWGH 1PYBA 4BY7H 4JV5L 1H95A 1EQRA 3PO3G 4AH6A 3PO2G 1Q81C 2ATWA 2VQEL 4X6AH 1X56A 3HOVG 4A3EG 4POFA 1XPUA 4L5RC 4BBRG 1GO3E 4QJFA 4LWCA 5FLXc 1J5EQ 4A3CG 4JI3L 4QL5A 2K5VA 3ULJA 2VW9A 2K50A 1VQ5A 4LFAQ 2JEBI 5IP9G 3M4OH 5IYCH 2YU9H 1VQEA 1B7YB 4NXMQ 4A3BG 3G4SA 2ZTDA 4JBJA 1CKOA 1MJEA 3GTMH 4WJ3M 2JA9A 1HH2P 1BKBA 1L2FA 3K8AA 4FDBA 3I4MH 1S72A 1VQNA 4GKJL 1VQCA 2AWNA 1HNZL 3ULPA 1K9MC 1WCMG 4X62Q 3RN2A 1VQGA 5LMUL 3CD6A 4A3MG 2MQHA 4HJ8A 2QA4A 1VQMA 4PG3A 2MO1A 4DV6Q 5AJ3L 3KF6B 2EIFA 5EAYA 5M5WH 1PH5A 4OXPA 1LUZA 2Q2TA 1VQOA 1VQKA 2K52A 2HT1A 2K5NA 4EQ5A 2D0OA 1N33L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ G;  5GQO A;  2CQO A;  4GNX A;  2E2J H;  4L5S A;  4DR7 L;  4IFD G;  1CKN A;  3T1Y Q;  3JC6 6;  2DGY A;  1BVS A;  4DUZ L;  2R7D A;  2ZM6 L;  4B3R L;  1L1O A;  3GTJ H;  3UDF A;  1PYS B;  2PNH A;  2RCN A;  1XJV A;  1KAW A;  2HHH L;  1UE7 A;  3PV0 A;  3W5O A;  1Z47 A;  4UP7 A;  1PH4 A;  4A3J G;  4LF6 Q;  4LF7 L;  4DR4 L;  2R92 G;  1HNX Q;  3BZK A;  3PIO A;  3M9B A;  5C0X G;  4B3T Q;  3S17 H;  4C2M H;  3UDI A;  4K0K L;  4BY1 G;  3ZJY C;  4B3M L;  2IHE A;  2ID0 A;  4OON A;  4R4Q A;  4RG1 A;  1YJW A;  3GD7 A;  5FJ8 H;  1X3F A;  3KOJ A;  1Q1E A;  3HOZ G;  2FXQ A;  1QZH A;  4KI0 A;  4JOI C;  4DV7 L;  1Y1W H;  1TWC H;  2KEN A;  4JI8 Q;  1VS0 A;  4JI2 Q;  1C7Y A;  4JI1 Q;  4DUY Q;  1P16 A;  2NVX H;  1IBK Q;  3M85 A;  2OWO A;  3KFU A;  2KHI A;  3A0J A;  4APV A;  1X3E A;  5H1S E;  4A3D H;  2LXK A;  1X55 A;  3KYH C;  4LF5 L;  1WOC A;  3S1R H;  2KBN A;  2CWA A;  3HFZ B;  3BJU A;  4A3L H;  1IBL L;  5IYD H;  4LFC L;  4JI7 Q;  3OTO L;  4A76 A;  1X6O A;  1FVI A;  1QZG A;  2Z6K A;  1C0A A;  3I4N H;  1I3Q H;  1HNW L;  2YTV A;  4IFD J;  2VL6 A;  2VY3 A;  4UP9 A;  2QEX A;  4GN4 B;  5C4J H;  1XNR Q;  3FKI H;  3RZO H;  2A1A A;  4B3S L;  1ASY A;  1SR3 A;  1XPR A;  4JI0 L;  2NZO A;  4DV2 Q;  1VCI A;  4DV4 Q;  1XMO Q;  1VQ9 A;  2UXB Q;  3K0X A;  4J15 A;  1IBM Q;  1SE8 A;  2JA7 G;  5ELO A;  1FGU A;  4UY8 C;  2EXD A;  3AYH B;  3PUZ A;  2E5L L;  1OXU A;  3CCQ A;  1L1O B;  2JK8 A;  1GD7 A;  2QGQ A;  1VQL A;  5C0X J;  4KHP L;  3TS2 A;  3EBE A;  3AQQ A;  1K3R A;  2WB1 E;  3PUY A;  4MNO A;  4JI6 Q;  2KCT A;  3S1N H;  2WAQ E;  2Y0S E;  3I55 A;  4HIM A;  1KRT A;  3A5Z B;  5C3E G;  1WFQ A;  4IPH A;  4R4C A;  5GAE C;  4LF4 L;  1I6H H;  5HY6 A;  4OWT B;  1M90 C;  3KJP A;  4DV3 Q;  4HIK A;  5JJI A;  2NVT H;  1XPO A;  3J81 j;  3STB C;  2JA6 G;  1IYJ B;  4A3F G;  1E7Z A;  3M3Y H;  4BXX H;  3H0G G;  2Q2H A;  2WFW A;  1N36 Q;  4QIW E;  2VZA A;  2UUC Q;  4JI4 L;  4KHZ A;  3F2C A;  1XNQ Q;  4IOC A;  3HOY G;  1BBW A;  5C4X G;  1JJ2 A;  2NN6 G;  1N32 L;  5M5X H;  4JYA Q;  4OO1 G;  4NXN L;  2N3S A;  3HOU G;  4BBS G;  1YJ9 A;  1DGS A;  1EUJ A;  3E9I A;  1GM5 A;  4X65 L;  5M3M G;  1HR0 Q;  2JEA I;  1EOV A;  2I5M X;  3CPW A;  1G29 1;  4X64 L;  3BZC A;  4GKK Q;  1Q86 C;  5BR8 Q;  4O2D A;  3GTG H;  1Q12 A;  3F8T A;  1PH9 A;  4DR3 Q;  1RIP A;  1X54 A;  3CME A;  4HJ9 A;  2R93 H;  3M4P A;  1Q8K A;  3D31 A;  3F2D A;  3CP0 A;  2AKW B;  2ZJR A;  3T1H Q;  4DV0 Q;  5E7N A;  5GAH C;  1V9P A;  1EWI A;  1AE2 A;  1FL0 A;  3CCS A;  2UUB L;  3PCO B;  1G6P A;  2YV5 A;  1UWV A;  1V1Q A;  1Q46 A;  1YBY A;  1LYL A;  3U4Z A;  1C9O A;  1D8L A;  1NJI C;  4DR2 Q;  3I4M G;  4YHH L;  5LMN Q;  1SFO H;  3PGZ A;  2Q2U A;  2CCZ A;  2MFI A;  3CC2 A;  1Y14 B;  4PZ6 A;  1EYG A;  2B63 H;  4YCW A;  3BU2 A;  4AYB E;  4KLK A;  4IOA A;  1EIF A;  1HJP A;  1IL2 A;  4YCV A;  3UDG A;  1G51 A;  1KL9 A;  2I0Q A;  2NVQ H;  2RHQ B;  2XGT A;  3TS0 A;  2JA5 H;  3HOW G;  2N8N A;  4LW1 A;  4OO1 I;  3PO2 H;  4GOP B;  2YTX A;  3HOV H;  1EIY B;  5IWA Q;  4A3E H;  3U58 A;  2UUA Q;  4X66 L;  4HJ7 A;  1YJN A;  1XMQ Q;  4BBR H;  2UXD L;  3DM3 A;  4BA2 I;  3UE0 A;  4A3C H;  4DR6 Q;  2R7Z G;  1Y1V H;  4QY7 A;  3MEF A;  1QVF A;  2BA1 A;  3HKS A;  3H15 A;  4P71 A;  4UPA A;  4HIO A;  4A3K H;  4LF8 L;  4JV5 Q;  4RMF A;  5JJK A;  2VQE Q;  4DK3 C;  1X3G A;  1VQD A;  2AMC B;  4JI2 L;  4JC0 A;  2VQF L;  5C44 H;  3Q8D A;  4EX5 A;  5M3F G;  4C3J H;  4JI3 Q;  1VQB A;  3E9H A;  1HZC A;  4HJA A;  2UU9 L;  2F4V L;  1PVO A;  1M1K C;  1VQI A;  1KD1 C;  4P72 A;  4YY3 L;  3CCE A;  1W2B A;  2Q2I A;  3RLN A;  4A4I A;  4JI7 L;  2EQS A;  1OTC A;  1N34 L;  4A3M H;  1MKH A;  2JE6 I;  1X65 A;  3TEH B;  5HGQ A;  1I5F A;  5LMN W;  2I5H A;  1I94 L;  4GOP C;  4PMW A;  3M7N A;  2C35 B;  3UE1 A;  1XNR L;  1WJJ A;  1E1O A;  4UP8 A;  4GKJ Q;  2JA8 H;  4OX9 L;  4GN5 A;  1HNZ Q;  5IYD G;  4AQY L;  3KF8 B;  5LMU Q;  2PMZ E;  1YHB A;  3K80 C;  2IY5 B;  4DNI A;  5GAD C;  4LF7 Q;  4WJ4 A;  1TWF H;  4POG A;  3CF5 A;  2PQA A;  1BBU A;  3PUX A;  3B6Y A;  5AJ3 Q;  3HOX G;  1K83 H;  4GS3 A;  4A3I H;  3PSI A;  2RHS B;  4A3J H;  3GTP H;  2BH2 A;  4DR1 L;  1Q7Y C;  1N33 Q;  1KRS A;  3OYY A;  3F1Z A;  3S14 H;  3JAM c;  1N9W A;  4LUO A;  2R92 H;  2K14 A;  4IFD I;  5K36 G;  1CSP A;  2I5L X;  4DUZ Q;  2ZM6 Q;  1S40 A;  4B3R Q;  4Y52 H;  1KIX A;  3ERS X;  4QGU A;  2VUM G;  5GRO A;  3A74 A;  2HHH Q;  1VQJ A;  3CC7 A;  1VQ6 A;  4PZ8 A;  2WB1 G;  4H02 A;  1FJG L;  3JAM i;  4DR4 Q;  2ASB A;  3H3V I;  4GNX B;  1A8V A;  2IHF A;  2WAQ G;  2Y0S G;  3KDF A;  1YHA A;  3NEN A;  1CKN B;  2AWO A;  4TQU S;  1PV4 A;  3PF4 A;  1B8A A;  1L0W A;  3CCR A;  1A63 A;  1CKM A;  4DV5 L;  2ZJP A;  4K0K Q;  2D62 A;  2YTY A;  2ALY B;  1PH2 A;  4A3G G;  4B3M Q;  4YWK A;  5C0X I;  5FLM G;  3PIP A;  2OQK A;  1JB7 A;  2F3I A;  3EIV A;  3K81 C;  1QUQ A;  4OWX B;  3RLO A;  4LFB L;  3FP9 A;  3G48 A;  4NB3 A;  4JI5 L;  2H5X A;  4DV7 Q;  1KXL A;  4MZ9 A;  1VQ4 A;  4BXX G;  3S1Q H;  2HQL A;  2UXC L;  2A8V A;  1HZB A;  4DV1 L;  5IP7 G;  4DR5 L;  4YWM A;  3J7A 5;  4XTC S;  4LF5 Q;  3ULL A;  3GO5 A;  4A93 G;  3GTL H;  4LF9 L;  2ZJQ A;  2WP8 J;  1IBL Q;  4LFC Q;  5ELN A;  3OTO Q;  4C3I H;  1VQP A;  3S1M H;  4GNX C;  2OCE A;  1OXS C;  1NBW A;  1OXT A;  5IYB H;  2KHJ A;  1HNW Q;  2K5H A;  1L1O C;  1OXX K;  3NEM A;  1J5E L;  2IT1 A;  3A5U A;  1D7Q A;  1CSQ A;  1U5K A;  2PQA B;  4B3S Q;  4JI0 Q;  2BA0 A;  2MO0 A;  4IO9 A;  4BY7 G;  1NMF A;  2E8G A;  2AHO B;  2IX1 A;  4LFA L;  1E22 A;  1AE3 A;  1YNX A;  4NPS A;  4ME3 A;  4GN3 B;  5DLQ E;  4NXM L;  3PF5 A;  1VQF A;  4TVA B;  3DLL A;  2CFM A;  2E5L Q;  4GLX A;  4OWW B;  3CCL A;  3M4Q A;  4KHP Q;  3KF6 A;  4JOI A;  3K7A H;  3TRE A;  1NTG A;  1OXV A;  2LSS A;  5J3B A;  1Q82 C;  1PH8 A;  1UEB A;  4X62 L;  3U50 C;  4A3F H;  1V43 A;  5IYC G;  2PI2 A;  2ES2 A;  4LF4 Q;  3W1G A;  3AEV A;  4IPD A;  4AYB G;  3NBH B;  3RLF A;  3WWV A;  5C4X H;  4DV6 L;  3HOY H;  2F52 A;  4L5Q A;  2B63 G;  1WI5 A;  1YZ6 A;  1QVG A;  4IPG A;  3G6E A;  1TWA H;  4IJH A;  2R6G A;  4LUV A;  4JBK A;  1QUQ B;  1WYD A;  1E3P A;  1KHI A;  4R4I A;  4JBW A;  3CCJ A;  3T1Y L;  2JA5 G;  3J80 c;  1QVC A;  4LUZ A;  5M3M H;  2Z6K C;  1O7I A;  2Z0S A;  4JI4 Q;  1YEZ A;  2VS1 A;  3CW2 C;  4JG2 A;  5JJL A;  2KCM A;  3PUV A;  1PA6 A;  1N32 Q;  1IZ6 A;  3STB D;  4NXN Q;  1SLJ A;  4LF6 L;  3J80 i;  2NN6 I;  3GDE A;  2OTJ A;  2L15 A;  4P73 A;  3PO3 H;  1Y1V G;  2ZTE A;  3I7F A;  1HNX L;  5JEA G;  4B3T L;  4X65 Q;  3L2P A;  4A3K G;  1HZA A;  4ALP A;  4X64 Q;  1HR0 W;  2LXJ A;  2B3G A;  3KJO A;  3RNU A;  4XIG S;  5C44 G;  3CXC A;  2K75 A;  3AFQ A;  1JJG A;  1TWH H;  4C3H H;  2OTL A;  5IP9 H;  3VDY A;  4R1J A;  4JI8 L;  3AFP A;  4JI1 L;  1B70 B;  4DUY L;  1HZ9 A;  4A3B H;  1IBK L;  1K0R A;  4YWL A;  2UUB Q;  1TXY A;  2K4K A;  2IX0 A;  5IE8 A;  3PUW A;  5FJ8 G;  2YYZ A;  3CQZ H;  1NMG A;  1X9N A;  3ICE A;  2OQ0 A;  2CKZ B;  4DK6 C;  1PHJ A;  1JT8 A;  1YIJ A;  1WCM H;  1Y1W G;  3TQY A;  4YHH Q;  3CAM A;  3HOW H;  2MNA A;  2JA8 G;  1J6Q A;  1RL2 A;  3RZD H;  1PH1 A;  1GVP A;  4IPC A;  3UDX A;  4A3D G;  2NZH A;  3I56 A;  4A3L G;  2N49 A;  4DV2 L;  4DV4 L;  1XMO L;  2HIV A;  4DKA C;  1R9T H;  4JCV E;  2R7Z H;  2UXB L;  2JJQ A;  1IBM L;  4A3I G;  1XTD A;  3HKZ E;  3MXN B;  4GLV B;  1PH7 A;  3I4N G;  3TRZ A;  2D0P A;  1E1T A;  1W3S A;  4MTN A;  4O0A A;  3FKI G;  3H3V H;  1GKH A;  1U0L A;  3KLW A;  4PZ7 A;  5JEA J;  4X66 Q;  2UXD Q;  1LTL A;  1JE5 A;  3G71 A;  5M3F H;  2NVY H;  4DR7 Q;  4JI6 L;  2N78 A;  1E24 A;  2DUD A;  1A0I A;  3RR5 A;  1YVC A;  2GVA A;  4DAY B;  4LF8 Q;  1EFW A;  4BA1 I;  4BY1 H;  4AIM A;  1P8L A;  4HID A;  2XTI A;  2ZTC A;  3ER0 A;  4DV3 L;  2VQF Q;  1NY4 A;  1CUK A;  3HOZ H;  3E0E A;  3SGI A;  4HJ5 A;  3OW2 A;  3J81 c;  1SMX A;  4QQB X;  1K8G A;  4L5T A;  2UU9 Q;  2F4V Q;  3CCM A;  3J7Z C;  4YY3 Q;  2GN5 A;  1N36 L;  4JBM A;  2UUC L;  3S15 H;  1N34 Q;  1XNQ L;  1SN8 A;  2R7F A;  3J81 i;  3S24 A;  4JYA L;  1MIU A;  1I94 Q;  3W1B A;  1I50 H;  3HOX H;  1YHQ A;  2HIX A;  3K7U C;  1PH3 A;  1JMC A;  5IY0 A;  3GTO H;  3S2D H;  4A75 A;  3L7Z C;  2E2I H;  3CPF A;  1KQS A;  3I2Z A;  3CCV A;  1HR0 L;  1PFS A;  4OX9 Q;  4DAM A;  1UE1 A;  4AQY Q;  1VQ8 A;  4GKK L;  1LM0 A;  3CCU A;  5BR8 L;  4R4T A;  1EQQ A;  2V1C C;  4Y7N H;  3CMA A;  4DPG A;  4DR3 L;  5IYB G;  2VUM H;  1NE3 A;  1VQH A;  1S3O A;  2JQO A;  3RN5 A;  1JJC B;  1SRU A;  2JA7 H;  1VQ7 A;  1UE6 A;  4GLA C;  3FHW A;  4DV0 L;  3T1H L;  4DR1 Q;  2GVB A;  2VNU D;  1AH9 A;  1VQA A;  3U4V A;  2E2H H;  4IJL A;  4A3G H;  2R93 G;  5FLM H;  1T9H A;  2B29 A;  1FJG Q;  3IRB A;  1UE5 A;  1MJC A;  4DR2 L;  5LMN L;  1K8A C;  5C3E H;  3CC4 A;  2BH8 A;  3LGJ A;  4LNQ A;  3NEL A;  4P75 A;  4DV5 Q;  3GTK H;  3S2H H;  4GOP A;  3EN2 A;  3L0O A;  4R4O A;  1K73 C;  2RF4 A;  5IP7 H;  5IT9 c;  1SRO A;  2JA6 H;  4LFB Q;  3KDF B;  1YI2 A;  4A93 H;  3H0G H;  2UXC Q;  4JI5 Q;  1YIT A;  2A19 A;  1IXR A;  3I4O A;  1A62 A;  3GTQ H;  5M5Y H;  3S16 H;  5IWA L;  1Q1B A;  1Z9F A;  4P74 A;  1KC8 C;  2UUA L;  1XMQ L;  5GAG C;  3F2B A;  1PH6 A;  3HOU H;  1N8R C;  4DV1 Q;  4BBS H;  4DR5 Q;  4DR6 L;  4YCU A;  2CWP A;  3D0F A;  2PI2 E;  1ASZ A;  4LF9 Q;  1TWG H;  1PYB A;  4BY7 H;  4JV5 L;  1H95 A;  1EQR A;  3PO3 G;  4AH6 A;  3PO2 G;  1Q81 C;  2ATW A;  2VQE L;  4X6A H;  1X56 A;  3HOV G;  4A3E G;  4POF A;  1XPU A;  4L5R C;  4BBR G;  1GO3 E;  4QJF A;  4LWC A;  5FLX c;  1J5E Q;  4A3C G;  4JI3 L;  4QL5 A;  2K5V A;  3ULJ A;  2VW9 A;  2K50 A;  1VQ5 A;  4LFA Q;  2JEB I;  5IP9 G;  3M4O H;  5IYC H;  2YU9 H;  1VQE A;  1B7Y B;  4NXM Q;  4A3B G;  3G4S A;  2ZTD A;  4JBJ A;  1CKO A;  1MJE A;  3GTM H;  4WJ3 M;  2JA9 A;  1HH2 P;  1BKB A;  1L2F A;  3K8A A;  4FDB A;  3I4M H;  1S72 A;  1VQN A;  4GKJ L;  1VQC A;  2AWN A;  1HNZ L;  3ULP A;  1K9M C;  1WCM G;  4X62 Q;  3RN2 A;  1VQG A;  5LMU L;  3CD6 A;  4A3M G;  2MQH A;  4HJ8 A;  2QA4 A;  1VQM A;  4PG3 A;  2MO1 A;  4DV6 Q;  5AJ3 L;  3KF6 B;  2EIF A;  5EAY A;  5M5W H;  1PH5 A;  4OXP A;  1LUZ A;  2Q2T A;  1VQO A;  1VQK A;  2K52 A;  2HT1 A;  2K5N A;  4EQ5 A;  2D0O A;  1N33 L; 
#chains in the Genus database with same CATH topology
 3HKZ G;  1I6V C;  1L0Y B;  1CKN A;  1ESF A;  2ZM6 L;  4B3R L;  1L1O A;  2EZV A;  2F0N A;  4BY7 B;  4DA2 A;  4LF7 L;  1I4X A;  2PYK A;  2R92 G;  4XQJ A;  1HNX Q;  3PIO A;  5C0X G;  3ZJY C;  2IHE A;  2ID0 A;  3SEB A;  4BWG B;  5FJ8 H;  3KOJ A;  5CV6 A;  1Q1E A;  3HOZ G;  4EGV A;  1QZH A;  4KI0 A;  2NWG A;  1Y1W H;  1SNM A;  1VS0 A;  4JI2 Q;  2B8G A;  1C7Y A;  1GJX A;  1SYC A;  4DFA A;  2I07 B;  3M85 A;  3KFU A;  2KHI A;  3MFG A;  1X3E A;  2JA5 B;  2R61 A;  3HFZ B;  1EEI D;  2M9V A;  4LFC L;  3V2T A;  4DAV A;  1QZG A;  4NKL A;  2F0Q A;  4IFD J;  1D5M C;  2VY3 A;  2QEX A;  2MJ8 A;  1XNR Q;  1JE4 A;  3A7A B;  2A1A A;  4MIU A;  2EYJ A;  4F7X A;  1WTP A;  4ZKC B;  3DEO A;  2EJG C;  4JI0 L;  2AUK A;  3D4W A;  1VCI A;  3WOE A;  1IHZ A;  1XMO Q;  1VQ9 A;  2UXB Q;  5K36 H;  2OF1 A;  1JWS D;  3P7J A;  1STY A;  1I4Q A;  1GD7 A;  1VQL A;  1BUV T;  3EBE A;  3PUY A;  1ILQ A;  3SDZ A;  2WAQ E;  4HIM A;  3A5Z B;  1WFQ A;  4R4C A;  5GAE C;  2E74 C;  2Z8L A;  2G5D A;  1Y1W B;  1H9S A;  1PMR A;  5JJI A;  1A15 A;  1AEX A;  2EY1 A;  1XPO A;  3NPP A;  3STB C;  4N9T A;  4A3F G;  1E7Z A;  3M3Y H;  1GUN A;  2Q2H A;  2WFW A;  2K5Q A;  2VZA A;  1YNN D;  1BR9 A;  5KND A;  4KHZ A;  1XNQ Q;  3HOY G;  2KCN A;  1N32 L;  4A3I B;  1ICW A;  4NXN L;  1EL0 A;  1ENC A;  4BBS G;  4L63 B;  3E9I A;  1HR0 Q;  1KLU D;  4X65 L;  1QG7 A;  3DM1 A;  4X64 L;  3BZC A;  1U9R A;  2K32 A;  3GTG H;  3F8T A;  2R93 H;  3M4P A;  1Q8K A;  3D31 A;  1EWI A;  1HTL D;  1V1P B;  4RHR A;  2F0J A;  1YBY A;  1GOZ A;  2RDG A;  3LWU A;  5LMN Q;  2Q2U A;  1BCP D;  3CC2 A;  4HED A;  5IT9 E;  3QG1 A;  3NSW A;  1EWH A;  2K01 A;  2NUC A;  3R3O A;  3JAM L;  2BCO A;  3M3Y B;  1U4M A;  1EIF A;  1G51 A;  3RMH A;  2I0Q A;  5EBD A;  2NVQ H;  3U9O A;  3CHB D;  1A3V A;  2IPK D;  4LW1 A;  5JOB A;  1ZKO A;  4HMI A;  3MEH A;  4CDC C;  3HOV H;  1HXY D;  2PCF B;  2UUA Q;  1XMQ Q;  1GUG A;  2KCC A;  4U68 A;  3UE0 A;  3H15 A;  4TRD A;  4UPA A;  4A3K H;  2F3W A;  4LF8 L;  4JV5 Q;  4RMF A;  2MP1 A;  2R93 B;  3BDL A;  1STE A;  1PZJ D;  5EKI A;  3MXU A;  3SHL A;  4JI2 L;  5D14 A;  3NK9 A;  3BVG A;  1NUC A;  5FOB B;  1VQB A;  2UU9 L;  1QNK A;  2TMP A;  4YY3 L;  2XRQ D;  3RLN A;  5FKA C;  5FO8 B;  1EOT A;  3A8J E;  5EKK A;  1O7L A;  1MKH A;  2JE6 I;  1X65 A;  4A3M H;  5HGQ A;  4RA8 A;  1I94 L;  3GV3 A;  2C35 B;  1XNR L;  2B2U A;  4V19 0;  4UP8 A;  4GKJ Q;  2J0T D;  1TVX A;  4GN5 A;  4ZK9 B;  4OX9 L;  1HNZ Q;  1GUS A;  2PMZ E;  1S5F D;  5GAD C;  3O13 A;  4POG A;  1JOO A;  5EKL A;  3KBX A;  3HOV B;  3PSI A;  3BYT B;  1NCV A;  1N33 Q;  5CC4 A;  3OYY A;  1E2Z A;  1N9W A;  4IFD I;  2A68 D;  2I5L X;  1SEB D;  4ZRZ A;  5GRO A;  4A3K B;  1JOK A;  2I46 A;  1VQ6 A;  4H02 A;  3T16 A;  2RVL A;  3KDF A;  1KAB A;  1EZ8 A;  2SNS A;  1CKN B;  3NEN A;  1A63 A;  3CCR A;  1HFG A;  1Z6H A;  4K2L A;  2XWJ B;  4LK1 C;  3TP6 A;  1VF7 A;  4IZ8 A;  4A3G G;  3KBG A;  1PFN A;  5FLM G;  1K3B C;  4I65 A;  2F3I A;  4LFB L;  4DK1 A;  4A3M B;  3N52 A;  5I6Y A;  4QUC A;  4DV7 Q;  4MTK A;  1VQ4 A;  1B3A A;  4LMQ D;  2HQL A;  5J39 A;  2A8V A;  2CQA A;  1O7Y A;  3ULL A;  3GO5 A;  4A93 G;  1D1K A;  2WP8 J;  3OOC A;  5ELN A;  3OTO Q;  4C3I H;  4WJW A;  4G4K A;  1NBW A;  1GHJ A;  1EYC A;  1WTO A;  1L1O C;  1OXX K;  4ULL A;  1WD1 A;  3QB3 A;  1PTO H;  4BY7 G;  1NMF A;  3D3R A;  2FHT A;  2RA4 A;  5DLQ E;  2E5L Q;  4GLX A;  4FO2 A;  3CCL A;  5IOC A;  1JOR A;  4JOI A;  1O78 A;  1OXV A;  2LSS A;  3QJY A;  1Q82 C;  1UEB A;  4IUR A;  1L0X B;  3U50 C;  5IYC G;  3K5L A;  2QW7 A;  1IKL A;  5CBA E;  4L5Q A;  1GXD C;  2AUJ D;  1QVG A;  2F0H A;  4IPG A;  4JBK A;  2R6G A;  1QUQ B;  1E3P A;  1KHI A;  2JA5 G;  1CA6 A;  2L12 A;  2Z0S A;  1H9S B;  2EE1 A;  4C3I B;  3PUV A;  2V4D A;  4X3T A;  4QUF A;  3PO3 H;  2WKD A;  5I2Y A;  3J7A V;  5JEA G;  3L2P A;  1HZA A;  1KDC A;  2LXJ A;  5C5L A;  1ET6 A;  1STH A;  3AFQ A;  1QE6 A;  3H94 A;  1SSO A;  4C3H H;  4C3J G;  1JJG A;  2H1E A;  1LT3 D;  4JI8 L;  2PW5 A;  2X69 A;  3R2T A;  4DUY L;  4A3B H;  1PLF A;  1K0R A;  3D4D A;  2K4K A;  3ERQ A;  5FJ8 G;  1JC7 A;  2DJG C;  4DK6 C;  1PHJ A;  1UNS A;  1WCM H;  1Y1W G;  4YHH Q;  3S16 B;  3HOW H;  3OSO A;  5KNC A;  2MNA A;  1RL2 A;  3HOU B;  4CKB A;  4MHE A;  2Q8R E;  3BDC A;  4IPC A;  3UDX A;  1PTO C;  1H9M A;  3M7G A;  4DV2 L;  4DV4 L;  2C9O A;  2HIV A;  1R9T H;  4A3I G;  2F03 A;  2D0P A;  4K2K A;  2XN9 C;  1E1T A;  4O0A A;  3PO3 B;  1GKH A;  1U0L A;  3OIP A;  3NXW A;  1CTM A;  5M3F H;  1B9N A;  4JI6 L;  4O42 A;  1A0I A;  5C0X H;  1SE3 A;  4FXK C;  4AIM A;  1P8L A;  4HID A;  4C3H B;  2ZTC A;  3ER0 A;  5CGK A;  2VQF Q;  3HOZ H;  4A3B B;  1H9J A;  3EFX D;  4HCS A;  1LLR D;  1K8G A;  1ZYR C;  1F77 A;  2HCC A;  3CCM A;  5E4W C;  1PRT B;  2M2L A;  1N34 Q;  3HRZ C;  1WCM B;  2R7F A;  3HOW B;  2QEJ C;  2FMM A;  1DOM A;  1PH3 A;  3K7U C;  3K0Y A;  3EVQ A;  3CPF A;  5JAV A;  1PFS A;  4OEL B;  1UE1 A;  3P20 A;  1BOS A;  1LM0 A;  4KY5 A;  3CCU A;  1QB5 D;  4R4T A;  1R9T B;  4Y7N H;  4DR3 L;  2K6A A;  1MHW C;  3RN5 A;  1SRU A;  2IJ0 A;  2BE5 D;  3QOJ A;  1UE6 A;  4GLA C;  3FHW A;  3RUZ A;  2KQ3 A;  4DR1 Q;  5C3X A;  4E6I A;  2F0L A;  2EYF A;  5M3F B;  1AH9 A;  1QNU A;  2E2H H;  1PRT C;  2R93 G;  2VXW A;  4H0L C;  2HDM A;  3S9W A;  2QIL A;  1K8A C;  3K5N A;  1LTA D;  3CC4 A;  3HOZ B;  1S4Z A;  3NEL A;  3GTK H;  4CHT B;  3S2H H;  3R93 A;  3EN2 A;  1ILP A;  1CI3 M;  3KDF B;  1YI2 A;  2F0T A;  1QIL A;  2B2U C;  4JI5 Q;  4DNR B;  1IXR A;  4ABN A;  1A62 A;  2F0U A;  2PQE A;  1EYA A;  5G3L F;  4X3U A;  5IWA L;  1Z9F A;  3DWQ A;  3ND9 A;  2UXC Q;  2K04 A;  1N8R C;  4DV1 Q;  4BBS H;  4DR6 L;  4YCU A;  3GV6 A;  1HQM C;  5TSS A;  3TZU A;  4LF9 Q;  1TWG H;  1G6Z A;  4X6A H;  2ATW A;  3FPU B;  1ONL A;  1X56 A;  5C4Z A;  3HOV G;  1XPU A;  5DM7 3;  3ONA B;  2WAQ B;  4M8A A;  4QJF A;  1J5E Q;  4XT1 B;  2K5V A;  5BN4 A;  3ULJ A;  2E2H B;  2K50 A;  3BG3 A;  1EIG A;  4MN3 A;  3M4O H;  1B7Y B;  4M1U B;  3F2U A;  1MJE A;  4JBJ A;  3GTM H;  3FMC A;  2AQ1 B;  2JA9 A;  4FDB A;  1BKB A;  3GTK B;  1X32 A;  1FNW A;  4CGY B;  1VQN A;  4BS9 A;  3CD6 A;  2GA4 B;  4A3M G;  4HJ8 A;  5NUC A;  1AW7 A;  4OXP A;  1VQO A;  2QGQ A;  2K52 A;  2A19 A;  2K5N A;  2HT1 A;  1SMY C;  2CQO A;  4NW2 A;  4HCE A;  5GQO A;  2E2J H;  4IFD G;  3DMU A;  3T1Y Q;  4QF4 A;  1KAA A;  3GTJ H;  3J7A F;  2RCN A;  3NBI A;  2CVR A;  4DR4 L;  5CR3 A;  4XQQ A;  3PIO 3;  1E0B A;  1LTG D;  3BZK A;  3S17 H;  4C2M H;  4BY1 G;  2FMC A;  4R4Q A;  1YJW A;  4CDE C;  5DEH A;  3M4O B;  1DD2 A;  4JOI C;  1BQQ T;  1TWC H;  2WII B;  2OT2 A;  3I70 A;  1B50 A;  2NVX H;  1PYW D;  4KKU A;  5H1S E;  3NHH A;  2LXK A;  4LF5 L;  4OGQ C;  2KBN A;  2O5J C;  3BJU A;  4UAI A;  1FVI A;  1MI2 A;  1II3 A;  2Z6K A;  4KY6 A;  5EBC A;  2K33 A;  1EY0 A;  1I3Q H;  1HNW L;  2KHS A;  4NP5 A;  2E2J B;  1Y1V B;  5EQ0 A;  3CKI B;  4B3S L;  3VA5 A;  2NZO A;  3K0X A;  1STN A;  5ELO A;  1EEF D;  4R8N A;  2EXD A;  3G6J B;  3PUZ A;  1OXU A;  3CCQ A;  3CRL C;  3NBH A;  1NSN S;  4DN4 M;  3AQQ A;  1K3R A;  4C2M B;  4MNO A;  3S17 B;  2N55 A;  3M4Y A;  2WAC A;  1MD2 D;  4IPH A;  1EQV A;  4LF4 L;  1M90 C;  4DV3 Q;  1W6J A;  2NVT H;  1F2L A;  2PMZ B;  3FDT A;  2NVX B;  1PZI D;  3NTH A;  1IYJ B;  2FFK B;  1TS2 A;  4JI4 L;  1JIC A;  2A69 C;  1JJ2 A;  1SJH D;  3A54 A;  4JYA Q;  2N3S A;  3HOU G;  1YJ9 A;  1I3Q B;  1DGS A;  1EUJ A;  1KDB A;  1SYF A;  2MPM A;  1G29 1;  3NWS A;  2E2D C;  4GKK Q;  1MSG A;  1Q12 A;  1DOK A;  3VR2 A;  4HJ9 A;  3F2D A;  3T1H Q;  4RGO S;  4DV0 Q;  2F0S A;  5GAH C;  1RTO A;  1V9P A;  2HCI A;  1AE2 A;  3PCO B;  1JR0 D;  1V8Q A;  3U4Z A;  3BS1 A;  5ELD A;  4EVO A;  4C3H G;  3A55 A;  1D8L A;  1NJI C;  1PRT F;  3I4M G;  2CHB D;  3PGZ A;  2PZW A;  2CCZ A;  3I73 A;  2NVT B;  2PPB C;  1A6X A;  4OIJ A;  1EYG A;  4AYB E;  2PZT A;  2QDL A;  3WOF A;  1IL2 A;  1KL9 A;  3S1M B;  1ENA A;  1PZK D;  2RHQ B;  3TS0 A;  2JA5 H;  3HOW G;  1D6E C;  3E5S A;  1RTN A;  4OO1 I;  3PO2 H;  5ELE A;  1SYD A;  2BOS A;  5KYL A;  5I6W A;  4A3E H;  4UHV A;  1EIY B;  2NB0 A;  3U58 A;  4X66 L;  1KNE A;  1VF5 C;  2F0M A;  4BA2 I;  5HUR A;  1QVF A;  2KUM A;  5JEA H;  4HIO A;  5JJK A;  2VQE Q;  1CK1 A;  1QCB D;  1VQD A;  2LY7 A;  3TME A;  4JC0 A;  1XYI A;  2RBM A;  1SBB B;  5M3F G;  4C3J H;  1VMP A;  3E9H A;  1HZC A;  3T51 B;  2F4V L;  1VQI A;  1KD1 C;  3CCE A;  2KJX A;  2IWH A;  1OTC A;  1HA5 A;  1TII D;  1SYE A;  2I5H A;  2LKV A;  3M7N A;  1SNC A;  1K8M A;  1XTC D;  1SNO A;  2RSN A;  2P5Z X;  3MTS A;  2DJF C;  2K05 A;  4AQY L;  3KF8 B;  3K80 C;  4DNI A;  3LNN A;  1K0S A;  3PO2 B;  1LTR D;  4A3I H;  4A3J H;  4A3E B;  3PMF A;  4OIK A;  2K14 A;  2NBF A;  4DUZ Q;  2JSO A;  2F0W A;  2HHH Q;  1B4O A;  1TWH B;  4Q0F A;  1FJG L;  5CV8 A;  3GQB A;  1A8V A;  2WAQ G;  1YHA A;  4TQU S;  1BCP B;  4DV5 L;  3MXP A;  4C3J B;  4K0K Q;  4K6D A;  2D62 A;  2ALY B;  4TKO B;  5FO7 B;  1D1I A;  2CH4 A;  1PH2 A;  4YWK A;  4B3M Q;  5IGE A;  2OQK A;  3RLO A;  4OWX B;  1QUQ A;  4NB3 A;  1SJE D;  2H5X A;  2QF7 A;  2F3V A;  2L5T A;  4DR5 L;  5KGU A;  4YWM A;  1JQY D;  1J9O A;  2XSC A;  1IBL Q;  2OCE A;  4K5W A;  3TBI B;  4A3J B;  2K5H A;  2NVY B;  1D7Q A;  3A5U A;  3Q0A A;  2L11 A;  2BA0 A;  1CQF A;  1GUO A;  4LFA L;  4KD3 A;  4RGN A;  3TP7 A;  4ME3 A;  2NYZ D;  1K28 A;  2JYO A;  1DON A;  4OWW B;  1LAB A;  1XWE A;  3R2I A;  3M4Q A;  4KHP Q;  3KF6 A;  5KIX A;  3TRE A;  1NTG A;  5J3B A;  2A6E C;  3MZ5 A;  1G91 A;  3S15 B;  1ENF A;  2ES2 A;  4ME5 A;  2WKC A;  3AEV A;  4IPD A;  3NBH B;  3WWV A;  5C4X H;  4ILW A;  1YZ6 A;  4LUV A;  2EYO A;  1EIH A;  1WYD A;  4IUQ A;  4R4I A;  3Q22 A;  3CCJ A;  1FR3 A;  1QVC A;  1M4V A;  2J7Z A;  4LUZ A;  5M3M H;  2Z6K C;  1SXT A;  1YEZ A;  3CW2 C;  1FYC A;  1D2B A;  1PA6 A;  3STB D;  1SLJ A;  2NN6 I;  3GDE A;  2L15 A;  4P73 A;  5L37 A;  1Y1V G;  4IUU A;  1HNX L;  5CV7 A;  5T1I A;  4ALP A;  2B3G A;  4RGT A;  4RCN A;  3CXC A;  2K75 A;  3A56 A;  1B70 B;  2BDO A;  4N9P A;  4YWL A;  2UUB Q;  1TXY A;  1JOQ A;  2IX0 A;  2JA6 B;  2YYZ A;  3CQZ H;  2EXZ A;  2IW3 A;  2OQ0 A;  3OHX C;  2F0I A;  3QO2 A;  1XX8 A;  5C4X B;  4HAE A;  1CHP D;  1PH1 A;  3RZD H;  3SK8 A;  5F2D A;  3ZYY X;  4ZCK A;  3DUZ A;  1GVP A;  4R8I A;  5A2Q E;  2NZH A;  3H09 A;  3W2D A;  2N49 A;  5M3M B;  1HTP A;  1XMO L;  4IFD H;  4DKA C;  2UXB L;  3T56 B;  1PH7 A;  3TRZ A;  2ZXP A;  3VR5 A;  1ZXT A;  3KLW A;  4PZ7 A;  4I7Z C;  2UXD Q;  3NUC A;  1OO9 B;  1IW7 C;  1HUM A;  1KDA A;  2KOL A;  4JW0 A;  4L8J A;  2GVA A;  4DAY B;  4BY1 H;  3LWE A;  2XTI A;  5AFW A;  2H4O A;  4DAP A;  1A2U A;  3CQZ B;  4QB4 A;  2ENB A;  1B9M A;  1XNQ L;  4XT3 B;  1SN8 A;  4L6T B;  3S24 A;  3Q24 A;  5DM6 3;  1I50 H;  2D9U A;  3RZD B;  3KLS X;  2F0O A;  3I72 A;  3T13 A;  4A75 A;  3CCV A;  1HR0 L;  1PFM A;  2G9H D;  2CW0 C;  2V1C C;  1DJR D;  4DPG A;  2VUM H;  1VDZ A;  1VQH A;  3C1F A;  4FNF A;  2RKS A;  4J8Q A;  1EU3 A;  2MGS A;  4F88 A;  2D2C C;  4XYO A;  1VQA A;  1XXG A;  1I4H A;  4IJL A;  1B3Q A;  4BY1 B;  1MJC A;  3LX0 A;  5LMN L;  4ZKB B;  1O7Z A;  2A6H D;  2BH8 A;  4R4O A;  5IP7 H;  2B8F A;  1QOH A;  2RDH A;  3CU7 A;  1I50 B;  2WV6 D;  3IFT A;  3S16 H;  1Q1B A;  1SNP A;  2UUA L;  1XMQ L;  1PH6 A;  3HOU H;  4K5V A;  1TR5 A;  1K8O A;  4G7O C;  2XIW A;  2PI2 E;  4TSS A;  1HRJ A;  4JV5 L;  2VUM B;  4AH6 A;  3PO2 G;  3NTK A;  4XQN A;  2RQX A;  4A3E G;  1KTK A;  5IGC A;  2SNM A;  3KLS A;  1EY7 A;  1D5X C;  4FP5 D;  2VW9 A;  4EQN A;  1I6H B;  4KN7 C;  2YU9 H;  4NXM Q;  1AZP A;  1Q8I A;  3G4S A;  3R8B A;  3H91 A;  4WJ3 M;  3I4M H;  1S72 A;  4GKJ L;  1HNZ L;  1UEA B;  4X62 Q;  4PNY A;  3VA7 A;  2Z9H A;  5M5X B;  2RCF A;  1VQM A;  4DV6 Q;  1GUW A;  3KF6 B;  3HEJ A;  5M5W H;  1PH5 A;  5J1Z A;  4EQ5 A;  1N33 L;  4L5S A;  3K59 A;  2EYM A;  3UDF A;  1PYS B;  2PNH A;  1XJV A;  4IUP A;  1UE7 A;  3K6O A;  2HD3 A;  1Z47 A;  4RKB A;  4A3J G;  1PH4 A;  4LF6 Q;  1LO5 D;  5IOD A;  1EY9 A;  2F0E A;  4B3T Q;  3M9B A;  1WTR A;  2B2Y A;  5C3W A;  1Y69 U;  2F0P A;  1W6K A;  1X3F A;  5IT9 L;  2YU9 B;  2M00 A;  4DV7 L;  4AYB B;  2KEN A;  2B63 B;  1JB3 A;  2XNA C;  2BE5 C;  4JI1 Q;  3I4M B;  1P16 A;  1KLG D;  1IBK Q;  2OWO A;  3SK5 A;  3PQI A;  4HSV A;  4APV A;  4A3D H;  1PFB A;  1X55 A;  3KYH C;  4A3L H;  3C1E A;  2CWA A;  4JI7 Q;  1F9R A;  3OTO L;  1X6O A;  3DHQ A;  5M5W B;  2YTV A;  3FKI H;  4KMU C;  1SR3 A;  1XPR A;  1SYG A;  5CV5 A;  2E75 C;  3MWY W;  1IBM Q;  4J15 A;  3NE5 B;  1HCZ A;  2JA7 G;  1Y8P B;  1FGU A;  1FNU A;  4UY8 C;  3PIP 3;  2E5L L;  1HUN A;  1LTI D;  1MBY A;  1PTO D;  2WB1 E;  2KCT A;  3IFD A;  2Y0S E;  3I55 A;  3S1N H;  1KRT A;  5IIF A;  3QR8 A;  3KJP A;  5A2Q L;  4HIK A;  2JA8 B;  4B9W A;  3K5O A;  2JA6 G;  5J22 A;  4FF3 A;  3H0G G;  4A3D B;  2DY8 A;  5EGT A;  4QIW E;  1N36 Q;  1TWF B;  4KN4 C;  4QMG A;  2UUC Q;  3F2C A;  5C4X G;  4IOC A;  1BBW A;  2X6G A;  2VB2 X;  2J4X A;  2NN6 G;  4J1M A;  3E6Z X;  3FKI B;  1GM5 A;  2JEA I;  2XWB B;  5M3M G;  3D6C A;  1EOV A;  2I5M X;  2ZXR A;  1BF4 A;  3D8G A;  5BR8 Q;  4ZUJ A;  5CV4 A;  1RIP A;  2L4N A;  3MFY A;  2AKW B;  4FF4 A;  2B2T A;  4U67 3;  5E7N A;  2QDB A;  1VMC A;  1GHK A;  3CCS A;  1LT4 D;  5COR A;  2YV5 A;  1F9S A;  3S1N B;  3C3L A;  1LYL A;  1U4L A;  4R9W A;  3TSS A;  1SDF A;  4DR2 Q;  4YHH L;  1E2W A;  3KF8 A;  3Q23 A;  1Y14 B;  1AFP A;  3MXN A;  1LTB D;  1Q3L A;  1RJT A;  4PZ6 A;  1EZ6 A;  2L0C A;  3GTL B;  1HJP A;  4YCV A;  1AP0 A;  1I4G A;  5K5P A;  2MUY A;  1JWU D;  3SK4 A;  3J80 E;  2YTX A;  3L3O C;  4BBR H;  4A3C H;  1Y1V H;  4QY7 A;  4C56 C;  1TKW B;  4P71 A;  1U4R A;  3MXG A;  3TZD A;  2EPB A;  2VQF L;  3Q8D A;  3D6W A;  4RAU C;  1LT6 D;  2E76 C;  4JI3 Q;  4HJA A;  1NNX A;  1PVO A;  3V96 A;  4P72 A;  2B2V A;  4A4I A;  4JI7 L;  3AMU A;  1N34 L;  3TEH B;  5LMN W;  1FGB D;  1I5F A;  4CJ2 C;  3EQL C;  4PMW A;  1WJJ A;  2F4I A;  4KK7 A;  2B2W A;  2LFN A;  5IYD G;  1GUT A;  5LMU Q;  1YHB A;  1F9P A;  1BBU A;  2K5W A;  3CRK C;  5AJ3 Q;  1K83 H;  3HGB A;  1IYV A;  3GTP H;  4DR1 L;  1Q7Y C;  2EJF C;  3F1Z A;  1UAP A;  4BBR B;  3JAM c;  4LUO A;  3S14 H;  3MC0 B;  2DNE A;  4Y52 H;  2ZM6 Q;  4B3R Q;  3ERS X;  4DU9 A;  1ET9 A;  2VUM G;  4PZ8 A;  3JAM i;  1SMY D;  2ASB A;  4LF7 Q;  2IHF A;  3H3V I;  3PF4 A;  3HG9 A;  3SK6 A;  1TS4 A;  1B8A A;  1L0W A;  1CKM A;  3AU7 A;  5BN3 A;  2ZJP A;  3DEP A;  4IN3 A;  2YTY A;  3A7L A;  1H9R A;  3PIP A;  2DY7 A;  3EIV A;  4DK0 A;  1AN8 A;  5KNB A;  3FP9 A;  3J81 E;  4JI5 L;  2EY5 A;  1KXL A;  1EWC A;  5FO9 B;  4BXX G;  2UXC L;  5LL6 X;  4DV1 L;  1LTT D;  5IP7 G;  3NP8 A;  2NZ1 D;  4XTC S;  4HR7 B;  3VYS A;  4LF9 L;  2ZJQ A;  4LFC Q;  3FVQ A;  3T4A C;  3S1M H;  1OXS C;  1K83 B;  1OXT A;  2KHJ A;  3OWF A;  3GTP B;  1EQT A;  3S14 B;  2EYL A;  1J5E L;  4CDF C;  1CSQ A;  2PQA B;  3W3A A;  4JI0 Q;  2MO0 A;  1STB A;  2E8G A;  2IX1 A;  1AE3 A;  1YNX A;  2O2L D;  4NPS A;  3DWP A;  4GN3 B;  4DF7 A;  2WIN B;  1X3P A;  4WFN 3;  3PF5 A;  1G2S A;  1YNJ C;  2L55 A;  1WTH A;  5ISR A;  3A8I E;  1CA5 A;  1Q90 A;  1V43 A;  2KEC A;  1EYD A;  1BO0 A;  4AYB G;  4WOR A;  2B63 G;  1WI5 A;  4OO1 H;  1CHQ D;  4IJH A;  3ERO A;  4FF1 A;  3T1Y L;  4DGZ A;  1PDQ A;  4HSP A;  4H13 C;  4IAL A;  1O7I A;  2VS1 A;  4DNT B;  4JG2 A;  2L1B A;  5JJL A;  2KCM A;  1SYB A;  5EPJ A;  1N32 Q;  3BDO A;  4NXN Q;  1TY0 A;  4DAY A;  4KKT A;  1BDO A;  3I7F A;  4X65 Q;  2A69 D;  4X64 Q;  5A35 A;  3HP3 A;  4RHS A;  3KJO A;  5C3E B;  3RNU A;  5FLX E;  5C44 G;  1TWH H;  2KA7 A;  1EY8 A;  3VDY A;  2OTL A;  4R1J A;  3AFP A;  5DAU A;  4LAA A;  1EY5 A;  5KEE A;  2HDL A;  3PUW A;  1WTX A;  1X9N A;  3ICE A;  5DNF A;  4S3S A;  1JT8 A;  1T5X D;  1YIJ A;  2EYH A;  5M5Y B;  3CAM A;  2JA8 G;  1J6Q A;  5JVH 3;  1DYQ A;  1Z7T A;  1R4P B;  4A3D G;  4IQZ A;  4O1N A;  4A3L G;  3MA2 B;  2R7Z H;  4RWS C;  4FYD A;  1XTD A;  2F0F A;  3HKZ E;  3MXN B;  4GLV B;  4KJN A;  5KRU A;  3KK7 A;  1W3S A;  4MTN A;  3FKI G;  1LTS D;  3SXH A;  2AQ3 B;  2K28 A;  1LTL A;  1JE5 A;  2C5C A;  3G71 A;  2NVY H;  4DR7 Q;  2N78 A;  1E24 A;  4LF8 Q;  1EFW A;  2B2T C;  1YNN C;  2NTT A;  5CV9 A;  4DV3 L;  1EFI D;  4GZY C;  3E0E A;  3EJI A;  3SGI A;  1A2T A;  3J7Y W;  2UU9 Q;  1PXU A;  3J7Z C;  4YY3 Q;  2GN5 A;  3J80 L;  5C6A A;  3S15 H;  1ESR A;  4FF2 A;  4Z9C B;  4JYA L;  1I94 Q;  3NTI A;  2ZXO A;  3HOX H;  3GTO H;  3DXJ C;  5IY0 A;  3L7Z C;  3SE0 A;  4HMJ A;  5CYU A;  1HPC A;  4OX9 Q;  3HZX A;  4GKK L;  4DXG A;  2R7Z B;  1LT5 D;  4KY7 A;  5IYB G;  3MHB A;  1S3O A;  2HQE A;  2JA7 H;  1VQ7 A;  3T1H L;  4DV0 L;  1C48 A;  1NR4 A;  1BCP C;  1RKN A;  2GVB A;  4RCO A;  1WVL A;  4IUN A;  4PQX A;  3I90 A;  4ID6 A;  3FRP B;  2VNU D;  2LS0 1;  3U4V A;  1G2T A;  1JCK B;  4ODG A;  1T9H A;  2B29 A;  3IRB A;  1BNZ A;  3LGJ A;  4LNQ A;  5D3I B;  1ROD A;  3AB9 A;  4GOP A;  2B2V C;  1K73 C;  2F0D A;  2K03 A;  2RF4 A;  4H44 C;  3K5M A;  5IT9 c;  2JA6 H;  4LFB Q;  4XXE A;  3H0G H;  2A5H A;  4HN7 A;  3OIQ A;  3VR4 A;  1YIT A;  3GTQ H;  3I4O A;  2B2W C;  3HOX B;  3GTO B;  2PNR C;  5E3F A;  2NN6 H;  1KC8 C;  3F2B A;  2D5D A;  1PYB A;  1H95 A;  1EQR A;  1MGS A;  1Q81 C;  2VQE L;  4CKE A;  2WB1 B;  1RD9 D;  4POF A;  2Z6B A;  2JA7 B;  4L5R C;  2Y0S B;  3VYU A;  4BBR G;  1GO3 E;  1M8A A;  2OXP A;  4A3C G;  4QL5 A;  2F0G A;  3J81 L;  4FVM A;  5D65 A;  5IGD A;  1VQ5 A;  3OW7 A;  2JEB I;  4K8I A;  5IP9 G;  5IGG A;  2A74 C;  2EVB A;  2ZTD A;  3X3M A;  4QIW B;  3K8A A;  1HH2 P;  5C5M A;  1L2F A;  5BN5 A;  1CT1 D;  2AWN A;  3ULP A;  1FNV A;  2MQH A;  4RGM A;  2A68 C;  3H0G B;  4I7A A;  2QA4 A;  5EAY A;  3GTQ B;  2Q2T A;  1VQK A;  2A6E D;  2JN4 A;  4GNX A;  4DR7 L;  3JC6 6;  2DGY A;  3GTG B;  1BVS A;  4DUZ L;  2R7D A;  1T5E A;  3U9S A;  4B9X A;  1KAW A;  2EY6 A;  2HHH L;  3K58 A;  3PV0 A;  3W5O A;  4UP7 A;  5T1G A;  3Q6S A;  5C4H A;  2DN8 A;  4DXF A;  4K0K L;  3UDI A;  1WTW A;  5ELB A;  2N88 A;  3MVV A;  4B3M L;  4OON A;  4YIJ A;  4RG1 A;  3GD7 A;  2FXQ A;  4EQO A;  1NAP A;  2Z4I A;  4JI8 Q;  3NQT A;  2ICI A;  4DUY Q;  4B08 A;  1HFN A;  2FIN B;  3A0J A;  3BYY B;  2NVQ B;  1B2T A;  2B39 A;  4UDU C;  1WOC A;  5LL6 S;  2A73 B;  3S1R H;  1IBL L;  5IYD H;  1U4P A;  4A76 A;  4RKL A;  1C0A A;  3I4N H;  2VL6 A;  2A6H C;  4UP9 A;  1TQO A;  4GN4 B;  5C4J H;  3RZO H;  5FLX L;  1ASY A;  4CKC A;  3SVM A;  4DV2 Q;  4ZAI A;  4DV4 Q;  5EJW A;  1SE8 A;  1S5C D;  3I8Z A;  2KEE A;  3AYH B;  1L1O B;  2OEO A;  2JK8 A;  1DXM A;  4KHP L;  5C0X J;  3TS2 A;  5I9O A;  4JI6 Q;  2EOT A;  4OEM B;  3P75 A;  3L9A X;  5C3E G;  4C1N I;  1LAC A;  1H9K A;  1I6H H;  1TS3 A;  2F1M A;  4OWT B;  5HY6 A;  4G7H C;  1EY4 A;  4CBV A;  1IW7 D;  4RH6 A;  3J81 j;  1A3U A;  5LHY 1;  5CMD A;  2EY2 A;  4BXX H;  4JK1 C;  4J6H A;  3S1R B;  3EA6 A;  3I4L A;  5M5X H;  4OO1 G;  3I4N B;  4NMZ A;  1CQV A;  4X3K A;  3V05 A;  5C4J B;  2BDN A;  1ICF B;  5CBE E;  3RZO B;  2TSS A;  3CPW A;  1Q86 C;  4O2D A;  5G3L D;  1PH9 A;  4DR3 Q;  1X54 A;  3CME A;  4XDX A;  1S5E D;  1JWM D;  3CP0 A;  1STG A;  2ZJR A;  1TT2 A;  3G7L A;  2CW0 D;  1FL0 A;  3K57 A;  2UUB L;  1G6P A;  1Q46 A;  1UWV A;  1V1Q A;  2Q8I B;  1BCP F;  1C9O A;  4WRD A;  1SFO H;  2XVS A;  2MFI A;  2B63 H;  4YCW A;  3BU2 A;  4LJZ C;  1ZEQ X;  4KLK A;  4IOA A;  1B1Z A;  3QWN A;  1C4Q A;  5I9P A;  3UDG A;  2XGT A;  2N8N A;  4GOP B;  5IWA Q;  3NWT A;  4HJ7 A;  1YJN A;  4EQP A;  2UXD L;  1PTO B;  1V1O A;  3DM3 A;  3X3N A;  4DR6 Q;  2R7Z G;  3MEF A;  2BA1 A;  3HKS A;  1O80 A;  2MHV A;  4DK3 C;  1X3G A;  1WTQ A;  2AMC B;  3VR3 A;  1F9Q A;  5C44 H;  4EX5 A;  4K6L A;  1M1K C;  1CM9 A;  1MSH A;  1W2B A;  2Q2I A;  4K8J A;  1F2Y A;  3N6R A;  4G57 A;  1Y8O B;  2EQS A;  2ZT9 C;  1QJO A;  5JVG 3;  2O5I C;  1SFO B;  4GOP C;  4ZUI A;  3UE1 A;  1E1O A;  2RSO A;  4CJ1 B;  2JA8 H;  3IKJ A;  3MAQ A;  3BVZ A;  1Y8N B;  1F2M A;  2IY5 B;  4WJ4 A;  4FXD A;  4CDD C;  1TWF H;  3CF5 A;  2PQA A;  3PUX A;  3B6Y A;  3HOX G;  4GS3 A;  2RHS B;  4ZLT F;  2BH2 A;  1SAP A;  1EU4 A;  1KRS A;  2CH4 W;  4OL7 A;  2R92 H;  2IX3 A;  5K36 G;  1CZW A;  1CSP A;  1S40 A;  3I3C A;  1KIX A;  4QGU A;  3A74 A;  2NTS A;  1DZ1 A;  1VQJ A;  3CC7 A;  2WB1 G;  5HGT A;  3IAY A;  4DR4 Q;  4GNX B;  1NR2 A;  2Y0S G;  2AWO A;  1PV4 A;  5C44 B;  2PZU A;  4F8M A;  1HHV A;  5C0X I;  4H7B A;  1JB7 A;  1G8Z D;  4K14 A;  3K81 C;  3HS0 C;  2EDG A;  3FEW X;  3G48 A;  4MZ9 A;  1B44 D;  1J8I A;  4QCL A;  3S1Q H;  2R3Z A;  1HZB A;  3HKZ B;  3J7A 5;  2XRS D;  1SNQ A;  4LF5 Q;  3GTL H;  1CZG A;  2SEB D;  1KNA A;  2KVM A;  1VQP A;  1RF2 D;  4GNX C;  4K5X A;  5IYB H;  1HNW Q;  4JVZ A;  1ZYR D;  3NEM A;  2JP1 A;  3IL8 A;  2IT1 A;  2VB3 X;  2R92 B;  1U5K A;  4B3S Q;  2G9D A;  4IO9 A;  2AHO B;  3OMC A;  1E22 A;  2K5D A;  1D5Z C;  4CJ0 B;  4NXM L;  1VQF A;  4TVA B;  3DLL A;  2CFM A;  1FD7 D;  3K7A H;  1PH8 A;  3OPO A;  3D4R A;  1IYU A;  4KV6 A;  1TS5 A;  4X62 L;  4A3F H;  1S5B D;  2PI2 A;  4LF4 Q;  3W1G A;  3OMG A;  2O4X A;  4N8F A;  5EPL A;  3SR1 A;  3RLF A;  4DV6 L;  3KLR A;  3HOY H;  2F52 A;  3P1H A;  5IGF A;  5JJZ A;  3S1Q B;  3G6E A;  1TWA H;  4PV1 C;  1PRT D;  4JBW A;  3OWE B;  3J80 c;  4Y7N B;  1R4Q B;  3BZD B;  4JI4 Q;  5JPM C;  2FJ2 A;  1IZ6 A;  4LF6 L;  3J80 i;  2OTJ A;  1RDP D;  5KYI A;  2ZTE A;  2EYP A;  2Z1C A;  1CFM A;  4B3T L;  4A3K G;  1HR0 W;  2QCP X;  1IL8 A;  4XIG S;  1SE2 A;  1RHP A;  4HTH A;  4KHV A;  5IP9 H;  3S2H B;  1I4R A;  4JI1 L;  1EY6 A;  3UI2 A;  1HZ9 A;  3K7A B;  1IBK L;  1DOL A;  1TU2 B;  5IE8 A;  1NMG A;  4A3F B;  3E3X A;  2CKZ B;  1STA A;  3TQY A;  3HOY B;  3VYR A;  3URY A;  1TWA B;  4BBS B;  1UUP A;  2EJM A;  4FXG C;  5ELF A;  3I56 A;  5I2X A;  1TWG B;  3H6M A;  3NQI A;  4JCV E;  2JJQ A;  3RD4 A;  1IBM L;  1B53 A;  5IGB A;  3I4N G;  2RDF A;  4V0B A;  3H3V H;  3C46 A;  5JEA J;  4X66 Q;  2K7V A;  3KUP A;  1C8C A;  3FPP A;  4XYQ A;  3RR5 A;  2DUD A;  2L9H A;  4C1N K;  1YVC A;  2HUG A;  4BA1 I;  1F2Z A;  3GTM B;  1HA6 A;  1NY4 A;  1CUK A;  2ICE C;  4OHJ A;  1WD0 A;  5JPN C;  4HJ5 A;  3OW2 A;  3J81 c;  1SMX A;  4QQB X;  4L5T A;  2F4V Q;  4N8X 1;  5I4D A;  1N36 L;  5E4X A;  4JBM A;  2UUC L;  1BBX C;  3J81 i;  2F0K A;  2Q8T A;  1MIU A;  4IUT A;  3W1B A;  1YHQ A;  1JMC A;  3S2D H;  2HIX A;  5D3D A;  4KJO A;  1SE4 A;  2E2I H;  1KQS A;  3I2Z A;  3GTJ B;  3BVM A;  3T53 B;  4DAM A;  4AQY Q;  4PMC A;  1V1P A;  3VR6 A;  4C3I G;  1AZQ A;  1PTO F;  5BR8 L;  1VQ8 A;  1EQQ A;  3CMA A;  3C2P A;  3JAM E;  1NE3 A;  3I91 A;  5E1F A;  2JQO A;  4G7Z C;  1JJC B;  1DM0 B;  3VYT A;  1LV9 A;  1DCZ A;  1TY2 A;  2DNC A;  4A3G H;  1QWY A;  5FLM H;  2F0V A;  3ITP A;  1FJG Q;  1UE5 A;  4DR2 L;  1TWC B;  2AQ2 B;  5C3E H;  4P75 A;  4DV5 Q;  3TN2 A;  2B2Y C;  3L0O A;  4KTA A;  1I4P A;  1S5D D;  2QKI C;  3TDQ A;  1SRO A;  2LMC B;  1ML0 D;  4Q5V A;  4A93 H;  3DWA A;  3TP8 A;  2PW7 A;  2IL8 A;  2KED A;  2JXM B;  5M5Y H;  3GP7 A;  3H3V C;  3S2D B;  4P74 A;  5ELC A;  5GAG C;  2E2I B;  1RCV D;  4DR5 Q;  4PMB A;  2PO4 A;  1E2V A;  4ZQ3 A;  5FK9 C;  2SOB A;  1X3Q A;  2CWP A;  3D0F A;  1BXT A;  1HQR D;  2Z4H A;  4JPB W;  4NDX A;  4ZYS A;  1ASZ A;  4BY7 H;  3PO3 G;  3E0J A;  4F87 A;  4LWC A;  5FLX c;  1IKM A;  4IUV A;  4JI3 L;  3WDN A;  4KD4 A;  5M9O A;  5COY A;  2X6L A;  1WTV A;  4A3G B;  4LFA Q;  3A8K E;  4RFB A;  5IYC H;  1VQE A;  4A3B G;  1CKO A;  1A3T A;  1SND A;  3QOL A;  1VQC A;  4X3S A;  1K9M C;  1WCM G;  4KKS A;  3RN2 A;  1VQG A;  5LMU L;  3TP5 A;  1YNJ D;  4A93 B;  4PG3 A;  2MO1 A;  5AJ3 L;  2EIF A;  5EPK A;  4P2C B;  3QIA A;  2SDF A;  1LUZ A;  3ND8 A;  2K1B A;  2D0O A; 
#chains in the Genus database with same CATH homology
 3HKZ G;  5GQO A;  2CQO A;  4GNX A;  2E2J H;  4L5S A;  4DR7 L;  4IFD G;  1CKN A;  3T1Y Q;  3JC6 6;  2DGY A;  1BVS A;  4DUZ L;  2R7D A;  2ZM6 L;  4B3R L;  1L1O A;  3GTJ H;  3UDF A;  1PYS B;  2PNH A;  2RCN A;  1XJV A;  1KAW A;  2HHH L;  1UE7 A;  3PV0 A;  3W5O A;  1Z47 A;  4UP7 A;  1PH4 A;  4A3J G;  4LF6 Q;  4LF7 L;  4DR4 L;  2R92 G;  1HNX Q;  3BZK A;  3PIO A;  3M9B A;  5C0X G;  4B3T Q;  3S17 H;  4C2M H;  3UDI A;  4K0K L;  4BY1 G;  3ZJY C;  4B3M L;  2IHE A;  2ID0 A;  4OON A;  4R4Q A;  4RG1 A;  1YJW A;  3GD7 A;  5FJ8 H;  1X3F A;  3KOJ A;  1Q1E A;  3HOZ G;  2FXQ A;  1QZH A;  4KI0 A;  4JOI C;  4DV7 L;  1Y1W H;  1TWC H;  2KEN A;  4JI8 Q;  1VS0 A;  4JI2 Q;  1C7Y A;  4JI1 Q;  4DUY Q;  1P16 A;  2NVX H;  1IBK Q;  3M85 A;  2OWO A;  3KFU A;  2KHI A;  3A0J A;  4APV A;  1X3E A;  5H1S E;  4A3D H;  2LXK A;  1X55 A;  3KYH C;  4LF5 L;  1WOC A;  3S1R H;  2KBN A;  2CWA A;  3HFZ B;  3BJU A;  4A3L H;  1IBL L;  5IYD H;  4LFC L;  4JI7 Q;  3OTO L;  4A76 A;  1X6O A;  1FVI A;  1QZG A;  2Z6K A;  1C0A A;  3I4N H;  1I3Q H;  1HNW L;  2YTV A;  4IFD J;  2VL6 A;  2VY3 A;  4UP9 A;  2QEX A;  4GN4 B;  5C4J H;  1XNR Q;  3FKI H;  3RZO H;  2A1A A;  4B3S L;  1ASY A;  1SR3 A;  1XPR A;  4JI0 L;  2NZO A;  4DV2 Q;  1VCI A;  4DV4 Q;  1XMO Q;  1VQ9 A;  2UXB Q;  3K0X A;  4J15 A;  1IBM Q;  1SE8 A;  2JA7 G;  5ELO A;  1FGU A;  4UY8 C;  2EXD A;  3AYH B;  3PUZ A;  2E5L L;  1OXU A;  3CCQ A;  1L1O B;  2JK8 A;  1GD7 A;  2QGQ A;  1VQL A;  5C0X J;  4KHP L;  3TS2 A;  3EBE A;  3AQQ A;  1K3R A;  2WB1 E;  3PUY A;  4MNO A;  4JI6 Q;  2KCT A;  3S1N H;  2WAQ E;  2Y0S E;  3I55 A;  4HIM A;  1KRT A;  3A5Z B;  5C3E G;  1WFQ A;  4IPH A;  4R4C A;  5GAE C;  4LF4 L;  1I6H H;  5HY6 A;  4OWT B;  1M90 C;  3KJP A;  4DV3 Q;  4HIK A;  5JJI A;  2NVT H;  1XPO A;  3J81 j;  3STB C;  2JA6 G;  1IYJ B;  4A3F G;  1E7Z A;  3M3Y H;  4BXX H;  3H0G G;  2Q2H A;  2WFW A;  1N36 Q;  4QIW E;  2VZA A;  2UUC Q;  4JI4 L;  4KHZ A;  3F2C A;  1XNQ Q;  4IOC A;  3HOY G;  1BBW A;  5C4X G;  1JJ2 A;  2NN6 G;  1N32 L;  5M5X H;  4JYA Q;  4OO1 G;  4NXN L;  2N3S A;  3HOU G;  4BBS G;  1YJ9 A;  1DGS A;  1EUJ A;  3E9I A;  1GM5 A;  4X65 L;  5M3M G;  1HR0 Q;  2JEA I;  1EOV A;  2I5M X;  3CPW A;  1G29 1;  4X64 L;  3BZC A;  4GKK Q;  1Q86 C;  5BR8 Q;  4O2D A;  3GTG H;  1Q12 A;  3F8T A;  1PH9 A;  4DR3 Q;  1RIP A;  1X54 A;  3CME A;  4HJ9 A;  2R93 H;  3M4P A;  1Q8K A;  3D31 A;  3F2D A;  3CP0 A;  2AKW B;  2ZJR A;  3T1H Q;  4DV0 Q;  5E7N A;  5GAH C;  1V9P A;  1EWI A;  1AE2 A;  1FL0 A;  3CCS A;  2UUB L;  3PCO B;  1G6P A;  2YV5 A;  1UWV A;  1V1Q A;  1Q46 A;  1YBY A;  1LYL A;  3U4Z A;  1C9O A;  1D8L A;  1NJI C;  4DR2 Q;  3I4M G;  4YHH L;  5LMN Q;  1SFO H;  3PGZ A;  2Q2U A;  2CCZ A;  2MFI A;  3CC2 A;  1Y14 B;  4PZ6 A;  1EYG A;  2B63 H;  4YCW A;  3BU2 A;  4AYB E;  4KLK A;  4IOA A;  1EIF A;  1HJP A;  1IL2 A;  4YCV A;  3UDG A;  1G51 A;  1KL9 A;  2I0Q A;  2NVQ H;  2RHQ B;  2XGT A;  3TS0 A;  2JA5 H;  3HOW G;  2N8N A;  4LW1 A;  4OO1 I;  3PO2 H;  4GOP B;  2YTX A;  3HOV H;  1EIY B;  5IWA Q;  4A3E H;  3U58 A;  2UUA Q;  4X66 L;  4HJ7 A;  1YJN A;  1XMQ Q;  4BBR H;  2UXD L;  3DM3 A;  4BA2 I;  3UE0 A;  4A3C H;  4DR6 Q;  2R7Z G;  1Y1V H;  4QY7 A;  3MEF A;  1QVF A;  2BA1 A;  3HKS A;  3H15 A;  4P71 A;  4UPA A;  4HIO A;  4A3K H;  4LF8 L;  4JV5 Q;  4RMF A;  5JJK A;  2VQE Q;  4DK3 C;  1X3G A;  1VQD A;  2AMC B;  4JI2 L;  4JC0 A;  2VQF L;  5C44 H;  3Q8D A;  4EX5 A;  5M3F G;  4C3J H;  4JI3 Q;  1VQB A;  3E9H A;  1HZC A;  4HJA A;  2UU9 L;  2F4V L;  1PVO A;  1M1K C;  1VQI A;  1KD1 C;  4P72 A;  4YY3 L;  3CCE A;  1W2B A;  2Q2I A;  3RLN A;  4A4I A;  4JI7 L;  2EQS A;  1OTC A;  1N34 L;  4A3M H;  1MKH A;  2JE6 I;  1X65 A;  3TEH B;  5HGQ A;  1I5F A;  5LMN W;  2I5H A;  1I94 L;  4GOP C;  4PMW A;  3M7N A;  2C35 B;  3UE1 A;  1XNR L;  1WJJ A;  1E1O A;  4UP8 A;  4GKJ Q;  2JA8 H;  4OX9 L;  4GN5 A;  1HNZ Q;  5IYD G;  4AQY L;  3KF8 B;  5LMU Q;  2PMZ E;  1YHB A;  3K80 C;  2IY5 B;  4DNI A;  5GAD C;  4LF7 Q;  4WJ4 A;  1TWF H;  4POG A;  3CF5 A;  2PQA A;  1BBU A;  3PUX A;  3B6Y A;  5AJ3 Q;  3HOX G;  1K83 H;  4GS3 A;  4A3I H;  3PSI A;  2RHS B;  4A3J H;  3GTP H;  2BH2 A;  4DR1 L;  1Q7Y C;  1N33 Q;  1KRS A;  3OYY A;  3F1Z A;  3S14 H;  3JAM c;  1N9W A;  4LUO A;  2R92 H;  2K14 A;  4IFD I;  5K36 G;  1CSP A;  2I5L X;  4DUZ Q;  2ZM6 Q;  1S40 A;  4B3R Q;  4Y52 H;  1KIX A;  3ERS X;  4QGU A;  2VUM G;  5GRO A;  3A74 A;  2HHH Q;  1VQJ A;  3CC7 A;  1VQ6 A;  4PZ8 A;  2WB1 G;  4H02 A;  1FJG L;  3JAM i;  4DR4 Q;  2ASB A;  3H3V I;  4GNX B;  1A8V A;  2IHF A;  2WAQ G;  2Y0S G;  3KDF A;  1YHA A;  3NEN A;  1CKN B;  2AWO A;  4TQU S;  1PV4 A;  3PF4 A;  1B8A A;  1L0W A;  3CCR A;  1A63 A;  1CKM A;  4DV5 L;  2ZJP A;  4K0K Q;  2D62 A;  2YTY A;  2ALY B;  1PH2 A;  4A3G G;  4B3M Q;  4YWK A;  5C0X I;  5FLM G;  3PIP A;  2OQK A;  1JB7 A;  2F3I A;  3EIV A;  3K81 C;  1QUQ A;  4OWX B;  3RLO A;  4LFB L;  3FP9 A;  3G48 A;  4NB3 A;  4JI5 L;  2H5X A;  4DV7 Q;  1KXL A;  4MZ9 A;  1VQ4 A;  4BXX G;  3S1Q H;  2HQL A;  2UXC L;  2A8V A;  1HZB A;  4DV1 L;  5IP7 G;  4DR5 L;  4YWM A;  3J7A 5;  4XTC S;  4LF5 Q;  3ULL A;  3GO5 A;  4A93 G;  3GTL H;  4LF9 L;  2ZJQ A;  2WP8 J;  1IBL Q;  4LFC Q;  5ELN A;  3OTO Q;  4C3I H;  1VQP A;  3S1M H;  4GNX C;  2OCE A;  1OXS C;  1NBW A;  1OXT A;  5IYB H;  2KHJ A;  1HNW Q;  2K5H A;  1L1O C;  1OXX K;  3NEM A;  1J5E L;  2IT1 A;  3A5U A;  1D7Q A;  1CSQ A;  1U5K A;  2PQA B;  4B3S Q;  4JI0 Q;  2BA0 A;  2MO0 A;  4IO9 A;  4BY7 G;  1NMF A;  2E8G A;  2AHO B;  2IX1 A;  4LFA L;  1E22 A;  1AE3 A;  1YNX A;  4NPS A;  4ME3 A;  4GN3 B;  5DLQ E;  4NXM L;  3PF5 A;  1VQF A;  4TVA B;  3DLL A;  2CFM A;  2E5L Q;  4GLX A;  4OWW B;  3CCL A;  3M4Q A;  4KHP Q;  3KF6 A;  4JOI A;  3K7A H;  3TRE A;  1NTG A;  1OXV A;  2LSS A;  5J3B A;  1Q82 C;  1PH8 A;  1UEB A;  4X62 L;  3U50 C;  4A3F H;  1V43 A;  5IYC G;  2PI2 A;  2ES2 A;  4LF4 Q;  3W1G A;  3AEV A;  4IPD A;  4AYB G;  3NBH B;  3RLF A;  3WWV A;  5C4X H;  4DV6 L;  3HOY H;  2F52 A;  4L5Q A;  2B63 G;  1WI5 A;  1YZ6 A;  1QVG A;  4IPG A;  3G6E A;  1TWA H;  4IJH A;  2R6G A;  4LUV A;  4JBK A;  1QUQ B;  1WYD A;  1E3P A;  1KHI A;  4R4I A;  4JBW A;  3CCJ A;  3T1Y L;  2JA5 G;  3J80 c;  1QVC A;  4LUZ A;  5M3M H;  2Z6K C;  1O7I A;  2Z0S A;  4JI4 Q;  1YEZ A;  2VS1 A;  3CW2 C;  4JG2 A;  5JJL A;  2KCM A;  3PUV A;  1PA6 A;  1N32 Q;  1IZ6 A;  3STB D;  4NXN Q;  1SLJ A;  4LF6 L;  3J80 i;  2NN6 I;  3GDE A;  2OTJ A;  2L15 A;  4P73 A;  3PO3 H;  1Y1V G;  2ZTE A;  3I7F A;  1HNX L;  5JEA G;  4B3T L;  4X65 Q;  3L2P A;  4A3K G;  1HZA A;  4ALP A;  4X64 Q;  1HR0 W;  2LXJ A;  2B3G A;  3KJO A;  3RNU A;  4XIG S;  5C44 G;  3CXC A;  2K75 A;  3AFQ A;  1JJG A;  1TWH H;  4C3H H;  2OTL A;  5IP9 H;  3VDY A;  4R1J A;  4JI8 L;  3AFP A;  4JI1 L;  1B70 B;  4DUY L;  1HZ9 A;  4A3B H;  1IBK L;  1K0R A;  4YWL A;  2UUB Q;  1TXY A;  2K4K A;  2IX0 A;  5IE8 A;  3PUW A;  5FJ8 G;  2YYZ A;  3CQZ H;  1NMG A;  1X9N A;  3ICE A;  2OQ0 A;  2CKZ B;  4DK6 C;  1PHJ A;  1JT8 A;  1YIJ A;  1WCM H;  1Y1W G;  3TQY A;  4YHH Q;  3CAM A;  3HOW H;  2MNA A;  2JA8 G;  1J6Q A;  1RL2 A;  3RZD H;  1PH1 A;  1GVP A;  4IPC A;  3UDX A;  4A3D G;  2NZH A;  3I56 A;  4A3L G;  2N49 A;  4DV2 L;  4DV4 L;  1XMO L;  2HIV A;  4DKA C;  1R9T H;  4JCV E;  2R7Z H;  2UXB L;  2JJQ A;  1IBM L;  4A3I G;  1XTD A;  3HKZ E;  3MXN B;  4GLV B;  1PH7 A;  3I4N G;  3TRZ A;  2D0P A;  1E1T A;  1W3S A;  4MTN A;  4O0A A;  3FKI G;  3H3V H;  1GKH A;  1U0L A;  3KLW A;  4PZ7 A;  5JEA J;  4X66 Q;  2UXD Q;  1LTL A;  1JE5 A;  3G71 A;  5M3F H;  2NVY H;  4DR7 Q;  4JI6 L;  2N78 A;  1E24 A;  2DUD A;  1A0I A;  3RR5 A;  1YVC A;  2GVA A;  4DAY B;  4LF8 Q;  1EFW A;  4BA1 I;  4BY1 H;  4AIM A;  1P8L A;  4HID A;  2XTI A;  2ZTC A;  3ER0 A;  4DV3 L;  2VQF Q;  1NY4 A;  1CUK A;  3HOZ H;  3E0E A;  3SGI A;  4HJ5 A;  3OW2 A;  3J81 c;  1SMX A;  4QQB X;  1K8G A;  4L5T A;  2UU9 Q;  2F4V Q;  3CCM A;  3J7Z C;  4YY3 Q;  2GN5 A;  1N36 L;  4JBM A;  2UUC L;  3S15 H;  1N34 Q;  1XNQ L;  1SN8 A;  2R7F A;  3J81 i;  3S24 A;  4JYA L;  1MIU A;  1I94 Q;  3W1B A;  1I50 H;  3HOX H;  1YHQ A;  2HIX A;  3K7U C;  1PH3 A;  1JMC A;  5IY0 A;  3GTO H;  3S2D H;  4A75 A;  3L7Z C;  2E2I H;  3CPF A;  1KQS A;  3I2Z A;  3CCV A;  1HR0 L;  1PFS A;  4OX9 Q;  4DAM A;  1UE1 A;  4AQY Q;  1VQ8 A;  4GKK L;  1LM0 A;  3CCU A;  5BR8 L;  4R4T A;  1EQQ A;  2V1C C;  4Y7N H;  3CMA A;  4DPG A;  4DR3 L;  5IYB G;  2VUM H;  1NE3 A;  1VQH A;  1S3O A;  2JQO A;  3RN5 A;  1JJC B;  1SRU A;  2JA7 H;  1VQ7 A;  1UE6 A;  4GLA C;  3FHW A;  4DV0 L;  3T1H L;  4DR1 Q;  2GVB A;  2VNU D;  1AH9 A;  1VQA A;  3U4V A;  2E2H H;  4IJL A;  4A3G H;  2R93 G;  5FLM H;  1T9H A;  2B29 A;  1FJG Q;  3IRB A;  1UE5 A;  1MJC A;  4DR2 L;  5LMN L;  1K8A C;  5C3E H;  3CC4 A;  2BH8 A;  3LGJ A;  4LNQ A;  3NEL A;  4P75 A;  4DV5 Q;  3GTK H;  3S2H H;  4GOP A;  3EN2 A;  3L0O A;  4R4O A;  1K73 C;  2RF4 A;  5IP7 H;  5IT9 c;  1SRO A;  2JA6 H;  4LFB Q;  3KDF B;  1YI2 A;  4A93 H;  3H0G H;  2UXC Q;  4JI5 Q;  1YIT A;  2A19 A;  1IXR A;  3I4O A;  1A62 A;  3GTQ H;  5M5Y H;  3S16 H;  5IWA L;  1Q1B A;  1Z9F A;  4P74 A;  1KC8 C;  2UUA L;  1XMQ L;  5GAG C;  3F2B A;  1PH6 A;  3HOU H;  1N8R C;  4DV1 Q;  4BBS H;  4DR5 Q;  4DR6 L;  4YCU A;  2CWP A;  3D0F A;  2PI2 E;  1ASZ A;  4LF9 Q;  1TWG H;  1PYB A;  4BY7 H;  4JV5 L;  1H95 A;  1EQR A;  3PO3 G;  4AH6 A;  3PO2 G;  1Q81 C;  2ATW A;  2VQE L;  4X6A H;  1X56 A;  3HOV G;  4A3E G;  4POF A;  1XPU A;  4L5R C;  4BBR G;  1GO3 E;  4QJF A;  4LWC A;  5FLX c;  1J5E Q;  4A3C G;  4JI3 L;  4QL5 A;  2K5V A;  3ULJ A;  2VW9 A;  2K50 A;  1VQ5 A;  4LFA Q;  2JEB I;  5IP9 G;  3M4O H;  5IYC H;  2YU9 H;  1VQE A;  1B7Y B;  4NXM Q;  4A3B G;  3G4S A;  2ZTD A;  4JBJ A;  1CKO A;  1MJE A;  3GTM H;  4WJ3 M;  2JA9 A;  1HH2 P;  1BKB A;  1L2F A;  3K8A A;  4FDB A;  3I4M H;  1S72 A;  1VQN A;  4GKJ L;  1VQC A;  2AWN A;  1HNZ L;  3ULP A;  1K9M C;  1WCM G;  4X62 Q;  3RN2 A;  1VQG A;  5LMU L;  3CD6 A;  4A3M G;  2MQH A;  4HJ8 A;  2QA4 A;  1VQM A;  4PG3 A;  2MO1 A;  4DV6 Q;  5AJ3 L;  3KF6 B;  2EIF A;  5EAY A;  5M5W H;  1PH5 A;  4OXP A;  1LUZ A;  2Q2T A;  1VQO A;  1VQK A;  2K52 A;  2HT1 A;  2K5N A;  4EQ5 A;  2D0O A;  1N33 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...