2I5UA

Crystal structure of dnad domain protein from enterococcus faecalis. structural genomics target apc85179
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
77
structure length
77
Chain Sequence
SNAIRSIWENNGFGLMSSKTMTDFDYWISDFEKIGASQKEAEQLIVKAIEIAIDANARNYNYINAILKDWEQRGFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.5 A crystal structure of a DnaD domain protein from Enterococcus Faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
molecule keywords DnaD domain protein
total genus 27
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.630 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A DnaD domain-like 2i5uA00
2I5UA 2ZC2A
chains in the Genus database with same CATH superfamily
2KT0A 4NUBA 2BY1A 1YJNI 2E1MB 1XD7A 5FJ8J 1KA8A 3SYTA 1JKQC 4XOPA 4UUVA 4XR6A 1FT9A 3WE2A 4HZFA 3DLLF 1H89C 2K7LA 5DCFA 2Y0MA 3P9KA 1ZGAA 1A6QA 2CW8A 1OISA 2GAUA 3ELKA 3IKTA 1IC8A 3Q0WA 1VQ8I 2DMQA 5DTDA 1OJLA 1MSFC 1ZH5A 2OQGA 3I4PA 3RPUA 2OCEA 3OWTA 3GLXA 1WPKA 2RC4A 1I5ZA 4IHVA 2JRTA 3ZOBA 3MKYB 1DPRA 1WHUA 4Z2YA 3VPRA 4I76A 4C9YA 4RMNA 2XUBA 3FKJA 4D7NA 1U8BA 1IG7A 3SDBA 2QSGX 1A5JA 3FMQA 3I53A 3M3YJ 4ZDOA 2R5YB 2VBWA 2BXZA 2MW8A 1FBQA 1R4MB 1SD4A 3M8EA 1X1DA 4LK1F 4WXCA 2HOSA 4L18B 5IT9Z 3PJRA 1BR4A 3L2RA 4NC6A 2LY2A 3B02A 4NNJA 3OYHA 3JRHA 1BI3A 2FJ1A 4B1RA 4YIFA 1GVJA 2NS8A 1JKPC 1A35A 2FBHA 5GAHJ 1RUOA 1PJRA 2FSWA 3KZZA 1D3YA 2P4WA 1LFPA 2NVUB 3DKXA 3ZMZA 4IKFA 2VONA 3IHUA 2QBYB 2GOXB 1MDMB 4M6VA 4F93B 2ZJRF 1I3AA 4NDLA 1XDSA 4G7HF 2CS3A 2M0MA 2ME0A 2D1HA 2VXZA 3M4OJ 4FETA 2GIVA 4EV0A 4KJZA 1BA5A 4OIQF 2KKOA 3CQZJ 1I6XA 4OMZA 1DQUA 2GLOA 5LEJA 3LA3A 1RKWA 2ZBKA 1IRXA 4OWRB 1Y8RB 3PQJA 3OYLA 2OD5A 1Z7LA 4IHXA 2XAQA 2JT1A 1FC3A 4BJ5C 4UVBA 2W25A 2VUMJ 4J19A 2UXNA 1YIJI 1K7AA 2LRDA 4B44A 5F1RA 2H6BA 1TW3A 2ADUA 4CUGA 3CC4I 2EA2A 4DYQA 3W2AA 3FXMA 1LVAA 3E3VA 4ESJA 1K78B 3N4MA 3S93A 4EMSA 1IN4A 3CJNA 1Y0UA 2H09A 3R0AA 4C3HJ 2LH9A 1ZKGA 3E1SA 4RB0A 3HC7A 2GXGA 3BJ6A 3LAJA 3J80K 5ICCA 4LIUA 3HOUJ 3KP3A 3BJOA 4ITVA 3GBGA 3F8MA 2E2JJ 2XPWA 3OR2C 2HEOA 1E3PA 3MKLA 4A12A 3EYYA 1MJ9A 1U9OA 1HW1A 2BVMA 1HSTA 2VN2A 3IRQA 5KVRA 4ASNA 4AU7A 1U5TC 2NYXA 1FYMA 4B3XA 3RKXA 1BI1A 3W2VA 1PP8F 2H1LA 3IWZA 2JA5J 4PFOA 5TGTA 2NVTJ 2IVMA 4I98B 2IJLA 1GV5A 2JVGA 5GAEJ 2KIQA 2EK5A 3BT9A 3IAS2 2Y2ZA 3ABTA 5FLXZ 2K02A 4FHTA 5DYMA 2AHQA 1B59A 2DA5A 2L54A 4S04A 3HL2A 2ZMEA 4NQWB 1LPQA 2W84A 2B9SA 2IBDA 4HYEA 5D5VB 1TQPA 1W5CC 1BI0A 5HDKA 4D1QA 1K4SA 1OR7A 3B6CA 2BVLA 4XSZF 4RAYA 2ZKZA 2V1DA 2EINH 5EG0A 1L0OC 1SAXA 1XCBA 3CCYA 3Q9SA 1Y1VJ 3NWSA 1BI2A 1WRJA 5B3SH 3CCMI 3FBIB 4G6QA 2M5WA 3D5RC 4LK0F 3E5XA 1LE8A 2KQRA 4HNTA 3BR1A 1B1BA 4BEHA 3ERED 3F8CA 1MBGA 4B43A 3EYIA 1BC8C 2GQQA 4KT6A 3KEQA 2VASA 1T0FA 1XTAA 1D8JA 1IUYA 4MO7A 3V7RA 2PFBA 2ZO4A 1RPWA 2BW3A 3E5UA 3A01B 3WHCA 1UMQA 2VBXA 2C6YA 1R71A 2N8GA 3GLLA 2H27A 3QPHA 3O2PE 2HOTA 4HA8A 3TQNA 4E7LA 4YFNF 1SMTA 3QP5A 2HDWA 4U87A 4N9IA 2H8RA 1A04A 3V8JA 4AIKA 1F36A 5EJCA 3L2WA 4HQMA 5D8LB 4U0WA 2LK2A 3G6EI 2DMTA 5FFXA 2VE9A 2O3FA 1R1TA 2CUZA 5J4VA 3RTRA 2XVCA 1XDUA 4HLXA 2ELJA 3WTWC 1ETWA 4AYBA 3LSIA 3L09A 3RKWA 2E19A 1U9NA 5BPIA 2L4AA 2WBMA 4BS9A 2W82A 1T33A 1WCMJ 2XIGA 2YU3A 5M5XJ 3K1NA 2K3PA 4IQJA 4ZYHA 3K4BA 2DTZA 1U0JA 5ERIA 2J5OA 4IHWA 2Q2EA 2A3SA 3LSMA 4MNUA 4BXXJ 4OIRF 3ZXSA 3WTSC 1W4MA 5C44J 3ZMTA 4Y13A 1N77A 3DFGA 2E5ZA 1UG0A 4M3GA 1GXPA 2CG4A 3HOSA 4P9FA 4U0VA 3BCBA 3F8BA 4KIBA 4YELA 2HVSA 1T6SA 2E34A 3CC2I 3W2WA 1QA6A 1FP2A 4XRSA 5E3MA 2QGUA 5D4SA 5CJ9A 1DP7P 3A2KA 1H8AC 3B6AA 2FF4A 3RCOA 2DFHA 4NQWA 5HLGA 4PGGA 3F0CA 1WZ2A 1LQ1A 1FTZA 4P55A 1TWCJ 4Y7NJ 2DAOA 2DMPA 4A0XA 5HS9A 4FCYA 1Z3XA 5L3GA 3E0JB 1Y8QB 1ZYRF 4HX8A 1BR1A 4OINF 1G6NA 2ZFWA 2R7OA 2JPCA 4AVZA 1TNSA 2WAEA 3DPLC 4V2GA 5IP7J 2XROA 1PDNC 2OQRA 4BE1A 4DNCA 3BCAA 2NAZA 1HKQA 4F92B 1MBKA 3CCSI 4S0HB 5EEGA 5DCMA 3REOA 3J7ZI 1R00A 4CYCA 1OYWA 2YX4A 2CQQA 3HGGA 1BOAA 1MNEA 4A3JJ 2JA7J 3DBHB 1HKSA 1W7PA 3CD6I 2HQAA 2JUCA 1ZR2A 4MHGA 2KHMA 4DZPA 3W6VA 2RREA 1N75A 5ILVA 3PQKA 4GGGA 2ZJ2A 1Y6IA 3A4CA 5E20A 1QQIA 3BTLA 3FHNA 3OYMA 3IP4B 4M71A 3W6KB 3DXJF 4BHCA 4JK1X 1FJLA 2QF7A 3GZ5A 3K1PA 3CLQA 2PEXA 2DYSH 5HS7A 1OFCX 2BY0A 4XM3A 3CDIA 2ZMEC 2YSRA 2AS5F 1KU9A 5FKOA 3HOTA 1IUFA 3OIQA 1QHGA 4IEJA 1KQ9A 2V26A 2VIXA 4C30A 3T8RA 1K61A 2L02A 5B5EC 5L3BA 2PMZN 2VPLA 2EFQA 3DPTA 3H5RA 4HEA2 1W5SA 2MFZA 1OQYA 3O3KA 2OZ6A 5GTHC 2HYGD 4F7ZA 1EV7A 4P96A 5LFAA 3RZDJ 3CJRB 4A3FJ 3LMMA 5KAIC 1O7FA 1FY7A 4ETSA 5FLMJ 4LB5A 3DTIA 3ZRGA 1P4WA 2P6TA 1U5TA 2JSPA 2JA2A 4M9ZA 3H3VK 1OCZH 3LOCA 3V4GA 4B3AA 3HTUA 4OIPF 4LLNA 4V2FA 2VJ5A 3ABUA 2Y0SN 5E8GA 1J75A 2Y31A 3SDGA 3ONQA 2H8WA 2I5UA 2QUFA 5B1AH 1YFHA 2DT7B 5JVTA 4ENMA 1T95A 5LRSA 4ZYGA 5D8KB 1MD0A 3G71I 3E6CC 2WADA 1R6RA 2X6YA 4ZTFA 4LG0A 3ZQCA 5LHGA 3J81K 1YHQI 4I02A 3RPUD 5J8FA 4C2UA 1S8NA 4ZYDA 5GTIC 2FUG2 1LFBA 1I1GA 2L01A 2KJBA 3WTUC 3IL2A 2LREA 5HLHA 3F21A 1I6HJ 1P7IA 3LA2A 4E7ZA 4WWCA 4H4KC 1QGPA 1ZN2A 3TP0A 4JQFA 4GCVA 2KMUA 3OS2A 4BNCA 2F4OB 2PG4A 2MLKA 2XAJA 3BROA 2M4GA 1IV8A 2JWTA 4OOIA 1FIPA 2Z2SB 1FOWA 1FIAA 2FQ3A 1R5GA 1WKMA 3BTJA 3J7AO 2ACJA 4AYBN 1TBXA 1QNTA 3CUQC 5CKTA 1B8IA 2XB5A 3GUDA 4L9NA 4RGSA 4A3CJ 2H1KA 2BOLA 4HOBA 4EQQA 4NB5A 3OSGA 1IN8A 3E97A 5F0CA 4B09A 2BZTA 1ZHFA 2KIMA 3GFLA 2RAEA 4QIWN 4NC7A 5GAGJ 2PJRB 3UKGA 2R92J 2HFHA 3O8GA 2UWMA 2DW4A 1TNTA 3JSPA 1APLC 2MA3A 2A68F 3F22A 1YJWI 1VQNI 3MZ8A 1ENHA 3BG7A 3S1RJ 5E17F 2X1DA 3HOXJ 2ZXJA 2CJJA 1T8IA 1VQ4I 2VODA 3CCRI 2VOPA 2DDAA 1IXCA 4PJLA 2VBYA 1MBJA 3JRGA 2L3DA 3GTOJ 1AWCA 2OPTA 3I55I 2Q8KA 3K1MA 3TW7A 5EF6A 3ULQB 2DU9A 1EH7A 5KCMA 3IH3A 4DYCA 4UV8A 3K4JA 3BJAA 3LFKA 1U6GA 3GEZA 2F5FA 1V5GA 3GTJJ 2DOEA 1X2NA 4BGDA 3ZQGA 2PI0A 2L9VA 2MSYA 1P4XA 2LKXA 3QODA 4IOCF 2QKMB 2LC2A 2MGQA 2VC0A 3PFYA 2W7NA 4X6AJ 2QSHX 3CMAI 4WF2A 5H6QA 2MYSA 1FPQA 1IXSB 1NG7A 2DA6A 2MD0A 3KP4A 1B9MA 1FMWA 4CDGA 1UAAA 3BG5A 1DPUA 1E17A 3IWFA 2OF7A 2XF5A 1R36A 5LRRA 4GDFA 1XX5A 3I64A 2HQNA 3JRDA 2DMNA 1KU2A 5LGUA 2CV1A 3N05A 3KCCA 2DLLA 1YW8A 3W6JB 4PK4A 1R5HA 1LEAA 2KRCA 3K10A 2RQPA 3K70D 2VKHA 2WB1N 3HUGB 2IGNA 2FD5A 3RYPA 5LHHA 1FX7A 5F6FA 4RAZA 4DGWB 2DI3A 3IV5A 3I4MJ 2IS2A 2VXDA 5M3MJ 5GADJ 3K6GA 3BTIA 3FIWA 1ETOA 2L7ZA 1UCRA 4WK8F 3F8NA 5DM6F 3BZ6A 3K4CA 2RV8A 3EPZA 2E1CA 3C7JA 4FE7A 5FB2A 1I3QJ 4ZYAA 2DT5A 4ESFA 2M4KA 1J09A 1D1BA 2VL8A 2ZXIA 3CCEI 4MLOA 1ETQA 4DJAA 3HIFA 4EJTA 1I1SA 3WGGA 1F4KA 1VF9A 2ZJQF 3EQLF 1Z3YA 4UHTA 2VJIA 5DD8A 3NEUA 4E70A 3DP7A 4Y15A 2HXOA 3CZ6A 1IRZA 3A0HC 5FKNA 3ZMDA 2JA6J 2QKLB 2Y9YA 5K7FA 2QEXI 2GZWA 2HOEA 3WGIA 3CUQB 2X48A 2QBYA 4HLYA 3TGNA 4C2MJ 4BXUA 2WWYA 4G7OF 3ABMH 3GF2A 1RNLA 2CV2A 3CMYA 1UFMA 2ZNZA 1Y56A 6PAXA 1FNNA 5KAFC 1JHFA 1XMKA 4XBFA 1JJ6C 1JT0A 1SD7A 4XMYA 3U1DA 4XKWA 1TWHJ 2R5ZA 3AKZA 1IV6A 2DK8A 1GT0C 2UXXA 4LITA 4D5CA 2Z9OA 2HOAA 3JSOA 4M3BA 2Z1DA 2Z3YA 5EZGA 1MNMC 3JTHA 1FYLA 1TW2A 3V8LA 2V9PA 2R7TA 2CFOA 2G7HA 3QWLA 4A3KJ 3L7WA 5GPAA 1HBXG 2CW7A 1XS9A 1UHMA 3DBLB 3TO9A 4XL9A 4ZYEA 1VI0A 4XNFA 3HOWJ 2JMWA 1D1CA 1YE9A 2OA4A 1R5ID 4MGRA 5K7ZA 3VWBA 3BOQA 3K4KA 3LAPA 2OU2A 2EILH 3K2ZA 2W57A 2ESHA 2P0WA 4TV7A 2IEKA 2LFBA 4CHUA 4PDKA 2ZC2A 2CSOA 2Y69H 4ESBA 3JTGA 1JE8A 3DKWA 1WVRA 2FOWA 1W7PD 5E3NA 1QHHD 4RLFA 1ITYA 1BOBA 2CU7A 3CCJI 5E3OA 1QPMA 2XGDA 2VKVA 2PQ8A 4Y17A 5IT3A 2QQBA 3NARA 5LBQA 1HLVA 3F6OA 2E2HJ 3KZYA 2LF7A 4AIHA 1FOKA 1Y1WJ 1T98A 4KUMA 1ON2A 1ERDA 1FSEA 9ANTA 3HKZN 4A2UA 3HPGA 3WTTC 1BJZA 1I39A 2VKEA 3L2CA 1O3RA 2VJJA 1CGPA 2DJIA 3CUQA 3GYHX 3L2UA 3WTVC 4E7JA 1FOXA 4A6EA 4PSWA 5J4YA 3HHHA 2L7KA 4RBOA 3KIOA 4U88A 3I59A 1CQTA 4XLNF 2A07F 2P5KA 5EDNA 2XF7A 5HNHA 4EM1A 4G8XA 3NRVA 2VB6A 1WWXA 2OTLI 1Z9CA 1PUFA 2VPRA 2FOKA 3S16J 3A0BC 1Z6RA 4AWXB 1PUEE 1VQKI 3S1NJ 3CF2A 4KICA 5F04A 1GV2A 3FXKA 2HYFA 1YIOA 3S2HJ 1H0MA 1RI7A 2OV7A 2QQAA 2X1CA 1RUNA 4MQ9F 5JFRA 1WJ5A 3S1MJ 4UUSB 3VYUB 2RNGA 1R1UA 5LGNA 1X58A 2NOJB 1HF0A 2R4GA 2A61A 2K4BA 1K79A 4HX7A 2FNPA 4HSTA 4YRVA 3RKQA 3LSJA 2DTRA 2LSOA 4L5EA 1WI9A 5DUIA 3BZKA 2NRAC 3FXRA 3IRRA 2E36A 3LSGA 5TJJA 2HR3A 4BYYA 1FBSA 2AXTC 3IH4A 4A0YA 3KLOA 1TT0A 3TEDA 4HNUA 3C3WA 1TQMA 1TZLA 2GOMA 1P2FA 2K9NA 3LL7A 2B63J 4Y3OA 4ZZDA 4U7BA 2HU9A 1HCRA 3A02A 5F27A 3G1OA 5D5WB 2KRFA 2LD5A 3I0TA 3ZQFA 2X85A 1USSA 1J5YA 2V4JC 4HQEA 1QVTA 1S9HA 3H5NA 4M3EA 5JI6A 1X4PA 1JTXA 3V8KA 2X51A 4XQFA 1SVLA 1YYVA 1D1AA 1ORKA 1Z1DA 3DKYA 5CQGA 1VQ5I 1MW7A 3ZQIA 5CVIA 2IS4A 2BHZA 2K5CA 1X3ZB 3A03A 2LVSA 1CF7B 3BPXA 1USTA 3S32A 1W36C 2AXLA 2F48A 4XSXF 1G2HA 1JT6A 4I0AA 1WH5A 5BNGA 1J59A 2ZXHA 4E7IA 2V1XA 3OIPA 3L9FA 4EGZA 4XLAA 1OCPA 3PSFA 4B8XA 1YLFA 2ZFUA 3KYCB 5K1YA 2O0YA 1F9NA 2DXIA 1ON1A 4EM0B 2EZLA 1XGMA 2X1EA 5IPAA 3M7GA 1T38A 3H0DA 1ZQ3P 5E1XA 1JJ8C 5K5RA 1LB2A 1KYWA 3QU3A 2MABA 5A2QZ 1REPC 1VQPI 2XAFA 4YIIA 2F4MB 1ZARA 4M3DA 3DQVC 2ETHA 2O6GE 3S2DJ 4MTEA 2JUGA 5JVGF 1E3OC 3TMOA 4ENNA 1NK2P 1D0YA 4LG0B 4XORA 2KJCA 3TDUC 5E3LA 2EZHA 2L9RA 3NAUA 3RPQA 1YG2A 4DIQA 3VODA 5LEKA 3BLYA 1KONA 3K9TA 4BDZA 3VYSB 2KP6A 2XF6A 1VNDA 5CVJA 1XSVA 5EEAA 1E3HA 2HYJA 5FKMA 2KZVA 4XLPF 3FX3A 3E6MA 5EYRA 4PUSA 2QVOA 4DYRA 4UVAA 2PJPA 3ZQHA 2X9DA 4M6YA 2IS1A 4QPQA 1R22A 1WJBA 2R7QA 1EH8A 1W36D 2Y9ZA 4RA2A 1TP4A 1BN5A 4NC8A 1UELB 3CUOA 4PJNA 1B72A 1WFXA 3SXYA 3HXLA 3BY6A 2LY1A 2PMZA 1MSEC 2W4SA 4CA0A 1EJ9A 3WHBA 2G7UA 2OBPA 4YIRX 1M1EB 3LA7A 2HKXA 4Z6YA 1C0WA 1JUSA 1TWAJ 2DOAA 3QAHA 3FXJA 3GO5A 3H1CA 5B1BH 3GWZA 1OMIA 1FBUA 4G6DA 1AU7A 1AA7A 2BYVE 3F9KA 4YEJA 2KISA 3OV8A 2DJNA 2XPVA 2A5WA 4HG2A 2Z16A 1IW7F 3H3ZA 5LLQA 1QO0D 4IVNA 1Y39A 2V6EA 3ZQLA 2CH0A 5C4XJ 4XLEA 4BJ6C 3FM5A 2WV0A 1TC3C 2AQFA 5EGOB 4IXAA 2EB7A 1HOMA 1X1BA 3TO6A 3GX4X 4I09A 2R0QC 2CQKA 1ZAOA 5E18F 2M2EA 2VQLA 1WJDA 2R5ZB 3BWGA 2VQHA 4I0BA 1RC9A 2NNNA 2V7FA 2XC7A 4IRIA 1RETA 2R7DA 5DCMB 3S2WA 2LOOA 1ZGJA 3KYDB 1SD5A 4M6XA 3ZN1A 1XSDA 3HDDA 4EGYA 2F5CA 4BEHB 1KU7A 4FT8A 2D45A 1OCOH 3MQ0A 1I27A 3OOUA 1U5TB 3G1LA 3R0JA 3U21A 1HW2A 1V5EA 1XCVA 3HG9A 5E8IA 3G3ZA 2KDOA 3BR5A 1SVMA 2O03A 1YI2I 5J6XA 3SFZA 4G12A 3RZOJ 3OIOA 2M34A 1W5TA 2MBFA 1O3SA 3S17J 4FTHA 2ME6A 1PYVA 3V42A 1D0XA 3GTKJ 1Q1HA 3S14J 3DU5A 4GYGA 1W0UA 4IF4A 4O6JA 5L3DA 4LB6B 2DQLA 3CCVI 3QOPA 1MIJA 3T8TA 4HBLA 4RS8A 4XK4A 2FMLA 2JJ7A 1GDTA 3KEYA 1TTYA 1K6OA 3ZQ7A 4WCGA 3PNYA 4XOTA 3CF5F 5GPCA 2GXAA 4A3MJ 2XAGA 1P4AA 2E71A 2K9QA 2XSJC 3BQZA 2ELKA 3ZCOA 1WGXA 1YX5A 3F8FA 2P5VA 1P6RA 4II2A 3VEPA 3JREA 5IP9J 2DA7A 4D9JA 2Z99A 2MC3A 3VSLA 2KLOA 2ID6A 4KIGA 3X2QH 3CC7I 2TCTA 4BE2A 3E6DA 1U8RA 3IUOA 1SC7A 3MFKA 3J80Z 2EBIA 4I6ZA 4MTDA 3T0YA 5IYBJ 5FKKA 2K4JA 5F1JA 2LP0A 3VFZA 4PFPA 2FBIA 2XRLA 1YRNA 1WJAA 5KK1A 3BG3A 3S15J 1JUMA 3DEEA 4S05A 3UR3C 3ROUA 3S3NA 2F6CA 1KGSA 3H9QA 2DBBA 2EPFA 3WU2C 3H3UA 3ZMVA 4F91B 4OMYA 2O61A 2LY9A 1IRGA 4HSRA 2M7BA 4RAFA 3DBRB 2WY7Q 3M1CA 3LSTA 5CVVA 4MEXF 2ZSHB 4BJTA 4IHYA 3CESA 2JZYA 3H0GJ 5IYDJ 1BJAA 3KP5A 5J1UA 3QYFA 2DYRH 3KZIC 1AKHA 2EFOA 4LMYA 2K9SA 3I4NJ 2BV6A 4UV9A 3JAMZ 1P7JA 1EF4A 5HOOA 1LUJB 1SAUA 2E7XA 2XRNA 4J01A 1BM9A 2BXYA 4EM2A 2VQGA 2F4IA 2WC2A 1GVDA 4R1HA 3CO7C 4A3EJ 2F2EA 2L9SA 2AQEA 5ICFA 2M8EA 2E1OA 5JR3A 3WGHA 2L4MA 1IXRC 1JGGA 2LKPA 2CRGA 2B7EA 3HOVJ 4JOMA 3TW6A 2UZKA 4L0YB 2ECBA 2RNJA 3JCUC 2KFDA 2VE8A 1VQ6I 5JLWA 4PJ0C 4L5IA 3PO3J 1TT5B 3TDZC 5FRNA 4IQ4A 3KETA 2Q0OA 3R6SA 4LIVA 4DW6A 2WAFA 3B73A 3A01A 1HKTA 2RKHA 1SANA 3H36A 3M1EA 4MFEA 4N4OB 3QPLA 3T5XA 1R58A 4BBRJ 1Y0NA 3DLAA 4IHSA 3PIPF 2MD5A 1SMYF 1RIOH 2HTSA 3P7NA 2CWEA 3WU1B 1G3WA 3BP8A 3M8FA 2R5YA 1BW5A 5D5XB 1S7EA 1LKXA 4BHPA 1R49A 2R7XA 2IA0A 1ETXA 5E79C 2STTA 3CTAA 5IT9K 1P9QC 4P5OA 1MH3A 2P7VB 2XGCA 1OPCA 1IZ1A 3HEFA 3MWMA 2ISYA 2EJRA 2ZSIB 1VQOI 1D0ZA 5EG0B 3JRFA 4HV6A 4IZZA 1S72I 2DCEA 1MKMA 2A6TA 2AO9A 3ABKH 3HM5A 1LEBA 1YS6A 1J9IA 2XPUA 1IN7A 4LG3A 4ANJA 3BQYA 3C1DA 2ECCA 2BE5F 2IP2A 4XKVA 4XICA 2R7UA 2ELHA 2EIKH 1UJ8A 1YTYA 1G3TA 1MMSA 1ONVA 2NVYJ 3PIOF 4BBSJ 2K86A 1MZBA 2XB0X 4LJZF 5TISC 4IOAF 3RKYA 3Q0UA 1NTCA 1KQ8A 2F5DA 1S29A 3OYGA 3HB9A 3K4LA 4YG2F 4A3IJ 2R7VA 3D5SC 3I5UA 4BQQA 3GZNB 1R4NB 1V3FA 4B48A 4IRGA 4M72A 2K9MA 3KP7A 4XN3A 1JKOC 2IGMA 2ZB9A 4CCOA 2ZNYA 3GW2A 3HUGA 3MZYA 3SZPA 4K2EA 3C2HA 4RGRA 2HVRA 3WE3A 3GTMJ 3I3LA 4HRIA 1H9TA 4UVCA 1YO5C 4HF1A 4DBRA 5K5OA 1BBYA 4GRIA 3HZJA 2HKOA 2NXNB 1IN6A 1J2XA 1G3YA 2RQQA 4GO1A 3HSFA 5ILSA 2K40A 1IDYA 1BR2A 2DFEA 2DA3A 3U2RA 3CMMA 4WXHA 2XHKA 1IGNA 1HSJA 3BG6A 1BIBA 1WJEA 1T08B 3PUFA 2LNBA 3GTGJ 1O57A 1I50J 5DV5A 5DS9A 4KYWA 2G9WA 2HDCA 4F55A 4X0GA 1XN7A 3LWFA 2EFWA 1O4XA 2GA2A 4LFUA 5F08A 1B4AA 3PNVA 3TBIA 2EFPA 2VC1A 1YRNB 4HF0A 3TOBA 2XV4S 3HSEA 4EVIA 4F3QA 5J47A 1UG2A 3ZPLA 2COMA 3LQQA 1ZRDA 1QZZA 3EUKL 3I59B 1ETKA 4MFDA 3FWEA 1YX3A 4CGZA 2EZKA 2E7WA 4MEYF 3T1BA 1DUXC 3OMYA 2W85A 4MQVA 4JX6A 2E5NA 2EWNA 1ODDA 3Q0VA 1T39A 4ZZLA 1LDKB 3CO6C 1V5FA 2XGEA 3AG4H 2TDXA 3QQAA 1MMAA 1O7LA 4I2OA 4RB2C 3C18A 5BOXA 4A6DA 3OYKA 2IA1A 3R61A 3DTEA 2PMUA 3ZGKA 1RR8C 1WI3A 1UHWA 1YITI 3OYIA 3OYNA 3WU0A 1X3WB 5ICEA 1BL0A 2HZDA 1J7KA 2HGCA 3OYEA 4I7HA 1FTTA 2M9HA 4MIMA 3FK7A 2CYYA 4IL6C 4A69C 2EQRA 4PSXA 3FMRA 2P8TA 4N0BA 4BL0B 1JTYA 2IXSA 3M07A 2XAHA 2R7ZJ 3FXQA 1J0RA 4UUSA 1U78A 2O9LA 2LMDA 3FKIJ 2GWRA 1MDMA 5TRDA 2IGKA 3DEUA 5CLSA 2M3AA 4G6TB 3TP3A 1IN5A 1ETYA 4F52A 3EUAA 4KN7X 3CLOA 2YU9J 3FK6A 3J81Z 4UUTA 2W48A 1RRJA 4HPQA 1Z21A 2XKOA 4Y52J 2HQ5A 4EEFG 2F5VA 3BPVA 2CW0F 4CO8A 4O3MA 4WX9A 1MGTA 5F0HA 1TWGJ 3SEQA 5HLIA 3HTSB 4DOZA 2DN0A 3L00A 2CV0A 2HI3A 3AL0C 3Q9VA 3V7CA 5IY5H 2Z33A 2DOFA 5FO5A 3UNGC 3J7YJ 1N78A 2EH3A 2GIZA 3P9IA 3GTLJ 2LYCA 1BC7C 1TWFJ 5ICGA 3R4KA 3F72A 2CQNA 4BE0A 3ZMSA 1Z77A 1ZTRA 2DDBA 2IPQX 2PN6A 3C2GA 1KQ0A 4G7ZF 1DGWY 3K69A 2IT0A 4Q4ZF 2WY8Q 3HRMA 4ABZA 4B4CA 1SFKA 4AIJA 5B66C 4U0YA 1ZRCA 2HNHA 5E1WA 1HDDC 2WAQN 1BW6A 1UHSA 2M8GX 2EV5A 4Y33A 4ZJZA 1L3LA 3SHFA 2JN6A 4KITB 4Q5SF 1Q1VA 2Q2EB 2HXIA 1IRFA 1X1PA 4CXFA 4CCJA 1ZK8A 1S3JA 4CCLA 2MLGA 1PP7U 1K4TA 4BY1J 5BPDA 4BQOA 2FXAA 1D5VA 4UY8I 3VDXA 1G3SA 4XLFA 2X6XA 2JSCA 3DPUA 4GYIA 4L5JA 3OL3A 2GM4A 3DWLE 1ZG1A 2CQXA 2LLKA 4W1UA 5HS8A 4RB1A 1T0FC 1WH7A 2CFXA 3OS1A 1DDNA 2FQ4A 3MD2A 2OZUA 2WB1A 3KEOA 4KDPA 3JAMK 1DGRM 2M0CA 2E60A 1ZRFA 2JRMA 3FHZA 2E1NA 2EZIA 5LD2C 1LNWA 1GXQA 5C4JJ 1YW9A 5M3FJ 1VFCA 2DK5A 2Y30A 2DT6A 3TKYA 4V19K 3MKWB 3PO2J 3OYAA 3L2QA 1RR7A 5ED4A 2L5QA 2LTPA 4QSHA 3RQ4A 4QLCU 2STWA 2I10A 3D0SA 4HX4A 5F0FA 1S5LC 1FSHA 2K85A 4BDYA 2JPBA 4PGHA 2CGPA 4KMFA 2KIUA 3H5AA 1MJBA 4QPOA 3LQRA 2HQRA 2VLAA 2EIJH 3LSHA 2IA2A 4FASD 1O3TA 1HC8A 4E7KA 3L1PA 1R1VA 2XDVA 2M45A 5IYCJ 2IS6A 4HDUA 2M30A 3SZGA 2PBIA 5AIQA 5L3CA 1QBJA 4L9JA 2QZ8A 3GXOA 4N9HA 1ZREA 2E2IJ 4FISA 3ZMUA 2Z5UA 4E6KG 1H88C 1B72B 4XRFA 1VQ7I 2K27A 3H9JA 4IO9F 4HF2A 2NVXJ 4A3GJ 4OAYA 4EATA 2RVCA 4BU2A 3BR0A 3M8JA 5HDNA 3JR9A 1VQ9I 4QWQA 2R7FA 2GA1A 2RN7A 1ETVA 2UUZA 4C3IJ 1EKEA 3RI4A 4JP0A 2BHYA 4EJWA 3IAM2 5M5WJ 2P5LC 2X4HA 1JUPA 4Y4RA 3WODF 1G4DA 2JVHA 2CMPA 3MMYB 2R3SA 2VBZA 4BKXA 1SFXA 3GFMA 5KNLA 1HDPA 1OCTC 2CUFA 2QENA 4KT5C 1GLNA 5L3FA 1MBEA 1R9TJ 1LDDA 2DA2A 2FRHA 3JRCA 2NNYA 3HJEA 2PJRA 2EFNA 2Y75A 5JHUA 4FQGA 3QP6A 3G4SI 3K0LA 4EJOA 2JK3A 3TO7A 2RGVA 3HPHA 2HDDA 3GTQJ 1OYIA 2V1UA 3I71A 5LHIA 2WAQA 4A3DJ 4CCKA 1MH4A 4CYDA 2OTJI 3QYEA 1MMDA 3JRIA 2UV1A 4IHTA 2XKPA 2P81A 3OL4A 2VI6A 1XMXA 1U2WA 1HW5A 4OAZA 1K6YA 4ZC3A 4R79A 5D4RA 3OY9A 3CDHA 3SEZA 2EIMH 3FBNB 2HTJA 3QYBA 1QZYA 3GTPJ 4P1WA 3S8PA 4A5NA 2D2WA 3Q3SA 5KHDA 2A05A 3OYCA 4RB3C 4JYKA 4A0ZA 3MEXA 3K4MA 2K3FA 3DU6A 3GMEA 4AVPA 2QSFX 1XSXA 2Y0SA 1MMGA 3AG1H 1UB9A 3KPHA 4AIDA 1XMAA 4CSWA 2A5YB 3FISA 1MJAA 1FYKA 3MKZA 2RDPA 4RLQA 4OIOF 2FE3A 1S7OA 5AONA 4D7MA 4E7HA 2EV0A 3KLNA 3ZR8X 2VOOA 1NG6A 2WV1A 3DF8A 5FLVA 5CPRB 1Z91A 3VYRB 3VSKA 2VT3A 1HA8A 3K7AJ 2NS0A 4XKCA 3CJTB 4PCQA 2VQCA 5BS6A 4D0PA 2OCCH 1FEXA 3F6VA 3TOAA 3HRUA 4BQAA 1WSUA 4M74A 1MMNA 5D6FA 5EZHA 2R7WA 3GVAA 1OCRH 1GUUA 1Z67A 3AG3H 3O6BB 1QVUA 3I54A 4CCMA 2H6CA 1X1AA 1XC5A 4J00A 1GHCA 3AL0B 4RGUA 1PUFB 3PUBA 4RDUA 3FF5A 5J3LA 4DZJA 5JHFA 2DMUA 3IH2A 3KP2A 3KFWX 5EEHA 3BC8A 3D5LA 5ILUA 2B0LA 3ECOA 2LBFA 1VQLI 1F5TA 2IGOA 1Z7UA 3DV8A 1YOVB 3I56I 2M1BA 4PJMA 1OKRA 2HZTA 3FM3A 3HOZJ 5EGOA 4M3FA 4L9VA 4DBQA 1G8XA 1W7PB 1X4OA 3ZN0A 3S3MA 1P92A 5L3EA 1MBFA 3ZQQA 1QU3A 1SVOA 1HQCA 5BQTA 1QZEA 2K9LA 2IW5A 3H35A 3G2BA 3OS0A 4II3A 2P7CB 5HODA 3PNTA 4ZTJA 1YS7A 2HWVA 1MNDA 1S7AA 1F1ZA 2BY3A 4PZJA 1ZG5A 3QPSA 2O7OA 4B47A 3ISPA 2VT2A 1V54H 4G9YA 3U1KA 2M7AA 2FNAA 4KNYA 3SFIA 4C3JJ 1X3UA 2HPIA 4LD5A 1U3EM 4XN0A 1FLIA 3BR3A 1XG1A 4LLGF 5M5YJ 4IJAA 2W00A 1Z05A 4QTRA 4CYCB 2ESNA 1OR7C 3G1MA 2P6SA 1ZGWA 2A6HF 3GZ6A 4M9SA 4CCNA 2FX0A 1SEUA 2EA4A 2YX7A 4UB6C 2DA4A 1FWZA 2XAUA 4BAYA 1T56A 1RKTA 2Q1ZB 2LDUA 5D5UB 3RYRA 2PMHA 5J40A 1A6IA 4KISA 2IAIA 1UZCA 1XB4A 3S3OA 3DEWA 2YUSA 1OCCH 4EJVA 1QRYA 2L0KA 1Z0XA 3JRBA 1VTNC 5IOYA 3OYBA 2KRHA 1FZPB 3HSRA 3LFUA 2NVQJ 1EA3A 4HDVA 1NHAA 4A3LJ 3QU6A 3EUHC 3I9V2 2G0EA 3JRAA 1LFUP 1VQMI 2HS5A 3FMSA 2KDZA 1RZ4A 2JTVA 3HKZA 1D8KA 5IP6A 3J7AY 2L7MP 3HHGA 5BMZA 1WJFA 3HRSA 2QCOA 4KA4A 2FMYA 3E5QA 3H92A 2D5VA 5HLTA 2HPMA 4I99C 4RM3A 2L9NA 5CYVA 5HDGA 3MAJA 4JX4A 4HAMA 3AAFA 4XRMA 5FROA 3N97A 1ULYA 2DQRA 2LF8A 4RGXA 5HNFA 1YW7A 4FX0A 2R93J 2NS7A 4UNOA 3C2BA 5H2FC 3LSPA 3BR2A 3ESWB 2LG4A 2WTEA 3CP8A 1TLHB 1KYZA 4XRSG 2GBYA 4AC0A 5IOZA 3L2VA 2X6OA 3A1YA 3VB2A 4U7DA 1ACIA 4KFCA 2DO7A 2JA8J 5LGTA 3AFHA 2NOGA 5FRMA 5K5QA 1STZA 5CVRA 1SD6A 5FKLA 4E4HA 3E7LA 1LJ9A 5DDGA 2BGCA 3HOYJ 1XGNA 3KE2A 4BACA 1RESA 3Q5FA 1XGOA 3VOEA 1XGSA 1IAWA 1B6AA 3HYIA 4W97A 1FOYA 3ECHA 1MBHA 3BR6A 3EUHA 2QM3A 2MH9A 2DA1A 5GP9A 1IDZA 2DFIA 1YJ9I 5JLXA 3AG2H 2ZXWH 4Q48A 4A93J 1E0EA 3FZVA 3P5JA 1K78A 4AM3A 2ISZA 5DEQA 1DP3A 3RQIA 4ON0A 3ZP5A 5FFZA 2DFFA 4I01A 2CUJA 2KPMA 2LBFB 4CH7A 1X19A 1ZLJA 2BW3B 2X6WA 4IPAA 2R7RA 2GXBA 5J1RA 3WTYC 5FGMA 2CO5A 3QOEA 5H20A 4RM2A 2YS9A 1BIAA 5DUKA 2OC6A 3SQNA 1X2MA 3DTKA 3M9AA 4GXOA 4X1EA 2COBA 4HNVA 2FBKA 2QA4I 3MVPA 2VJ4A 4YFXF 4H0EA 2W24A 2ZMEB 3VYTB 1DU6A 4XONA 4A5MA 2W1OA 2YR2A 1TL8A 3F3XA 5CVUA 3OYJA 3ML6A 2V9VA 5HVQC 1X1CA 4GFBA 5E1ZB 2BY2A 3QRFF 2V79A 4UB8C 2EV6A 1POGA 3BG9A 3NQOA 2QQ8A 4IX7A 3COAC 5C3EJ 1IF1A 2KIFA 3OOPA 4XIDA 2X0LA 1YQAA 2LR8A 4RAGA 2XSDC 3CCQI 1CF7A 5FLXK 2A6EF 3PL8A 1JKRC 1NK3P 1ZLKA 4AD9A 1OYYA 2V1NA 3WG7H 1SFEA 1F43A 3W3CA 3GFJA 2FEZA 4KIFA 2O8KA 1TQIA 4FX4A 2JQ7A 2O8XA 4HV5A 4XLHA 3U9GA 2O5RA 4ENKA 3MCZA 1T2KA 4BH9A 1W0TA 1B9NA 1R7JA 1JI8A 2I8DA 1VZ0A 5F64A 3LSRA 2V9KA 4NHJA 4M9XA 1H9GA 4LGWA 3IKVA 5D6EA 4XKBA 1KZHA 4FE4A 3CJQB 2J5PA 2XGXA 3CDLA 4R8HA 2ZCWA 3MN2A 1SFUA 2IRFG 4CZCA 3R60A 2D1VA 1JGSA 3F23A 4KN4X 2ZJPF 3ASNH 3EDPA 1JXSA 4XLCA 4JX5A 2KL4A 1FMVA 5DD4A 1WJCA 5DM7F 2CQ7A 3WG9A 4AUXA 3CCUI 3CP2A 1IO2A 4C2TA 4BY7J 3OSFA 4L0ZB 1AKHB 5K7HA 1ZELA 2L7FP 3FXOA 2E1MC 2FU4A 1R23A 4ENJA 3EETA 5H6RA 4KMUX 2R7SA 5CQEA 2YPRA 1XPXA 2FA5A 5FD5A 4OU0A 1LVKA 2ICWG 2CUEA 2OJED 3ERMA 3K4NA 3CMEI 4ZDLA 4ZDPA 4EJUA 2QQ9A 3ASOH 5J1YA 2OUMA 4NBQA 4YFKF 1S6LA 3LSKA 3NWTA 4UXNA 1SFOJ 2MC4A 3PM1A 4BHBA 2QLZA 1W1WE 3RIRA 2BEOA 2V6CA 2ID3A 2LKSA 3RSNA 4LOCA 1D5YA 3QPTA 3SJMA 1AOYA 4CICA 1FP1D 1V4RA 1JHHA 2Y48A 4CZZA 4E7SA 4O5VA 2DPUA 4M73A 2HVQA 2TRTA 2QWWA 1EH6A 3BTCA 1A31A 2M87A 3OYFA 2PLYA 3RDIA 2E35A 3BZCA 1PVEA 2PX9A 4G94A 3HBLA 3GFIA 5AIPA 1A36A 2BBYA 4IRHA 4Q47A 5J8CA 2XASA 3TL4X 3S1QJ 4A3BJ 2MH2A 3ABLH 1G59A 4D5FA 1K83J 3JW4A 2DPDA 1KU3A 3BDDA 1LDJA 3K2AA 3DCFA 2H94A 3WTZA 2OAZA 3RJPA 4PJJA 2A69F 2DODA 1WQ2A 3KX2A 4BXFA 4P9UA 3KYLA 3D1NI 3FXLA 3SZTA 2WA0A 3OR1C 4JBAA 3WTXC 2L2OA 1NH3A 3LNQA 3H9GA 1Z6TA 4WXDA 2VKDA 5A2QK 2MG4A 1ZR4A 1E2XA 4HW0A 3FXUA 1N25A 5FD6A 1O3QA 4BUPA 3V7SA 3K70C 1AHDP 1V55H 3OYDA 4BQNA 3O8HA 4ZH4F 3HGYA 1HXDA 3P9CA 3IC7A 4LLLA 2KZGA 4DQ2A 1ZG3A 1IJWC 3G73A 3FDYA 1DU0A 3MZHA 1OLTA 3E6BA 3PFIA 3I58A 4L9TA 1LE8B 3KP6A 2QYOA 3PSIA 1QPIA 3GCMA 3CCLI 4N4NB 1B8IB 3HRTA 2F5EA
chains in the Genus database with same CATH topology
2I5UA 2ZC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5U A;  2ZC2 A; 
#chains in the Genus database with same CATH topology
 2KT0 A;  4NUB A;  2BY1 A;  1YJN I;  2E1M B;  1XD7 A;  5FJ8 J;  1KA8 A;  3SYT A;  1JKQ C;  4XOP A;  4UUV A;  4XR6 A;  1FT9 A;  3WE2 A;  4HZF A;  3DLL F;  1H89 C;  2K7L A;  5DCF A;  2Y0M A;  3P9K A;  1ZGA A;  1A6Q A;  2CW8 A;  1OIS A;  2GAU A;  3ELK A;  3IKT A;  1IC8 A;  3Q0W A;  1VQ8 I;  2DMQ A;  5DTD A;  1OJL A;  1MSF C;  1ZH5 A;  2OQG A;  3I4P A;  3RPU A;  2OCE A;  3OWT A;  3GLX A;  1WPK A;  2RC4 A;  1I5Z A;  4IHV A;  2JRT A;  3ZOB A;  3MKY B;  1DPR A;  1WHU A;  4Z2Y A;  3VPR A;  4I76 A;  4C9Y A;  4RMN A;  2XUB A;  3FKJ A;  4D7N A;  1U8B A;  1IG7 A;  3SDB A;  2QSG X;  1A5J A;  3FMQ A;  3I53 A;  3M3Y J;  4ZDO A;  2R5Y B;  2VBW A;  2BXZ A;  2MW8 A;  1FBQ A;  1R4M B;  1SD4 A;  3M8E A;  1X1D A;  4LK1 F;  4WXC A;  2HOS A;  4L18 B;  5IT9 Z;  3PJR A;  1BR4 A;  3L2R A;  4NC6 A;  2LY2 A;  3B02 A;  4NNJ A;  3OYH A;  3JRH A;  1BI3 A;  2FJ1 A;  4B1R A;  4YIF A;  1GVJ A;  2NS8 A;  1JKP C;  1A35 A;  2FBH A;  5GAH J;  1RUO A;  1PJR A;  2FSW A;  3KZZ A;  1D3Y A;  2P4W A;  1LFP A;  2NVU B;  3DKX A;  3ZMZ A;  4IKF A;  2VON A;  3IHU A;  2QBY B;  2GOX B;  1MDM B;  4M6V A;  4F93 B;  2ZJR F;  1I3A A;  4NDL A;  1XDS A;  4G7H F;  2CS3 A;  2M0M A;  2ME0 A;  2D1H A;  2VXZ A;  3M4O J;  4FET A;  2GIV A;  4EV0 A;  4KJZ A;  1BA5 A;  4OIQ F;  2KKO A;  3CQZ J;  1I6X A;  4OMZ A;  1DQU A;  2GLO A;  5LEJ A;  3LA3 A;  1RKW A;  2ZBK A;  1IRX A;  4OWR B;  1Y8R B;  3PQJ A;  3OYL A;  2OD5 A;  1Z7L A;  4IHX A;  2XAQ A;  2JT1 A;  1FC3 A;  4BJ5 C;  4UVB A;  2W25 A;  2VUM J;  4J19 A;  2UXN A;  1YIJ I;  1K7A A;  2LRD A;  4B44 A;  5F1R A;  2H6B A;  1TW3 A;  2ADU A;  4CUG A;  3CC4 I;  2EA2 A;  4DYQ A;  3W2A A;  3FXM A;  1LVA A;  3E3V A;  4ESJ A;  1K78 B;  3N4M A;  3S93 A;  4EMS A;  1IN4 A;  3CJN A;  1Y0U A;  2H09 A;  3R0A A;  4C3H J;  2LH9 A;  1ZKG A;  3E1S A;  4RB0 A;  3HC7 A;  2GXG A;  3BJ6 A;  3LAJ A;  3J80 K;  5ICC A;  4LIU A;  3HOU J;  3KP3 A;  3BJO A;  4ITV A;  3GBG A;  3F8M A;  2E2J J;  2XPW A;  3OR2 C;  2HEO A;  1E3P A;  3MKL A;  4A12 A;  3EYY A;  1MJ9 A;  1U9O A;  1HW1 A;  2BVM A;  1HST A;  2VN2 A;  3IRQ A;  5KVR A;  4ASN A;  4AU7 A;  1U5T C;  2NYX A;  1FYM A;  4B3X A;  3RKX A;  1BI1 A;  3W2V A;  1PP8 F;  2H1L A;  3IWZ A;  2JA5 J;  4PFO A;  5TGT A;  2NVT J;  2IVM A;  4I98 B;  2IJL A;  1GV5 A;  2JVG A;  5GAE J;  2KIQ A;  2EK5 A;  3BT9 A;  3IAS 2;  2Y2Z A;  3ABT A;  5FLX Z;  2K02 A;  4FHT A;  5DYM A;  2AHQ A;  1B59 A;  2DA5 A;  2L54 A;  4S04 A;  3HL2 A;  2ZME A;  4NQW B;  1LPQ A;  2W84 A;  2B9S A;  2IBD A;  4HYE A;  5D5V B;  1TQP A;  1W5C C;  1BI0 A;  5HDK A;  4D1Q A;  1K4S A;  1OR7 A;  3B6C A;  2BVL A;  4XSZ F;  4RAY A;  2ZKZ A;  2V1D A;  2EIN H;  5EG0 A;  1L0O C;  1SAX A;  1XCB A;  3CCY A;  3Q9S A;  1Y1V J;  3NWS A;  1BI2 A;  1WRJ A;  5B3S H;  3CCM I;  3FBI B;  4G6Q A;  2M5W A;  3D5R C;  4LK0 F;  3E5X A;  1LE8 A;  2KQR A;  4HNT A;  3BR1 A;  1B1B A;  4BEH A;  3ERE D;  3F8C A;  1MBG A;  4B43 A;  3EYI A;  1BC8 C;  2GQQ A;  4KT6 A;  3KEQ A;  2VAS A;  1T0F A;  1XTA A;  1D8J A;  1IUY A;  4MO7 A;  3V7R A;  2PFB A;  2ZO4 A;  1RPW A;  2BW3 A;  3E5U A;  3A01 B;  3WHC A;  1UMQ A;  2VBX A;  2C6Y A;  1R71 A;  2N8G A;  3GLL A;  2H27 A;  3QPH A;  3O2P E;  2HOT A;  4HA8 A;  3TQN A;  4E7L A;  4YFN F;  1SMT A;  3QP5 A;  2HDW A;  4U87 A;  4N9I A;  2H8R A;  1A04 A;  3V8J A;  4AIK A;  1F36 A;  5EJC A;  3L2W A;  4HQM A;  5D8L B;  4U0W A;  2LK2 A;  3G6E I;  2DMT A;  5FFX A;  2VE9 A;  2O3F A;  1R1T A;  2CUZ A;  5J4V A;  3RTR A;  2XVC A;  1XDU A;  4HLX A;  2ELJ A;  3WTW C;  1ETW A;  4AYB A;  3LSI A;  3L09 A;  3RKW A;  2E19 A;  1U9N A;  5BPI A;  2L4A A;  2WBM A;  4BS9 A;  2W82 A;  1T33 A;  1WCM J;  2XIG A;  2YU3 A;  5M5X J;  3K1N A;  2K3P A;  4IQJ A;  4ZYH A;  3K4B A;  2DTZ A;  1U0J A;  5ERI A;  2J5O A;  4IHW A;  2Q2E A;  2A3S A;  3LSM A;  4MNU A;  4BXX J;  4OIR F;  3ZXS A;  3WTS C;  1W4M A;  5C44 J;  3ZMT A;  4Y13 A;  1N77 A;  3DFG A;  2E5Z A;  1UG0 A;  4M3G A;  1GXP A;  2CG4 A;  3HOS A;  4P9F A;  4U0V A;  3BCB A;  3F8B A;  4KIB A;  4YEL A;  2HVS A;  1T6S A;  2E34 A;  3CC2 I;  3W2W A;  1QA6 A;  1FP2 A;  4XRS A;  5E3M A;  2QGU A;  5D4S A;  5CJ9 A;  1DP7 P;  3A2K A;  1H8A C;  3B6A A;  2FF4 A;  3RCO A;  2DFH A;  4NQW A;  5HLG A;  4PGG A;  3F0C A;  1WZ2 A;  1LQ1 A;  1FTZ A;  4P55 A;  1TWC J;  4Y7N J;  2DAO A;  2DMP A;  4A0X A;  5HS9 A;  4FCY A;  1Z3X A;  5L3G A;  3E0J B;  1Y8Q B;  1ZYR F;  4HX8 A;  1BR1 A;  4OIN F;  1G6N A;  2ZFW A;  2R7O A;  2JPC A;  4AVZ A;  1TNS A;  2WAE A;  3DPL C;  4V2G A;  5IP7 J;  2XRO A;  1PDN C;  2OQR A;  4BE1 A;  4DNC A;  3BCA A;  2NAZ A;  1HKQ A;  4F92 B;  1MBK A;  3CCS I;  4S0H B;  5EEG A;  5DCM A;  3REO A;  3J7Z I;  1R00 A;  4CYC A;  1OYW A;  2YX4 A;  2CQQ A;  3HGG A;  1BOA A;  1MNE A;  4A3J J;  2JA7 J;  3DBH B;  1HKS A;  1W7P A;  3CD6 I;  2HQA A;  2JUC A;  1ZR2 A;  4MHG A;  2KHM A;  4DZP A;  3W6V A;  2RRE A;  1N75 A;  5ILV A;  3PQK A;  4GGG A;  2ZJ2 A;  1Y6I A;  3A4C A;  5E20 A;  1QQI A;  3BTL A;  3FHN A;  3OYM A;  3IP4 B;  4M71 A;  3W6K B;  3DXJ F;  4BHC A;  4JK1 X;  1FJL A;  2QF7 A;  3GZ5 A;  3K1P A;  3CLQ A;  2PEX A;  2DYS H;  5HS7 A;  1OFC X;  2BY0 A;  4XM3 A;  3CDI A;  2ZME C;  2YSR A;  2AS5 F;  1KU9 A;  5FKO A;  3HOT A;  1IUF A;  3OIQ A;  1QHG A;  4IEJ A;  1KQ9 A;  2V26 A;  2VIX A;  4C30 A;  3T8R A;  1K61 A;  2L02 A;  5B5E C;  5L3B A;  2PMZ N;  2VPL A;  2EFQ A;  3DPT A;  3H5R A;  4HEA 2;  1W5S A;  2MFZ A;  1OQY A;  3O3K A;  2OZ6 A;  5GTH C;  2HYG D;  4F7Z A;  1EV7 A;  4P96 A;  5LFA A;  3RZD J;  3CJR B;  4A3F J;  3LMM A;  5KAI C;  1O7F A;  1FY7 A;  4ETS A;  5FLM J;  4LB5 A;  3DTI A;  3ZRG A;  1P4W A;  2P6T A;  1U5T A;  2JSP A;  2JA2 A;  4M9Z A;  3H3V K;  1OCZ H;  3LOC A;  3V4G A;  4B3A A;  3HTU A;  4OIP F;  4LLN A;  4V2F A;  2VJ5 A;  3ABU A;  2Y0S N;  5E8G A;  1J75 A;  2Y31 A;  3SDG A;  3ONQ A;  2H8W A;  2I5U A;  2QUF A;  5B1A H;  1YFH A;  2DT7 B;  5JVT A;  4ENM A;  1T95 A;  5LRS A;  4ZYG A;  5D8K B;  1MD0 A;  3G71 I;  3E6C C;  2WAD A;  1R6R A;  2X6Y A;  4ZTF A;  4LG0 A;  3ZQC A;  5LHG A;  3J81 K;  1YHQ I;  4I02 A;  3RPU D;  5J8F A;  4C2U A;  1S8N A;  4ZYD A;  5GTI C;  2FUG 2;  1LFB A;  1I1G A;  2L01 A;  2KJB A;  3WTU C;  3IL2 A;  2LRE A;  5HLH A;  3F21 A;  1I6H J;  1P7I A;  3LA2 A;  4E7Z A;  4WWC A;  4H4K C;  1QGP A;  1ZN2 A;  3TP0 A;  4JQF A;  4GCV A;  2KMU A;  3OS2 A;  4BNC A;  2F4O B;  2PG4 A;  2MLK A;  2XAJ A;  3BRO A;  2M4G A;  1IV8 A;  2JWT A;  4OOI A;  1FIP A;  2Z2S B;  1FOW A;  1FIA A;  2FQ3 A;  1R5G A;  1WKM A;  3BTJ A;  3J7A O;  2ACJ A;  4AYB N;  1TBX A;  1QNT A;  3CUQ C;  5CKT A;  1B8I A;  2XB5 A;  3GUD A;  4L9N A;  4RGS A;  4A3C J;  2H1K A;  2BOL A;  4HOB A;  4EQQ A;  4NB5 A;  3OSG A;  1IN8 A;  3E97 A;  5F0C A;  4B09 A;  2BZT A;  1ZHF A;  2KIM A;  3GFL A;  2RAE A;  4QIW N;  4NC7 A;  5GAG J;  2PJR B;  3UKG A;  2R92 J;  2HFH A;  3O8G A;  2UWM A;  2DW4 A;  1TNT A;  3JSP A;  1APL C;  2MA3 A;  2A68 F;  3F22 A;  1YJW I;  1VQN I;  3MZ8 A;  1ENH A;  3BG7 A;  3S1R J;  5E17 F;  2X1D A;  3HOX J;  2ZXJ A;  2CJJ A;  1T8I A;  1VQ4 I;  2VOD A;  3CCR I;  2VOP A;  2DDA A;  1IXC A;  4PJL A;  2VBY A;  1MBJ A;  3JRG A;  2L3D A;  3GTO J;  1AWC A;  2OPT A;  3I55 I;  2Q8K A;  3K1M A;  3TW7 A;  5EF6 A;  3ULQ B;  2DU9 A;  1EH7 A;  5KCM A;  3IH3 A;  4DYC A;  4UV8 A;  3K4J A;  3BJA A;  3LFK A;  1U6G A;  3GEZ A;  2F5F A;  1V5G A;  3GTJ J;  2DOE A;  1X2N A;  4BGD A;  3ZQG A;  2PI0 A;  2L9V A;  2MSY A;  1P4X A;  2LKX A;  3QOD A;  4IOC F;  2QKM B;  2LC2 A;  2MGQ A;  2VC0 A;  3PFY A;  2W7N A;  4X6A J;  2QSH X;  3CMA I;  4WF2 A;  5H6Q A;  2MYS A;  1FPQ A;  1IXS B;  1NG7 A;  2DA6 A;  2MD0 A;  3KP4 A;  1B9M A;  1FMW A;  4CDG A;  1UAA A;  3BG5 A;  1DPU A;  1E17 A;  3IWF A;  2OF7 A;  2XF5 A;  1R36 A;  5LRR A;  4GDF A;  1XX5 A;  3I64 A;  2HQN A;  3JRD A;  2DMN A;  1KU2 A;  5LGU A;  2CV1 A;  3N05 A;  3KCC A;  2DLL A;  1YW8 A;  3W6J B;  4PK4 A;  1R5H A;  1LEA A;  2KRC A;  3K10 A;  2RQP A;  3K70 D;  2VKH A;  2WB1 N;  3HUG B;  2IGN A;  2FD5 A;  3RYP A;  5LHH A;  1FX7 A;  5F6F A;  4RAZ A;  4DGW B;  2DI3 A;  3IV5 A;  3I4M J;  2IS2 A;  2VXD A;  5M3M J;  5GAD J;  3K6G A;  3BTI A;  3FIW A;  1ETO A;  2L7Z A;  1UCR A;  4WK8 F;  3F8N A;  5DM6 F;  3BZ6 A;  3K4C A;  2RV8 A;  3EPZ A;  2E1C A;  3C7J A;  4FE7 A;  5FB2 A;  1I3Q J;  4ZYA A;  2DT5 A;  4ESF A;  2M4K A;  1J09 A;  1D1B A;  2VL8 A;  2ZXI A;  3CCE I;  4MLO A;  1ETQ A;  4DJA A;  3HIF A;  4EJT A;  1I1S A;  3WGG A;  1F4K A;  1VF9 A;  2ZJQ F;  3EQL F;  1Z3Y A;  4UHT A;  2VJI A;  5DD8 A;  3NEU A;  4E70 A;  3DP7 A;  4Y15 A;  2HXO A;  3CZ6 A;  1IRZ A;  3A0H C;  5FKN A;  3ZMD A;  2JA6 J;  2QKL B;  2Y9Y A;  5K7F A;  2QEX I;  2GZW A;  2HOE A;  3WGI A;  3CUQ B;  2X48 A;  2QBY A;  4HLY A;  3TGN A;  4C2M J;  4BXU A;  2WWY A;  4G7O F;  3ABM H;  3GF2 A;  1RNL A;  2CV2 A;  3CMY A;  1UFM A;  2ZNZ A;  1Y56 A;  6PAX A;  1FNN A;  5KAF C;  1JHF A;  1XMK A;  4XBF A;  1JJ6 C;  1JT0 A;  1SD7 A;  4XMY A;  3U1D A;  4XKW A;  1TWH J;  2R5Z A;  3AKZ A;  1IV6 A;  2DK8 A;  1GT0 C;  2UXX A;  4LIT A;  4D5C A;  2Z9O A;  2HOA A;  3JSO A;  4M3B A;  2Z1D A;  2Z3Y A;  5EZG A;  1MNM C;  3JTH A;  1FYL A;  1TW2 A;  3V8L A;  2V9P A;  2R7T A;  2CFO A;  2G7H A;  3QWL A;  4A3K J;  3L7W A;  5GPA A;  1HBX G;  2CW7 A;  1XS9 A;  1UHM A;  3DBL B;  3TO9 A;  4XL9 A;  4ZYE A;  1VI0 A;  4XNF A;  3HOW J;  2JMW A;  1D1C A;  1YE9 A;  2OA4 A;  1R5I D;  4MGR A;  5K7Z A;  3VWB A;  3BOQ A;  3K4K A;  3LAP A;  2OU2 A;  2EIL H;  3K2Z A;  2W57 A;  2ESH A;  2P0W A;  4TV7 A;  2IEK A;  2LFB A;  4CHU A;  4PDK A;  2ZC2 A;  2CSO A;  2Y69 H;  4ESB A;  3JTG A;  1JE8 A;  3DKW A;  1WVR A;  2FOW A;  1W7P D;  5E3N A;  1QHH D;  4RLF A;  1ITY A;  1BOB A;  2CU7 A;  3CCJ I;  5E3O A;  1QPM A;  2XGD A;  2VKV A;  2PQ8 A;  4Y17 A;  5IT3 A;  2QQB A;  3NAR A;  5LBQ A;  1HLV A;  3F6O A;  2E2H J;  3KZY A;  2LF7 A;  4AIH A;  1FOK A;  1Y1W J;  1T98 A;  4KUM A;  1ON2 A;  1ERD A;  1FSE A;  9ANT A;  3HKZ N;  4A2U A;  3HPG A;  3WTT C;  1BJZ A;  1I39 A;  2VKE A;  3L2C A;  1O3R A;  2VJJ A;  1CGP A;  2DJI A;  3CUQ A;  3GYH X;  3L2U A;  3WTV C;  4E7J A;  1FOX A;  4A6E A;  4PSW A;  5J4Y A;  3HHH A;  2L7K A;  4RBO A;  3KIO A;  4U88 A;  3I59 A;  1CQT A;  4XLN F;  2A07 F;  2P5K A;  5EDN A;  2XF7 A;  5HNH A;  4EM1 A;  4G8X A;  3NRV A;  2VB6 A;  1WWX A;  2OTL I;  1Z9C A;  1PUF A;  2VPR A;  2FOK A;  3S16 J;  3A0B C;  1Z6R A;  4AWX B;  1PUE E;  1VQK I;  3S1N J;  3CF2 A;  4KIC A;  5F04 A;  1GV2 A;  3FXK A;  2HYF A;  1YIO A;  3S2H J;  1H0M A;  1RI7 A;  2OV7 A;  2QQA A;  2X1C A;  1RUN A;  4MQ9 F;  5JFR A;  1WJ5 A;  3S1M J;  4UUS B;  3VYU B;  2RNG A;  1R1U A;  5LGN A;  1X58 A;  2NOJ B;  1HF0 A;  2R4G A;  2A61 A;  2K4B A;  1K79 A;  4HX7 A;  2FNP A;  4HST A;  4YRV A;  3RKQ A;  3LSJ A;  2DTR A;  2LSO A;  4L5E A;  1WI9 A;  5DUI A;  3BZK A;  2NRA C;  3FXR A;  3IRR A;  2E36 A;  3LSG A;  5TJJ A;  2HR3 A;  4BYY A;  1FBS A;  2AXT C;  3IH4 A;  4A0Y A;  3KLO A;  1TT0 A;  3TED A;  4HNU A;  3C3W A;  1TQM A;  1TZL A;  2GOM A;  1P2F A;  2K9N A;  3LL7 A;  2B63 J;  4Y3O A;  4ZZD A;  4U7B A;  2HU9 A;  1HCR A;  3A02 A;  5F27 A;  3G1O A;  5D5W B;  2KRF A;  2LD5 A;  3I0T A;  3ZQF A;  2X85 A;  1USS A;  1J5Y A;  2V4J C;  4HQE A;  1QVT A;  1S9H A;  3H5N A;  4M3E A;  5JI6 A;  1X4P A;  1JTX A;  3V8K A;  2X51 A;  4XQF A;  1SVL A;  1YYV A;  1D1A A;  1ORK A;  1Z1D A;  3DKY A;  5CQG A;  1VQ5 I;  1MW7 A;  3ZQI A;  5CVI A;  2IS4 A;  2BHZ A;  2K5C A;  1X3Z B;  3A03 A;  2LVS A;  1CF7 B;  3BPX A;  1UST A;  3S32 A;  1W36 C;  2AXL A;  2F48 A;  4XSX F;  1G2H A;  1JT6 A;  4I0A A;  1WH5 A;  5BNG A;  1J59 A;  2ZXH A;  4E7I A;  2V1X A;  3OIP A;  3L9F A;  4EGZ A;  4XLA A;  1OCP A;  3PSF A;  4B8X A;  1YLF A;  2ZFU A;  3KYC B;  5K1Y A;  2O0Y A;  1F9N A;  2DXI A;  1ON1 A;  4EM0 B;  2EZL A;  1XGM A;  2X1E A;  5IPA A;  3M7G A;  1T38 A;  3H0D A;  1ZQ3 P;  5E1X A;  1JJ8 C;  5K5R A;  1LB2 A;  1KYW A;  3QU3 A;  2MAB A;  5A2Q Z;  1REP C;  1VQP I;  2XAF A;  4YII A;  2F4M B;  1ZAR A;  4M3D A;  3DQV C;  2ETH A;  2O6G E;  3S2D J;  4MTE A;  2JUG A;  5JVG F;  1E3O C;  3TMO A;  4ENN A;  1NK2 P;  1D0Y A;  4LG0 B;  4XOR A;  2KJC A;  3TDU C;  5E3L A;  2EZH A;  2L9R A;  3NAU A;  3RPQ A;  1YG2 A;  4DIQ A;  3VOD A;  5LEK A;  3BLY A;  1KON A;  3K9T A;  4BDZ A;  3VYS B;  2KP6 A;  2XF6 A;  1VND A;  5CVJ A;  1XSV A;  5EEA A;  1E3H A;  2HYJ A;  5FKM A;  2KZV A;  4XLP F;  3FX3 A;  3E6M A;  5EYR A;  4PUS A;  2QVO A;  4DYR A;  4UVA A;  2PJP A;  3ZQH A;  2X9D A;  4M6Y A;  2IS1 A;  4QPQ A;  1R22 A;  1WJB A;  2R7Q A;  1EH8 A;  1W36 D;  2Y9Z A;  4RA2 A;  1TP4 A;  1BN5 A;  4NC8 A;  1UEL B;  3CUO A;  4PJN A;  1B72 A;  1WFX A;  3SXY A;  3HXL A;  3BY6 A;  2LY1 A;  2PMZ A;  1MSE C;  2W4S A;  4CA0 A;  1EJ9 A;  3WHB A;  2G7U A;  2OBP A;  4YIR X;  1M1E B;  3LA7 A;  2HKX A;  4Z6Y A;  1C0W A;  1JUS A;  1TWA J;  2DOA A;  3QAH A;  3FXJ A;  3GO5 A;  3H1C A;  5B1B H;  3GWZ A;  1OMI A;  1FBU A;  4G6D A;  1AU7 A;  1AA7 A;  2BYV E;  3F9K A;  4YEJ A;  2KIS A;  3OV8 A;  2DJN A;  2XPV A;  2A5W A;  4HG2 A;  2Z16 A;  1IW7 F;  3H3Z A;  5LLQ A;  1QO0 D;  4IVN A;  1Y39 A;  2V6E A;  3ZQL A;  2CH0 A;  5C4X J;  4XLE A;  4BJ6 C;  3FM5 A;  2WV0 A;  1TC3 C;  2AQF A;  5EGO B;  4IXA A;  2EB7 A;  1HOM A;  1X1B A;  3TO6 A;  3GX4 X;  4I09 A;  2R0Q C;  2CQK A;  1ZAO A;  5E18 F;  2M2E A;  2VQL A;  1WJD A;  2R5Z B;  3BWG A;  2VQH A;  4I0B A;  1RC9 A;  2NNN A;  2V7F A;  2XC7 A;  4IRI A;  1RET A;  2R7D A;  5DCM B;  3S2W A;  2LOO A;  1ZGJ A;  3KYD B;  1SD5 A;  4M6X A;  3ZN1 A;  1XSD A;  3HDD A;  4EGY A;  2F5C A;  4BEH B;  1KU7 A;  4FT8 A;  2D45 A;  1OCO H;  3MQ0 A;  1I27 A;  3OOU A;  1U5T B;  3G1L A;  3R0J A;  3U21 A;  1HW2 A;  1V5E A;  1XCV A;  3HG9 A;  5E8I A;  3G3Z A;  2KDO A;  3BR5 A;  1SVM A;  2O03 A;  1YI2 I;  5J6X A;  3SFZ A;  4G12 A;  3RZO J;  3OIO A;  2M34 A;  1W5T A;  2MBF A;  1O3S A;  3S17 J;  4FTH A;  2ME6 A;  1PYV A;  3V42 A;  1D0X A;  3GTK J;  1Q1H A;  3S14 J;  3DU5 A;  4GYG A;  1W0U A;  4IF4 A;  4O6J A;  5L3D A;  4LB6 B;  2DQL A;  3CCV I;  3QOP A;  1MIJ A;  3T8T A;  4HBL A;  4RS8 A;  4XK4 A;  2FML A;  2JJ7 A;  1GDT A;  3KEY A;  1TTY A;  1K6O A;  3ZQ7 A;  4WCG A;  3PNY A;  4XOT A;  3CF5 F;  5GPC A;  2GXA A;  4A3M J;  2XAG A;  1P4A A;  2E71 A;  2K9Q A;  2XSJ C;  3BQZ A;  2ELK A;  3ZCO A;  1WGX A;  1YX5 A;  3F8F A;  2P5V A;  1P6R A;  4II2 A;  3VEP A;  3JRE A;  5IP9 J;  2DA7 A;  4D9J A;  2Z99 A;  2MC3 A;  3VSL A;  2KLO A;  2ID6 A;  4KIG A;  3X2Q H;  3CC7 I;  2TCT A;  4BE2 A;  3E6D A;  1U8R A;  3IUO A;  1SC7 A;  3MFK A;  3J80 Z;  2EBI A;  4I6Z A;  4MTD A;  3T0Y A;  5IYB J;  5FKK A;  2K4J A;  5F1J A;  2LP0 A;  3VFZ A;  4PFP A;  2FBI A;  2XRL A;  1YRN A;  1WJA A;  5KK1 A;  3BG3 A;  3S15 J;  1JUM A;  3DEE A;  4S05 A;  3UR3 C;  3ROU A;  3S3N A;  2F6C A;  1KGS A;  3H9Q A;  2DBB A;  2EPF A;  3WU2 C;  3H3U A;  3ZMV A;  4F91 B;  4OMY A;  2O61 A;  2LY9 A;  1IRG A;  4HSR A;  2M7B A;  4RAF A;  3DBR B;  2WY7 Q;  3M1C A;  3LST A;  5CVV A;  4MEX F;  2ZSH B;  4BJT A;  4IHY A;  3CES A;  2JZY A;  3H0G J;  5IYD J;  1BJA A;  3KP5 A;  5J1U A;  3QYF A;  2DYR H;  3KZI C;  1AKH A;  2EFO A;  4LMY A;  2K9S A;  3I4N J;  2BV6 A;  4UV9 A;  3JAM Z;  1P7J A;  1EF4 A;  5HOO A;  1LUJ B;  1SAU A;  2E7X A;  2XRN A;  4J01 A;  1BM9 A;  2BXY A;  4EM2 A;  2VQG A;  2F4I A;  2WC2 A;  1GVD A;  4R1H A;  3CO7 C;  4A3E J;  2F2E A;  2L9S A;  2AQE A;  5ICF A;  2M8E A;  2E1O A;  5JR3 A;  3WGH A;  2L4M A;  1IXR C;  1JGG A;  2LKP A;  2CRG A;  2B7E A;  3HOV J;  4JOM A;  3TW6 A;  2UZK A;  4L0Y B;  2ECB A;  2RNJ A;  3JCU C;  2KFD A;  2VE8 A;  1VQ6 I;  5JLW A;  4PJ0 C;  4L5I A;  3PO3 J;  1TT5 B;  3TDZ C;  5FRN A;  4IQ4 A;  3KET A;  2Q0O A;  3R6S A;  4LIV A;  4DW6 A;  2WAF A;  3B73 A;  3A01 A;  1HKT A;  2RKH A;  1SAN A;  3H36 A;  3M1E A;  4MFE A;  4N4O B;  3QPL A;  3T5X A;  1R58 A;  4BBR J;  1Y0N A;  3DLA A;  4IHS A;  3PIP F;  2MD5 A;  1SMY F;  1RIO H;  2HTS A;  3P7N A;  2CWE A;  3WU1 B;  1G3W A;  3BP8 A;  3M8F A;  2R5Y A;  1BW5 A;  5D5X B;  1S7E A;  1LKX A;  4BHP A;  1R49 A;  2R7X A;  2IA0 A;  1ETX A;  5E79 C;  2STT A;  3CTA A;  5IT9 K;  1P9Q C;  4P5O A;  1MH3 A;  2P7V B;  2XGC A;  1OPC A;  1IZ1 A;  3HEF A;  3MWM A;  2ISY A;  2EJR A;  2ZSI B;  1VQO I;  1D0Z A;  5EG0 B;  3JRF A;  4HV6 A;  4IZZ A;  1S72 I;  2DCE A;  1MKM A;  2A6T A;  2AO9 A;  3ABK H;  3HM5 A;  1LEB A;  1YS6 A;  1J9I A;  2XPU A;  1IN7 A;  4LG3 A;  4ANJ A;  3BQY A;  3C1D A;  2ECC A;  2BE5 F;  2IP2 A;  4XKV A;  4XIC A;  2R7U A;  2ELH A;  2EIK H;  1UJ8 A;  1YTY A;  1G3T A;  1MMS A;  1ONV A;  2NVY J;  3PIO F;  4BBS J;  2K86 A;  1MZB A;  2XB0 X;  4LJZ F;  5TIS C;  4IOA F;  3RKY A;  3Q0U A;  1NTC A;  1KQ8 A;  2F5D A;  1S29 A;  3OYG A;  3HB9 A;  3K4L A;  4YG2 F;  4A3I J;  2R7V A;  3D5S C;  3I5U A;  4BQQ A;  3GZN B;  1R4N B;  1V3F A;  4B48 A;  4IRG A;  4M72 A;  2K9M A;  3KP7 A;  4XN3 A;  1JKO C;  2IGM A;  2ZB9 A;  4CCO A;  2ZNY A;  3GW2 A;  3HUG A;  3MZY A;  3SZP A;  4K2E A;  3C2H A;  4RGR A;  2HVR A;  3WE3 A;  3GTM J;  3I3L A;  4HRI A;  1H9T A;  4UVC A;  1YO5 C;  4HF1 A;  4DBR A;  5K5O A;  1BBY A;  4GRI A;  3HZJ A;  2HKO A;  2NXN B;  1IN6 A;  1J2X A;  1G3Y A;  2RQQ A;  4GO1 A;  3HSF A;  5ILS A;  2K40 A;  1IDY A;  1BR2 A;  2DFE A;  2DA3 A;  3U2R A;  3CMM A;  4WXH A;  2XHK A;  1IGN A;  1HSJ A;  3BG6 A;  1BIB A;  1WJE A;  1T08 B;  3PUF A;  2LNB A;  3GTG J;  1O57 A;  1I50 J;  5DV5 A;  5DS9 A;  4KYW A;  2G9W A;  2HDC A;  4F55 A;  4X0G A;  1XN7 A;  3LWF A;  2EFW A;  1O4X A;  2GA2 A;  4LFU A;  5F08 A;  1B4A A;  3PNV A;  3TBI A;  2EFP A;  2VC1 A;  1YRN B;  4HF0 A;  3TOB A;  2XV4 S;  3HSE A;  4EVI A;  4F3Q A;  5J47 A;  1UG2 A;  3ZPL A;  2COM A;  3LQQ A;  1ZRD A;  1QZZ A;  3EUK L;  3I59 B;  1ETK A;  4MFD A;  3FWE A;  1YX3 A;  4CGZ A;  2EZK A;  2E7W A;  4MEY F;  3T1B A;  1DUX C;  3OMY A;  2W85 A;  4MQV A;  4JX6 A;  2E5N A;  2EWN A;  1ODD A;  3Q0V A;  1T39 A;  4ZZL A;  1LDK B;  3CO6 C;  1V5F A;  2XGE A;  3AG4 H;  2TDX A;  3QQA A;  1MMA A;  1O7L A;  4I2O A;  4RB2 C;  3C18 A;  5BOX A;  4A6D A;  3OYK A;  2IA1 A;  3R61 A;  3DTE A;  2PMU A;  3ZGK A;  1RR8 C;  1WI3 A;  1UHW A;  1YIT I;  3OYI A;  3OYN A;  3WU0 A;  1X3W B;  5ICE A;  1BL0 A;  2HZD A;  1J7K A;  2HGC A;  3OYE A;  4I7H A;  1FTT A;  2M9H A;  4MIM A;  3FK7 A;  2CYY A;  4IL6 C;  4A69 C;  2EQR A;  4PSX A;  3FMR A;  2P8T A;  4N0B A;  4BL0 B;  1JTY A;  2IXS A;  3M07 A;  2XAH A;  2R7Z J;  3FXQ A;  1J0R A;  4UUS A;  1U78 A;  2O9L A;  2LMD A;  3FKI J;  2GWR A;  1MDM A;  5TRD A;  2IGK A;  3DEU A;  5CLS A;  2M3A A;  4G6T B;  3TP3 A;  1IN5 A;  1ETY A;  4F52 A;  3EUA A;  4KN7 X;  3CLO A;  2YU9 J;  3FK6 A;  3J81 Z;  4UUT A;  2W48 A;  1RRJ A;  4HPQ A;  1Z21 A;  2XKO A;  4Y52 J;  2HQ5 A;  4EEF G;  2F5V A;  3BPV A;  2CW0 F;  4CO8 A;  4O3M A;  4WX9 A;  1MGT A;  5F0H A;  1TWG J;  3SEQ A;  5HLI A;  3HTS B;  4DOZ A;  2DN0 A;  3L00 A;  2CV0 A;  2HI3 A;  3AL0 C;  3Q9V A;  3V7C A;  5IY5 H;  2Z33 A;  2DOF A;  5FO5 A;  3UNG C;  3J7Y J;  1N78 A;  2EH3 A;  2GIZ A;  3P9I A;  3GTL J;  2LYC A;  1BC7 C;  1TWF J;  5ICG A;  3R4K A;  3F72 A;  2CQN A;  4BE0 A;  3ZMS A;  1Z77 A;  1ZTR A;  2DDB A;  2IPQ X;  2PN6 A;  3C2G A;  1KQ0 A;  4G7Z F;  1DGW Y;  3K69 A;  2IT0 A;  4Q4Z F;  2WY8 Q;  3HRM A;  4ABZ A;  4B4C A;  1SFK A;  4AIJ A;  5B66 C;  4U0Y A;  1ZRC A;  2HNH A;  5E1W A;  1HDD C;  2WAQ N;  1BW6 A;  1UHS A;  2M8G X;  2EV5 A;  4Y33 A;  4ZJZ A;  1L3L A;  3SHF A;  2JN6 A;  4KIT B;  4Q5S F;  1Q1V A;  2Q2E B;  2HXI A;  1IRF A;  1X1P A;  4CXF A;  4CCJ A;  1ZK8 A;  1S3J A;  4CCL A;  2MLG A;  1PP7 U;  1K4T A;  4BY1 J;  5BPD A;  4BQO A;  2FXA A;  1D5V A;  4UY8 I;  3VDX A;  1G3S A;  4XLF A;  2X6X A;  2JSC A;  3DPU A;  4GYI A;  4L5J A;  3OL3 A;  2GM4 A;  3DWL E;  1ZG1 A;  2CQX A;  2LLK A;  4W1U A;  5HS8 A;  4RB1 A;  1T0F C;  1WH7 A;  2CFX A;  3OS1 A;  1DDN A;  2FQ4 A;  3MD2 A;  2OZU A;  2WB1 A;  3KEO A;  4KDP A;  3JAM K;  1DGR M;  2M0C A;  2E60 A;  1ZRF A;  2JRM A;  3FHZ A;  2E1N A;  2EZI A;  5LD2 C;  1LNW A;  1GXQ A;  5C4J J;  1YW9 A;  5M3F J;  1VFC A;  2DK5 A;  2Y30 A;  2DT6 A;  3TKY A;  4V19 K;  3MKW B;  3PO2 J;  3OYA A;  3L2Q A;  1RR7 A;  5ED4 A;  2L5Q A;  2LTP A;  4QSH A;  3RQ4 A;  4QLC U;  2STW A;  2I10 A;  3D0S A;  4HX4 A;  5F0F A;  1S5L C;  1FSH A;  2K85 A;  4BDY A;  2JPB A;  4PGH A;  2CGP A;  4KMF A;  2KIU A;  3H5A A;  1MJB A;  4QPO A;  3LQR A;  2HQR A;  2VLA A;  2EIJ H;  3LSH A;  2IA2 A;  4FAS D;  1O3T A;  1HC8 A;  4E7K A;  3L1P A;  1R1V A;  2XDV A;  2M45 A;  5IYC J;  2IS6 A;  4HDU A;  2M30 A;  3SZG A;  2PBI A;  5AIQ A;  5L3C A;  1QBJ A;  4L9J A;  2QZ8 A;  3GXO A;  4N9H A;  1ZRE A;  2E2I J;  4FIS A;  3ZMU A;  2Z5U A;  4E6K G;  1H88 C;  1B72 B;  4XRF A;  1VQ7 I;  2K27 A;  3H9J A;  4IO9 F;  4HF2 A;  2NVX J;  4A3G J;  4OAY A;  4EAT A;  2RVC A;  4BU2 A;  3BR0 A;  3M8J A;  5HDN A;  3JR9 A;  1VQ9 I;  4QWQ A;  2R7F A;  2GA1 A;  2RN7 A;  1ETV A;  2UUZ A;  4C3I J;  1EKE A;  3RI4 A;  4JP0 A;  2BHY A;  4EJW A;  3IAM 2;  5M5W J;  2P5L C;  2X4H A;  1JUP A;  4Y4R A;  3WOD F;  1G4D A;  2JVH A;  2CMP A;  3MMY B;  2R3S A;  2VBZ A;  4BKX A;  1SFX A;  3GFM A;  5KNL A;  1HDP A;  1OCT C;  2CUF A;  2QEN A;  4KT5 C;  1GLN A;  5L3F A;  1MBE A;  1R9T J;  1LDD A;  2DA2 A;  2FRH A;  3JRC A;  2NNY A;  3HJE A;  2PJR A;  2EFN A;  2Y75 A;  5JHU A;  4FQG A;  3QP6 A;  3G4S I;  3K0L A;  4EJO A;  2JK3 A;  3TO7 A;  2RGV A;  3HPH A;  2HDD A;  3GTQ J;  1OYI A;  2V1U A;  3I71 A;  5LHI A;  2WAQ A;  4A3D J;  4CCK A;  1MH4 A;  4CYD A;  2OTJ I;  3QYE A;  1MMD A;  3JRI A;  2UV1 A;  4IHT A;  2XKP A;  2P81 A;  3OL4 A;  2VI6 A;  1XMX A;  1U2W A;  1HW5 A;  4OAZ A;  1K6Y A;  4ZC3 A;  4R79 A;  5D4R A;  3OY9 A;  3CDH A;  3SEZ A;  2EIM H;  3FBN B;  2HTJ A;  3QYB A;  1QZY A;  3GTP J;  4P1W A;  3S8P A;  4A5N A;  2D2W A;  3Q3S A;  5KHD A;  2A05 A;  3OYC A;  4RB3 C;  4JYK A;  4A0Z A;  3MEX A;  3K4M A;  2K3F A;  3DU6 A;  3GME A;  4AVP A;  2QSF X;  1XSX A;  2Y0S A;  1MMG A;  3AG1 H;  1UB9 A;  3KPH A;  4AID A;  1XMA A;  4CSW A;  2A5Y B;  3FIS A;  1MJA A;  1FYK A;  3MKZ A;  2RDP A;  4RLQ A;  4OIO F;  2FE3 A;  1S7O A;  5AON A;  4D7M A;  4E7H A;  2EV0 A;  3KLN A;  3ZR8 X;  2VOO A;  1NG6 A;  2WV1 A;  3DF8 A;  5FLV A;  5CPR B;  1Z91 A;  3VYR B;  3VSK A;  2VT3 A;  1HA8 A;  3K7A J;  2NS0 A;  4XKC A;  3CJT B;  4PCQ A;  2VQC A;  5BS6 A;  4D0P A;  2OCC H;  1FEX A;  3F6V A;  3TOA A;  3HRU A;  4BQA A;  1WSU A;  4M74 A;  1MMN A;  5D6F A;  5EZH A;  2R7W A;  3GVA A;  1OCR H;  1GUU A;  1Z67 A;  3AG3 H;  3O6B B;  1QVU A;  3I54 A;  4CCM A;  2H6C A;  1X1A A;  1XC5 A;  4J00 A;  1GHC A;  3AL0 B;  4RGU A;  1PUF B;  3PUB A;  4RDU A;  3FF5 A;  5J3L A;  4DZJ A;  5JHF A;  2DMU A;  3IH2 A;  3KP2 A;  3KFW X;  5EEH A;  3BC8 A;  3D5L A;  5ILU A;  2B0L A;  3ECO A;  2LBF A;  1VQL I;  1F5T A;  2IGO A;  1Z7U A;  3DV8 A;  1YOV B;  3I56 I;  2M1B A;  4PJM A;  1OKR A;  2HZT A;  3FM3 A;  3HOZ J;  5EGO A;  4M3F A;  4L9V A;  4DBQ A;  1G8X A;  1W7P B;  1X4O A;  3ZN0 A;  3S3M A;  1P92 A;  5L3E A;  1MBF A;  3ZQQ A;  1QU3 A;  1SVO A;  1HQC A;  5BQT A;  1QZE A;  2K9L A;  2IW5 A;  3H35 A;  3G2B A;  3OS0 A;  4II3 A;  2P7C B;  5HOD A;  3PNT A;  4ZTJ A;  1YS7 A;  2HWV A;  1MND A;  1S7A A;  1F1Z A;  2BY3 A;  4PZJ A;  1ZG5 A;  3QPS A;  2O7O A;  4B47 A;  3ISP A;  2VT2 A;  1V54 H;  4G9Y A;  3U1K A;  2M7A A;  2FNA A;  4KNY A;  3SFI A;  4C3J J;  1X3U A;  2HPI A;  4LD5 A;  1U3E M;  4XN0 A;  1FLI A;  3BR3 A;  1XG1 A;  4LLG F;  5M5Y J;  4IJA A;  2W00 A;  1Z05 A;  4QTR A;  4CYC B;  2ESN A;  1OR7 C;  3G1M A;  2P6S A;  1ZGW A;  2A6H F;  3GZ6 A;  4M9S A;  4CCN A;  2FX0 A;  1SEU A;  2EA4 A;  2YX7 A;  4UB6 C;  2DA4 A;  1FWZ A;  2XAU A;  4BAY A;  1T56 A;  1RKT A;  2Q1Z B;  2LDU A;  5D5U B;  3RYR A;  2PMH A;  5J40 A;  1A6I A;  4KIS A;  2IAI A;  1UZC A;  1XB4 A;  3S3O A;  3DEW A;  2YUS A;  1OCC H;  4EJV A;  1QRY A;  2L0K A;  1Z0X A;  3JRB A;  1VTN C;  5IOY A;  3OYB A;  2KRH A;  1FZP B;  3HSR A;  3LFU A;  2NVQ J;  1EA3 A;  4HDV A;  1NHA A;  4A3L J;  3QU6 A;  3EUH C;  3I9V 2;  2G0E A;  3JRA A;  1LFU P;  1VQM I;  2HS5 A;  3FMS A;  2KDZ A;  1RZ4 A;  2JTV A;  3HKZ A;  1D8K A;  5IP6 A;  3J7A Y;  2L7M P;  3HHG A;  5BMZ A;  1WJF A;  3HRS A;  2QCO A;  4KA4 A;  2FMY A;  3E5Q A;  3H92 A;  2D5V A;  5HLT A;  2HPM A;  4I99 C;  4RM3 A;  2L9N A;  5CYV A;  5HDG A;  3MAJ A;  4JX4 A;  4HAM A;  3AAF A;  4XRM A;  5FRO A;  3N97 A;  1ULY A;  2DQR A;  2LF8 A;  4RGX A;  5HNF A;  1YW7 A;  4FX0 A;  2R93 J;  2NS7 A;  4UNO A;  3C2B A;  5H2F C;  3LSP A;  3BR2 A;  3ESW B;  2LG4 A;  2WTE A;  3CP8 A;  1TLH B;  1KYZ A;  4XRS G;  2GBY A;  4AC0 A;  5IOZ A;  3L2V A;  2X6O A;  3A1Y A;  3VB2 A;  4U7D A;  1ACI A;  4KFC A;  2DO7 A;  2JA8 J;  5LGT A;  3AFH A;  2NOG A;  5FRM A;  5K5Q A;  1STZ A;  5CVR A;  1SD6 A;  5FKL A;  4E4H A;  3E7L A;  1LJ9 A;  5DDG A;  2BGC A;  3HOY J;  1XGN A;  3KE2 A;  4BAC A;  1RES A;  3Q5F A;  1XGO A;  3VOE A;  1XGS A;  1IAW A;  1B6A A;  3HYI A;  4W97 A;  1FOY A;  3ECH A;  1MBH A;  3BR6 A;  3EUH A;  2QM3 A;  2MH9 A;  2DA1 A;  5GP9 A;  1IDZ A;  2DFI A;  1YJ9 I;  5JLX A;  3AG2 H;  2ZXW H;  4Q48 A;  4A93 J;  1E0E A;  3FZV A;  3P5J A;  1K78 A;  4AM3 A;  2ISZ A;  5DEQ A;  1DP3 A;  3RQI A;  4ON0 A;  3ZP5 A;  5FFZ A;  2DFF A;  4I01 A;  2CUJ A;  2KPM A;  2LBF B;  4CH7 A;  1X19 A;  1ZLJ A;  2BW3 B;  2X6W A;  4IPA A;  2R7R A;  2GXB A;  5J1R A;  3WTY C;  5FGM A;  2CO5 A;  3QOE A;  5H20 A;  4RM2 A;  2YS9 A;  1BIA A;  5DUK A;  2OC6 A;  3SQN A;  1X2M A;  3DTK A;  3M9A A;  4GXO A;  4X1E A;  2COB A;  4HNV A;  2FBK A;  2QA4 I;  3MVP A;  2VJ4 A;  4YFX F;  4H0E A;  2W24 A;  2ZME B;  3VYT B;  1DU6 A;  4XON A;  4A5M A;  2W1O A;  2YR2 A;  1TL8 A;  3F3X A;  5CVU A;  3OYJ A;  3ML6 A;  2V9V A;  5HVQ C;  1X1C A;  4GFB A;  5E1Z B;  2BY2 A;  3QRF F;  2V79 A;  4UB8 C;  2EV6 A;  1POG A;  3BG9 A;  3NQO A;  2QQ8 A;  4IX7 A;  3COA C;  5C3E J;  1IF1 A;  2KIF A;  3OOP A;  4XID A;  2X0L A;  1YQA A;  2LR8 A;  4RAG A;  2XSD C;  3CCQ I;  1CF7 A;  5FLX K;  2A6E F;  3PL8 A;  1JKR C;  1NK3 P;  1ZLK A;  4AD9 A;  1OYY A;  2V1N A;  3WG7 H;  1SFE A;  1F43 A;  3W3C A;  3GFJ A;  2FEZ A;  4KIF A;  2O8K A;  1TQI A;  4FX4 A;  2JQ7 A;  2O8X A;  4HV5 A;  4XLH A;  3U9G A;  2O5R A;  4ENK A;  3MCZ A;  1T2K A;  4BH9 A;  1W0T A;  1B9N A;  1R7J A;  1JI8 A;  2I8D A;  1VZ0 A;  5F64 A;  3LSR A;  2V9K A;  4NHJ A;  4M9X A;  1H9G A;  4LGW A;  3IKV A;  5D6E A;  4XKB A;  1KZH A;  4FE4 A;  3CJQ B;  2J5P A;  2XGX A;  3CDL A;  4R8H A;  2ZCW A;  3MN2 A;  1SFU A;  2IRF G;  4CZC A;  3R60 A;  2D1V A;  1JGS A;  3F23 A;  4KN4 X;  2ZJP F;  3ASN H;  3EDP A;  1JXS A;  4XLC A;  4JX5 A;  2KL4 A;  1FMV A;  5DD4 A;  1WJC A;  5DM7 F;  2CQ7 A;  3WG9 A;  4AUX A;  3CCU I;  3CP2 A;  1IO2 A;  4C2T A;  4BY7 J;  3OSF A;  4L0Z B;  1AKH B;  5K7H A;  1ZEL A;  2L7F P;  3FXO A;  2E1M C;  2FU4 A;  1R23 A;  4ENJ A;  3EET A;  5H6R A;  4KMU X;  2R7S A;  5CQE A;  2YPR A;  1XPX A;  2FA5 A;  5FD5 A;  4OU0 A;  1LVK A;  2ICW G;  2CUE A;  2OJE D;  3ERM A;  3K4N A;  3CME I;  4ZDL A;  4ZDP A;  4EJU A;  2QQ9 A;  3ASO H;  5J1Y A;  2OUM A;  4NBQ A;  4YFK F;  1S6L A;  3LSK A;  3NWT A;  4UXN A;  1SFO J;  2MC4 A;  3PM1 A;  4BHB A;  2QLZ A;  1W1W E;  3RIR A;  2BEO A;  2V6C A;  2ID3 A;  2LKS A;  3RSN A;  4LOC A;  1D5Y A;  3QPT A;  3SJM A;  1AOY A;  4CIC A;  1FP1 D;  1V4R A;  1JHH A;  2Y48 A;  4CZZ A;  4E7S A;  4O5V A;  2DPU A;  4M73 A;  2HVQ A;  2TRT A;  2QWW A;  1EH6 A;  3BTC A;  1A31 A;  2M87 A;  3OYF A;  2PLY A;  3RDI A;  2E35 A;  3BZC A;  1PVE A;  2PX9 A;  4G94 A;  3HBL A;  3GFI A;  5AIP A;  1A36 A;  2BBY A;  4IRH A;  4Q47 A;  5J8C A;  2XAS A;  3TL4 X;  3S1Q J;  4A3B J;  2MH2 A;  3ABL H;  1G59 A;  4D5F A;  1K83 J;  3JW4 A;  2DPD A;  1KU3 A;  3BDD A;  1LDJ A;  3K2A A;  3DCF A;  2H94 A;  3WTZ A;  2OAZ A;  3RJP A;  4PJJ A;  2A69 F;  2DOD A;  1WQ2 A;  3KX2 A;  4BXF A;  4P9U A;  3KYL A;  3D1N I;  3FXL A;  3SZT A;  2WA0 A;  3OR1 C;  4JBA A;  3WTX C;  2L2O A;  1NH3 A;  3LNQ A;  3H9G A;  1Z6T A;  4WXD A;  2VKD A;  5A2Q K;  2MG4 A;  1ZR4 A;  1E2X A;  4HW0 A;  3FXU A;  1N25 A;  5FD6 A;  1O3Q A;  4BUP A;  3V7S A;  3K70 C;  1AHD P;  1V55 H;  3OYD A;  4BQN A;  3O8H A;  4ZH4 F;  3HGY A;  1HXD A;  3P9C A;  3IC7 A;  4LLL A;  2KZG A;  4DQ2 A;  1ZG3 A;  1IJW C;  3G73 A;  3FDY A;  1DU0 A;  3MZH A;  1OLT A;  3E6B A;  3PFI A;  3I58 A;  4L9T A;  1LE8 B;  3KP6 A;  2QYO A;  3PSI A;  1QPI A;  3GCM A;  3CCL I;  4N4N B;  1B8I B;  3HRT A;  2F5E A; 
#chains in the Genus database with same CATH homology
 2I5U A;  2ZC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...