2I5VO

Crystal structure of ospa mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
246
structure length
246
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKIIIIIKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title High-Resolution Structure of a Self-Assembly-Competent Form of a Hydrophobic Peptide Captured in a Soluble β-Sheet Scaffold.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags De novo protein
total genus 48
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2006-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2i5vO01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2i5vO02
5B11O 2I5VO 2PI3O 2OL8O 2OY7A 2OY5O 2FKGA 5B3MO 2G8CO 2HKDA 1P4PA 2AF5A 3CKGA 3EC5A 2OY1O 2OL6O 2FKJA 2OY8A 2OL7A 3CKFA 1FJ1E 2I5ZO 5B10O 3AUMO 2OYBO 5B2AO 1OSPO
chains in the Genus database with same CATH superfamily
3OD9A 5B11O 4GJSA 3U9PC 2MM3A 2OTJE 2WQAE 2LBAA 1X89A 2OVDA 1DFVA 1QY0A 5B5GA 4KT5A 3F8AA 3X00A 2QMIA 2WUTA 3PQUA 2RTHB 3G71E 1AELA 3ZW0A 4ID2A 1EIIA 1LIDA 2G7BA 5B27A 3I17A 2G8CO 4LZVA 1Y9TA 4XMHA 3SLJA 2RQ0A 2OYBO 4ORXA 4KH8A 4AZNA 2FLJA 4O3XB 1N9MA 1QG5A 2OZQA 1HBPA 1UYOX 4N7DA 1AQBA 4OMWA 1SWQA 2DM5A 3KFGA 3BRNA 5IXGA 1JJJA 1JBHA 1DF8A 3D97A 2AL0X 3SZIA 4CDCA 1DZPA 1B4MA 4K19A 3WZOA 4WF9E 1N9YA 5LJEA 3WXQA 4A60A 1YJ9E 4HWMA 1G5WA 1KT3A 1SXWA 1STSB 3O22A 2L5PA 1VWFB 2RTAA 1SWPA 1P6PA 2Y3FA 1G74A 1NDJA 1SXXA 2Z4HA 4R0BA 3RWXA 4FBOA 1SY0A 2JOZA 1ZNDA 2RTIB 2PI3O 2RTPB 2RTQB 4NV7A 1HXZA 4YKMA 3WJBA 3MG5A 2AMMX 1A18A 2KTSA 3DLLE 2RTGB 3J7ZG 4GDZA 3RKGA 5F2BA 2RTLA 3JSQA 3IFBA 1VQME 2AVIA 4YCEA 1EIOA 2N93A 5F6BA 4OEMA 1TXLA 1S72E 4LQZA 1MDCA 4A8ZA 5D48A 4EXZA 2OVSA 3TZSA 3WJGA 2L67A 4QRLA 2NP1A 3BY0A 1B56A 3ZW1A 1S2PA 3EW1A 3I56E 5DG4A 5H9AA 1MVGA 5B10O 3WJFA 4BJ8A 2BHVA 5AQ6A 1ML7A 1HQQA 3VG7A 2G78A 3CCSE 4BX5A 3RDUA 4IBAA 5FQ8E 1VQPE 1NQNA 4Y0QA 2RTEB 3CBCA 3FR2A 4GGZA 1RXJA 1JMZA 2GTFX 1YI2E 2QOMA 3ZI8A 4CV7A 4ML7B 1VWLB 1GT3A 3RDMA 4Y5DA 4YKOA 3CC4E 2A3FX 2AT0X 5HAEA 5HL7E 1LDQA 2AT8X 5IO7A 4JNJA 4D6BA 1SWJA 3AKNA 5EEEA 1PBYA 2IZKA 1GM6A 1SRHA 4CPEA 1SWDA 3NQKA 2OFAA 1VWOB 2XSTA 1O1VA 3UEVA 1Y53X 1KL3A 1LCWA 4ORUA 3MBTA 4KIIA 4NYQA 5HZ5A 1Y55X 2C1QA 2OY5O 4ORYA 4YDAA 2Y3EA 3O19A 3T2WA 1LIBA 5K06A 5HZ6A 5L8IA 3BLGA 4M7MA 1VYOA 3F6ZB 2YMSA 1Q86G 5BYPA 5B3MO 5BVQA 2A8GA 2KTDA 5D47A 1U18A 4ZR2A 2A13A 3RBYA 3P02A 3RDXA 3MVFA 4YFRA 3VGWA 1Q7YG 5H8TA 2A2UA 3AKMA 2GTLN 4QNIA 4I3BA 4Z2OA 1LELA 4INNA 1D2UA 1IJ8A 3BX8A 4NLIA 1YHQE 4GD9A 1I9HA 4DQ4A 3DTQA 3CMAE 4JHQA 3FEPA 3CCJE 2RTCB 3S26A 2JN3A 4C5PA 3CMPA 1JZUA 4JO6A 4YDBA 2VFBA 3SOTA 5FENA 3TGCA 1RSUB 4XMEA 2ZJRE 1MEPA 3ZWEA 4IO9E 2C4IA 3HWFA 4U8UO 1VQ9E 3O2YA 4ZHGA 3WJEA 1SY3A 1I4UA 2QO4A 4ZJ0A 1FE3A 1LKEA 5H9LA 1KL4A 3OJYC 4UU2A 1YP7A 2IZFB 3NPOA 3PEDA 2LA7A 1FDQA 4TKHA 4BX6B 2FKGA 4Y0PA 2OY1O 2AT6X 4FBVA 4ON1A 3FLLA 3LV4A 3B2IA 1SWKA 1NGLA 3FA7A 1VYGA 3P6GA 1GT1A 2FR3A 2X32A 5HZQA 1RJLC 2AT3X 2AF5A 5LJDA 1GKAA 1VQ7E 1SA8A 1SRJA 4GNYA 3RZYA 1OEEA 3CCEE 4GGTA 4GKCA 3HK1A 2F09A 1OEJA 1X8NA 2RTOB 2OF8A 3L4RA 1AVDA 3FR5A 1LICA 4GK9A 2Q9SA 2MWHA 4O9SA 5FQ7E 1O8VA 1QVFE 1STRB 3CCQE 4XMCA 3SAOA 1BSOA 4ORWA 1CBRA 1CBQA 1AVGI 1GX3A 2JU7A 1HMSA 1VQ5E 1LF7A 1SRFA 1I78A 3PH5A 3G7XA 4OKAA 2ZJQE 2BSZA 1RXKA 3LHNA 1XKIA 1Y9LA 2Q2MA 4ORSA 2KW1A 4D6AA 3APWA 2CQLA 4U8UM 1X8UA 4ARHA 1RSTB 5LJBA 2X8FA 1PMPA 1KC8G 3D4RA 1IFCA 1VQ6E 1ZNHA 2IZLB 1ALBA 3FR4A 1N0SA 5KICA 1VQNE 1K9MG 3HWEA 1KQXA 3VG4A 2OVAA 3ELZA 5FAZA 2G5LA 4HFOA 1S44A 1CRBA 2IZHB 4B55A 3PIOE 1Q81G 4WBKA 4ES7A 5K67A 1HXLA 5JVGE 1M1KG 2ACOA 5HCDC 1KFFA 4YGZA 3P6CA 1W2BE 4YGGA 4TQ2A 1BWYA 4NNTA 3FEKA 1BSYA 1K73G 1W5RA 3CCVE 5LKEA 1VQLE 1E5PA 1RXHA 2FRSA 4UY8G 2OL8O 5H9NA 1MUPA 3EYCA 1VWKB 2C1SA 1SWHA 4MVLA 4XMFA 3UEUA 5GAEG 4QGXA 3T1DA 1E02A 4PJ2A 5D45A 2F73A 2RCQA 1LIFA 3HOLA 3FA9A 1A57A 1LPJA 1YWAA 1QQSA 3PDFA 1EXSA 2AKQA 1PBOA 5HCCC 1NC9A 4U67E 1ZNEA 2A2GA 2OL6O 5KIDA 3HTYA 2CAMA 1YP6A 1SWFA 2WEWA 5F6ZA 1TOUA 3CCLE 1YJNE 2UZ2A 3CBSA 3HWDA 2ALLX 3VPJE 3WZNA 4YBPA 1JJXA 1N7YA 2HKDA 1KT6A 2RTRB 2GC9A 1LIEA 5GADG 2PY1A 4AZOA 4NV8A 4BX7B 2KD2A 1LFOA 5HZ8A 4XMDA 1JIWI 4MVEA 5L3YA 2FHLA 4WFUA 3IGEA 3VE1A 3JQOA 2OY8A 4CDDA 1VWCB 2L68A 3STKA 2CZTA 4MIRA 1ZNLA 1AVEA 1N43A 3RSWA 4CPHA 3WJDA 5H1SI 1HMTA 4KC8A 1DZMA 1N4JA 1QFVA 1LCVA 3KFIA 3F9DA 1T0VA 4GRJA 4DQ3A 2L9CA 1UZ2X 2I5VO 3I0AA 4EKVA 2MF6A 4COTA 2Q2PA 5JD2A 1GT5A 4O4UA 1BSQA 1SWTA 1OEKA 4QZTA 2FR2A 3IA8A 1DZKA 1VWQB 5JR8A 4GZVA 2GJ5A 3CD6E 4U3QA 1EPAA 5JVHE 4GUZA 1L6MA 2QO6A 3APXA 2RTKA 3UEWA 4TJZA 2ZAIA 3STNA 3TGAA 1VWJB 2RN4A 4NNSA 5F1EA 4I9RA 3BX7A 3D95A 3ELXA 2KT4B 3HOEA 2UYWA 3GAQA 2P8GA 3BSZE 4Z2VA 4QYPA 4ALOA 1KGLA 1NP4A 1QVGE 3CWKA 5IO5A 1A2DA 4QZUA 4BX5B 3CQNA 3WZPA 4TLJA 1X8PA 1DC9A 4ODDA 4BBOA 4IRWA 1T68X 1IKJA 1SWSA 3SLTA 1RAVA 3LTWA 4L1NA 2WEXA 1FEMA 4MISA 1MOYA 1I06A 5LJKA 3SZHA 1FJ1E 4Z6JA 1KQSE 1GX8A 1VWDB 5AJBA 4AW8A 1NJIG 3NX2A 1AB0A 2RTJA 4I6SA 5AJCA 3DSZA 2ZAGA 3CPWE 2FS7A 3PH6A 5MLCH 4RUUA 1KL5A 5IRUA 5IRAA 4IB9A 2QM9A 2BT9A 4I9SA 3P6HA 1PTSA 3IG9A 5EEDA 1CBIA 1A3YA 1KD1G 3VHMA 1SWEA 1CBSA 1BRPA 4YBUA 3B2KA 2X55A 3WVMA 1DV9A 1SWBA 5CHKA 4BX6A 4O4SA 3CKGA 4YMYA 4IB6A 4O3WA 4AZMA 4ZHHA 5D8JA 2X8SA 2A5CA 2HYSA 2MJIA 3EW2A 1E06A 1SY2A 3ZUIA 5F58A 3RDOA 3S60A 3VG2A 1SREA 3MM0A 2HLVA 5L8OA 2XKLA 1BLRA 2X46A 1FENA 1OPBA 5AEOA 2QOSC 1YITE 1ICMA 4MVKA 3D9WA 1D3SA 5FQ6E 1EQDA 4GNWA 3B2LA 1MX7A 1SMPI 2Q4NA 4IB7A 4CPFA 4YFQA 4LZUA 1SWGA 2HMBA 4EFGA 1DZJA 4Y0SA 3NBXX 2X8TA 4BCSA 4NLJA 3AEHA 5L8NA 4IAXA 3BU9A 4O3ZA 4Z2PA 1SLDB 3CC7E 1JMXA 3WYQA 2Y32A 3T2XA 1BJ7A 2W2BA 3SZJA 3EM0A 1EALA 3C77X 4GGRA 1GT4A 5DPQA 1S7DA 1ADLA 2W2FA 2NNQA 1XCAA 3NQ9A 4AZPA 1NQMA 4GETA 3RDQA 4WHIA 3D96A 3P6FA 5EDBA 2IZDB 4CK4A 4WFVA 3NP1A 2GTLM 3P24A 5HA1A 2RTNB 3BS2A 2CM9A 2EU7X 4ZGFA 3C78X 1FELA 1K24A 1IIUA 4ZCBA 4O4OA 3OBLA 4O49A 1G7NA 1YUPA 4Z28A 3STMX 5CYBA 1TVQA 3PPTA 4ZGUA 3TGBA 4QGWA 1HN2A 1KOIA 2ZJPE 1GKAB 4KC7A 3CCRE 2DJGA 5KHPA 4I60A 1QABE 1YWCA 5CSEA 3SLOA 2I5ZO 2JGSA 3AUMO 4M6SA 3PIPE 4YH0A 3NX1A 1ERBA 3NADA 2OVEA 2IZEB 5HA0A 2LBVA 1KXOA 1SLFB 4ORRA 3PK2A 1SWAA 5EZ2A 2FKJA 2OL7A 4FBRA 4TKBA 2M4LA 1TOWA 5LJCA 1R0UA 5HCEC 3TF6A 2WR6A 3T6FA 4ZHDA 1BM5A 4XMGA 2RA6A 2X34A 1EUOA 2R74A 2IZIA 1I05A 1Y52X 2RTDB 1TW4A 4CDFA 1X8OA 2LKKA 3I55E 4IB8A 5HWZA 1SWCA 4EQAC 2BLGA 4KCAA 1RBPA 2HZQA 1VWMB 1KT5A 1WBIA 2NNEA 2JMBA 1KT4A 1K8AG 1YWBA 4I95A 1HBQA 4AZRA 1HMRA 5HBSA 3FW4A 1QWDA 2K23A 1BRQA 1H91A 4YCHA 4UU3A 4I3CA 4NW4A 3ZW0B 4BX7A 1NBXA 2Z4IA 2MO5A 1STPA 4IAWA 2G79A 5AN9B 3CXCE 1WUBA 2QO5A 2K62A 1VQOE 1N8RG 3B2JA 2GH7A 1LCZA 4NYRA 1I04A 3KFHA 3NQ3A 1JJUA 2X4MA 1YJWE 3KVNA 3G6EE 4GDAA 3UEXA 1P4PA 1VWBB 1EW3A 4Y59A 3APVA 2WQ9A 4YFPA 2QA4E 1SRGA 2OFMX 3CQRA 1VQ4E 4HPDA 4O3YA 2AT5X 1X71A 1UYNX 3HWGA 3KFFA 1LUQA 4ZHCA 4NP1A 3RE5A 1YIJE 3BU1A 2FHNX 1UREA 1KZWA 2FGSA 4N7CA 1QY2A 2RTMA 3CKFA 3FIQA 2JU8A 3WZQA 3RDSA 3ZUOA 3QKGA 1B8EA 4DNEA 1PM1X 2NNDA 4ZHFA 2OY7A 1ZNGA 2JU3A 4A1YA 1M90G 1JV4A 4CSBA 1KZXA 4GU8A 4HPCA 3E3CA 2IZCB 5HTEA 3KQ0A 3BDRA 1SWUA 5B5FA 1BBPA 3U03A 3VG5A 3APUA 2R56A 4YVBA 1SXYA 2POAA 3NR3A 4RUNA 3ZZVA 2WSJA 5EPQA 2VFCA 2RD7C 2BC3A 3FDCA 1VYFA 3PECA 5C0NA 1GGLA 2WPUA 2YG2A 5BVTA 5CE4A 4BGFA 3EMMA 3WYPA 5D4AA 3C76X 4MVIA 1Q82G 4CPHB 4OS0A 1RL6A 3CR6A 2IZBA 4TNNA 3JS1A 3ZW1B 5DM7E 3FENA 1ACDA 5IO6A 1B0OA 1MX8A 5HTDA 2HZRA 3EC5A 4L3RA 1SY1A 1E2TA 1EPBA 2ACPX 3FA6A 1IW2A 3VG6A 2A5BA 2W2AA 1OBPA 3ZW2A 3KZAA 2X45A 1LNMA 4WCEE 1FTPA 1U0XA 4EEJA 1HQPA 1Y0GA 2ANSA 5F7GA 5BVSA 4Z27A 2JW1A 1OSPO 1OPAA 4QQ1A 2E4JA 3QQ2A 4HPBA 2OFBA 3OW2E 3WJCA 1W4TA 3Q34A 2OFRX 4ALBA 4WFNE 3P6EA 4QAEA 3EBWA 2X56A 3FA8A 2FS6A 2IZJA 2GTLO 2VDFA 4A1HA 1YWDA 2FT9A 3CC2E 2IZGB 1VWNB 3UAQA 4LKPA 2CBSA 2CM4A 1PEEA 4WFBE 1MK5A 4OS8A 5H9KA 4GH7A 2LFOA 1E00A 4ZFXA 4IOCE 3FIDA 4DCBA 1U17A 2R73A 1HY2A 1SWRA 3T6LA 4CPIA 2HNXA 3FMZA 1GX9A 1JJ2E 2ASNX 2RTBB 3VHHA 1BEBA 4AYHA 5GAGG 1VWRB 4U46A 1CJ5A 1ICNA 4FGIB 2WWPA 1QY1A 3RE6A 1SLEB 4GE1A 2CBRA 4IMNA 2OF9A 4OELA 1VWGB 2DJFA 3FW5A 3CMEE 1JYDA 3ZQ3A 3PP6A 3PQSA 1LDOA 5HZ9A 1X8QA 4U8UN 3RY1A 5DM6E 1ZRYA 3VU1A 1VQ8E 1EI5A 1K3BA 2O62A 2RTFB 4Y0RA 1SWOA 4WFAE 4YGHA 4IOAE 1SRIA 1W6FA 1VWEB 1GXAA 4TKJA 5B2AO 5K68A 1MM9A 4U9CA 5IRWA 4I3DA 1JQPA 2BS6A 2ZSCA 4MEEA 5B29A 3MX7A 3VG3A 4BOEA 3OE3A 3GE2A 1YIVA 5GAHG 1JYJA 5FFHA 4PSQA 2Q39A 1SWLA 1IKEA 4GJVA 1SXUA 2A0AA 4ZH9A 1QFTA 4HPAA 1SLGB 1T8VA 3EBKA 5EDCA 1SWNA 4BVMA 5LKFA 3FYFA 4QYNA 4QGVA 1VWIB 1ERXA 1O1UA 3FELA 3H3IA 4O4XA 2LB6A 2IZAA 3N91A 2CZUA 4OMXA 4FQBB 3RY2A 2AH7X 3CCUE 3G4SE 2IFBA 4OS3A 3HPEA 2QEXE 4EDEA 4JGLA 1VQKE 5LJHA 1VWAB 5LJGA 1OBQA 2FTBA 1DF3A 4CDEA 2MHDA 3K3LA 3CCME 1KT7A 3WBGA 1IFBA 1Z24A 2OTLE 2FWVA 3S5VA 3V8UA 3VHIA 4LKTA 4BQUA 3Q6LA 3WOVA 4IABA 1OBUA 4IMOA 4AZQA 1G85A 3P6DA 2F01A 2RCTA 3VE2A 1VPRA 2BS5A 1VWPB 1RLBE 3CF5E 1NP1A 1ZNKA 3B2HA 3U0DA 2QCBA 1VWHB 4ZH6A 1KQWA 3S5XA
chains in the Genus database with same CATH topology
5B11O 2I5VO 2PI3O 2OL8O 2OY7A 2OY5O 3IGEA 2FKGA 5B3MO 2G8CO 2HKDA 1RJLC 1P4PA 2AF5A 3CKGA 3EC5A 2OY1O 2OL6O 2FKJA 2OY8A 2OL7A 3CKFA 1FJ1E 2I5ZO 5B10O 3IG9A 3AUMO 2OYBO 5B2AO 1OSPO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B11 O;  2I5V O;  2PI3 O;  2OL8 O;  2OY7 A;  2OY5 O;  2FKG A;  5B3M O;  2G8C O;  2HKD A;  1P4P A;  2AF5 A;  3CKG A;  3EC5 A;  2OY1 O;  2OL6 O;  2FKJ A;  2OY8 A;  2OL7 A;  3CKF A;  1FJ1 E;  2I5Z O;  5B10 O;  3AUM O;  2OYB O;  5B2A O;  1OSP O; 
#chains in the Genus database with same CATH topology
 3OD9 A;  5B11 O;  4GJS A;  3U9P C;  2MM3 A;  2OTJ E;  2WQA E;  2LBA A;  1X89 A;  2OVD A;  1DFV A;  1QY0 A;  5B5G A;  4KT5 A;  3F8A A;  3X00 A;  2QMI A;  2WUT A;  3PQU A;  2RTH B;  3G71 E;  1AEL A;  3ZW0 A;  4ID2 A;  1EII A;  1LID A;  2G7B A;  5B27 A;  3I17 A;  2G8C O;  4LZV A;  1Y9T A;  4XMH A;  3SLJ A;  2RQ0 A;  2OYB O;  4ORX A;  4KH8 A;  4AZN A;  2FLJ A;  4O3X B;  1N9M A;  1QG5 A;  2OZQ A;  1HBP A;  1UYO X;  4N7D A;  1AQB A;  4OMW A;  1SWQ A;  2DM5 A;  3KFG A;  3BRN A;  5IXG A;  1JJJ A;  1JBH A;  1DF8 A;  3D97 A;  2AL0 X;  3SZI A;  4CDC A;  1DZP A;  1B4M A;  4K19 A;  3WZO A;  4WF9 E;  1N9Y A;  5LJE A;  3WXQ A;  4A60 A;  1YJ9 E;  4HWM A;  1G5W A;  1KT3 A;  1SXW A;  1STS B;  3O22 A;  2L5P A;  1VWF B;  2RTA A;  1SWP A;  1P6P A;  2Y3F A;  1G74 A;  1NDJ A;  1SXX A;  2Z4H A;  4R0B A;  3RWX A;  4FBO A;  1SY0 A;  2JOZ A;  1ZND A;  2RTI B;  2PI3 O;  2RTP B;  2RTQ B;  4NV7 A;  1HXZ A;  4YKM A;  3WJB A;  3MG5 A;  2AMM X;  1A18 A;  2KTS A;  3DLL E;  2RTG B;  3J7Z G;  4GDZ A;  3RKG A;  5F2B A;  2RTL A;  3JSQ A;  3IFB A;  1VQM E;  2AVI A;  4YCE A;  1EIO A;  2N93 A;  5F6B A;  4OEM A;  1TXL A;  1S72 E;  4LQZ A;  1MDC A;  4A8Z A;  5D48 A;  4EXZ A;  2OVS A;  3TZS A;  3WJG A;  2L67 A;  4QRL A;  2NP1 A;  3BY0 A;  1B56 A;  3ZW1 A;  1S2P A;  3EW1 A;  3I56 E;  5DG4 A;  5H9A A;  1MVG A;  5B10 O;  3WJF A;  4BJ8 A;  2BHV A;  5AQ6 A;  1ML7 A;  1HQQ A;  3VG7 A;  2G78 A;  3CCS E;  4BX5 A;  3RDU A;  4IBA A;  5FQ8 E;  1VQP E;  1NQN A;  4Y0Q A;  2RTE B;  3CBC A;  3FR2 A;  4GGZ A;  1RXJ A;  1JMZ A;  2GTF X;  1YI2 E;  2QOM A;  3ZI8 A;  4CV7 A;  4ML7 B;  1VWL B;  1GT3 A;  3RDM A;  4Y5D A;  4YKO A;  3CC4 E;  2A3F X;  2AT0 X;  5HAE A;  5HL7 E;  1LDQ A;  2AT8 X;  5IO7 A;  4JNJ A;  4D6B A;  1SWJ A;  3AKN A;  5EEE A;  1PBY A;  2IZK A;  1GM6 A;  1SRH A;  4CPE A;  1SWD A;  3NQK A;  2OFA A;  1VWO B;  2XST A;  1O1V A;  3UEV A;  1Y53 X;  1KL3 A;  1LCW A;  4ORU A;  3MBT A;  4KII A;  4NYQ A;  5HZ5 A;  1Y55 X;  2C1Q A;  2OY5 O;  4ORY A;  4YDA A;  2Y3E A;  3O19 A;  3T2W A;  1LIB A;  5K06 A;  5HZ6 A;  5L8I A;  3BLG A;  4M7M A;  1VYO A;  3F6Z B;  2YMS A;  1Q86 G;  5BYP A;  5B3M O;  5BVQ A;  2A8G A;  2KTD A;  5D47 A;  1U18 A;  4ZR2 A;  2A13 A;  3RBY A;  3P02 A;  3RDX A;  3MVF A;  4YFR A;  3VGW A;  1Q7Y G;  5H8T A;  2A2U A;  3AKM A;  2GTL N;  4QNI A;  4I3B A;  4Z2O A;  1LEL A;  4INN A;  1D2U A;  1IJ8 A;  3BX8 A;  4NLI A;  1YHQ E;  4GD9 A;  1I9H A;  4DQ4 A;  3DTQ A;  3CMA E;  4JHQ A;  3FEP A;  3CCJ E;  2RTC B;  3S26 A;  2JN3 A;  4C5P A;  3CMP A;  1JZU A;  4JO6 A;  4YDB A;  2VFB A;  3SOT A;  5FEN A;  3TGC A;  1RSU B;  4XME A;  2ZJR E;  1MEP A;  3ZWE A;  4IO9 E;  2C4I A;  3HWF A;  4U8U O;  1VQ9 E;  3O2Y A;  4ZHG A;  3WJE A;  1SY3 A;  1I4U A;  2QO4 A;  4ZJ0 A;  1FE3 A;  1LKE A;  5H9L A;  1KL4 A;  3OJY C;  4UU2 A;  1YP7 A;  2IZF B;  3NPO A;  3PED A;  2LA7 A;  1FDQ A;  4TKH A;  4BX6 B;  2FKG A;  4Y0P A;  2OY1 O;  2AT6 X;  4FBV A;  4ON1 A;  3FLL A;  3LV4 A;  3B2I A;  1SWK A;  1NGL A;  3FA7 A;  1VYG A;  3P6G A;  1GT1 A;  2FR3 A;  2X32 A;  5HZQ A;  1RJL C;  2AT3 X;  2AF5 A;  5LJD A;  1GKA A;  1VQ7 E;  1SA8 A;  1SRJ A;  4GNY A;  3RZY A;  1OEE A;  3CCE E;  4GGT A;  4GKC A;  3HK1 A;  2F09 A;  1OEJ A;  1X8N A;  2RTO B;  2OF8 A;  3L4R A;  1AVD A;  3FR5 A;  1LIC A;  4GK9 A;  2Q9S A;  2MWH A;  4O9S A;  5FQ7 E;  1O8V A;  1QVF E;  1STR B;  3CCQ E;  4XMC A;  3SAO A;  1BSO A;  4ORW A;  1CBR A;  1CBQ A;  1AVG I;  1GX3 A;  2JU7 A;  1HMS A;  1VQ5 E;  1LF7 A;  1SRF A;  1I78 A;  3PH5 A;  3G7X A;  4OKA A;  2ZJQ E;  2BSZ A;  1RXK A;  3LHN A;  1XKI A;  1Y9L A;  2Q2M A;  4ORS A;  2KW1 A;  4D6A A;  3APW A;  2CQL A;  4U8U M;  1X8U A;  4ARH A;  1RST B;  5LJB A;  2X8F A;  1PMP A;  1KC8 G;  3D4R A;  1IFC A;  1VQ6 E;  1ZNH A;  2IZL B;  1ALB A;  3FR4 A;  1N0S A;  5KIC A;  1VQN E;  1K9M G;  3HWE A;  1KQX A;  3VG4 A;  2OVA A;  3ELZ A;  5FAZ A;  2G5L A;  4HFO A;  1S44 A;  1CRB A;  2IZH B;  4B55 A;  3PIO E;  1Q81 G;  4WBK A;  4ES7 A;  5K67 A;  1HXL A;  5JVG E;  1M1K G;  2ACO A;  5HCD C;  1KFF A;  4YGZ A;  3P6C A;  1W2B E;  4YGG A;  4TQ2 A;  1BWY A;  4NNT A;  3FEK A;  1BSY A;  1K73 G;  1W5R A;  3CCV E;  5LKE A;  1VQL E;  1E5P A;  1RXH A;  2FRS A;  4UY8 G;  2OL8 O;  5H9N A;  1MUP A;  3EYC A;  1VWK B;  2C1S A;  1SWH A;  4MVL A;  4XMF A;  3UEU A;  5GAE G;  4QGX A;  3T1D A;  1E02 A;  4PJ2 A;  5D45 A;  2F73 A;  2RCQ A;  1LIF A;  3HOL A;  3FA9 A;  1A57 A;  1LPJ A;  1YWA A;  1QQS A;  3PDF A;  1EXS A;  2AKQ A;  1PBO A;  5HCC C;  1NC9 A;  4U67 E;  1ZNE A;  2A2G A;  2OL6 O;  5KID A;  3HTY A;  2CAM A;  1YP6 A;  1SWF A;  2WEW A;  5F6Z A;  1TOU A;  3CCL E;  1YJN E;  2UZ2 A;  3CBS A;  3HWD A;  2ALL X;  3VPJ E;  3WZN A;  4YBP A;  1JJX A;  1N7Y A;  2HKD A;  1KT6 A;  2RTR B;  2GC9 A;  1LIE A;  5GAD G;  2PY1 A;  4AZO A;  4NV8 A;  4BX7 B;  2KD2 A;  1LFO A;  5HZ8 A;  4XMD A;  1JIW I;  4MVE A;  5L3Y A;  2FHL A;  4WFU A;  3IGE A;  3VE1 A;  3JQO A;  2OY8 A;  4CDD A;  1VWC B;  2L68 A;  3STK A;  2CZT A;  4MIR A;  1ZNL A;  1AVE A;  1N43 A;  3RSW A;  4CPH A;  3WJD A;  5H1S I;  1HMT A;  4KC8 A;  1DZM A;  1N4J A;  1QFV A;  1LCV A;  3KFI A;  3F9D A;  1T0V A;  4GRJ A;  4DQ3 A;  2L9C A;  1UZ2 X;  2I5V O;  3I0A A;  4EKV A;  2MF6 A;  4COT A;  2Q2P A;  5JD2 A;  1GT5 A;  4O4U A;  1BSQ A;  1SWT A;  1OEK A;  4QZT A;  2FR2 A;  3IA8 A;  1DZK A;  1VWQ B;  5JR8 A;  4GZV A;  2GJ5 A;  3CD6 E;  4U3Q A;  1EPA A;  5JVH E;  4GUZ A;  1L6M A;  2QO6 A;  3APX A;  2RTK A;  3UEW A;  4TJZ A;  2ZAI A;  3STN A;  3TGA A;  1VWJ B;  2RN4 A;  4NNS A;  5F1E A;  4I9R A;  3BX7 A;  3D95 A;  3ELX A;  2KT4 B;  3HOE A;  2UYW A;  3GAQ A;  2P8G A;  3BSZ E;  4Z2V A;  4QYP A;  4ALO A;  1KGL A;  1NP4 A;  1QVG E;  3CWK A;  5IO5 A;  1A2D A;  4QZU A;  4BX5 B;  3CQN A;  3WZP A;  4TLJ A;  1X8P A;  1DC9 A;  4ODD A;  4BBO A;  4IRW A;  1T68 X;  1IKJ A;  1SWS A;  3SLT A;  1RAV A;  3LTW A;  4L1N A;  2WEX A;  1FEM A;  4MIS A;  1MOY A;  1I06 A;  5LJK A;  3SZH A;  1FJ1 E;  4Z6J A;  1KQS E;  1GX8 A;  1VWD B;  5AJB A;  4AW8 A;  1NJI G;  3NX2 A;  1AB0 A;  2RTJ A;  4I6S A;  5AJC A;  3DSZ A;  2ZAG A;  3CPW E;  2FS7 A;  3PH6 A;  5MLC H;  4RUU A;  1KL5 A;  5IRU A;  5IRA A;  4IB9 A;  2QM9 A;  2BT9 A;  4I9S A;  3P6H A;  1PTS A;  3IG9 A;  5EED A;  1CBI A;  1A3Y A;  1KD1 G;  3VHM A;  1SWE A;  1CBS A;  1BRP A;  4YBU A;  3B2K A;  2X55 A;  3WVM A;  1DV9 A;  1SWB A;  5CHK A;  4BX6 A;  4O4S A;  3CKG A;  4YMY A;  4IB6 A;  4O3W A;  4AZM A;  4ZHH A;  5D8J A;  2X8S A;  2A5C A;  2HYS A;  2MJI A;  3EW2 A;  1E06 A;  1SY2 A;  3ZUI A;  5F58 A;  3RDO A;  3S60 A;  3VG2 A;  1SRE A;  3MM0 A;  2HLV A;  5L8O A;  2XKL A;  1BLR A;  2X46 A;  1FEN A;  1OPB A;  5AEO A;  2QOS C;  1YIT E;  1ICM A;  4MVK A;  3D9W A;  1D3S A;  5FQ6 E;  1EQD A;  4GNW A;  3B2L A;  1MX7 A;  1SMP I;  2Q4N A;  4IB7 A;  4CPF A;  4YFQ A;  4LZU A;  1SWG A;  2HMB A;  4EFG A;  1DZJ A;  4Y0S A;  3NBX X;  2X8T A;  4BCS A;  4NLJ A;  3AEH A;  5L8N A;  4IAX A;  3BU9 A;  4O3Z A;  4Z2P A;  1SLD B;  3CC7 E;  1JMX A;  3WYQ A;  2Y32 A;  3T2X A;  1BJ7 A;  2W2B A;  3SZJ A;  3EM0 A;  1EAL A;  3C77 X;  4GGR A;  1GT4 A;  5DPQ A;  1S7D A;  1ADL A;  2W2F A;  2NNQ A;  1XCA A;  3NQ9 A;  4AZP A;  1NQM A;  4GET A;  3RDQ A;  4WHI A;  3D96 A;  3P6F A;  5EDB A;  2IZD B;  4CK4 A;  4WFV A;  3NP1 A;  2GTL M;  3P24 A;  5HA1 A;  2RTN B;  3BS2 A;  2CM9 A;  2EU7 X;  4ZGF A;  3C78 X;  1FEL A;  1K24 A;  1IIU A;  4ZCB A;  4O4O A;  3OBL A;  4O49 A;  1G7N A;  1YUP A;  4Z28 A;  3STM X;  5CYB A;  1TVQ A;  3PPT A;  4ZGU A;  3TGB A;  4QGW A;  1HN2 A;  1KOI A;  2ZJP E;  1GKA B;  4KC7 A;  3CCR E;  2DJG A;  5KHP A;  4I60 A;  1QAB E;  1YWC A;  5CSE A;  3SLO A;  2I5Z O;  2JGS A;  3AUM O;  4M6S A;  3PIP E;  4YH0 A;  3NX1 A;  1ERB A;  3NAD A;  2OVE A;  2IZE B;  5HA0 A;  2LBV A;  1KXO A;  1SLF B;  4ORR A;  3PK2 A;  1SWA A;  5EZ2 A;  2FKJ A;  2OL7 A;  4FBR A;  4TKB A;  2M4L A;  1TOW A;  5LJC A;  1R0U A;  5HCE C;  3TF6 A;  2WR6 A;  3T6F A;  4ZHD A;  1BM5 A;  4XMG A;  2RA6 A;  2X34 A;  1EUO A;  2R74 A;  2IZI A;  1I05 A;  1Y52 X;  2RTD B;  1TW4 A;  4CDF A;  1X8O A;  2LKK A;  3I55 E;  4IB8 A;  5HWZ A;  1SWC A;  4EQA C;  2BLG A;  4KCA A;  1RBP A;  2HZQ A;  1VWM B;  1KT5 A;  1WBI A;  2NNE A;  2JMB A;  1KT4 A;  1K8A G;  1YWB A;  4I95 A;  1HBQ A;  4AZR A;  1HMR A;  5HBS A;  3FW4 A;  1QWD A;  2K23 A;  1BRQ A;  1H91 A;  4YCH A;  4UU3 A;  4I3C A;  4NW4 A;  3ZW0 B;  4BX7 A;  1NBX A;  2Z4I A;  2MO5 A;  1STP A;  4IAW A;  2G79 A;  5AN9 B;  3CXC E;  1WUB A;  2QO5 A;  2K62 A;  1VQO E;  1N8R G;  3B2J A;  2GH7 A;  1LCZ A;  4NYR A;  1I04 A;  3KFH A;  3NQ3 A;  1JJU A;  2X4M A;  1YJW E;  3KVN A;  3G6E E;  4GDA A;  3UEX A;  1P4P A;  1VWB B;  1EW3 A;  4Y59 A;  3APV A;  2WQ9 A;  4YFP A;  2QA4 E;  1SRG A;  2OFM X;  3CQR A;  1VQ4 E;  4HPD A;  4O3Y A;  2AT5 X;  1X71 A;  1UYN X;  3HWG A;  3KFF A;  1LUQ A;  4ZHC A;  4NP1 A;  3RE5 A;  1YIJ E;  3BU1 A;  2FHN X;  1URE A;  1KZW A;  2FGS A;  4N7C A;  1QY2 A;  2RTM A;  3CKF A;  3FIQ A;  2JU8 A;  3WZQ A;  3RDS A;  3ZUO A;  3QKG A;  1B8E A;  4DNE A;  1PM1 X;  2NND A;  4ZHF A;  2OY7 A;  1ZNG A;  2JU3 A;  4A1Y A;  1M90 G;  1JV4 A;  4CSB A;  1KZX A;  4GU8 A;  4HPC A;  3E3C A;  2IZC B;  5HTE A;  3KQ0 A;  3BDR A;  1SWU A;  5B5F A;  1BBP A;  3U03 A;  3VG5 A;  3APU A;  2R56 A;  4YVB A;  1SXY A;  2POA A;  3NR3 A;  4RUN A;  3ZZV A;  2WSJ A;  5EPQ A;  2VFC A;  2RD7 C;  2BC3 A;  3FDC A;  1VYF A;  3PEC A;  5C0N A;  1GGL A;  2WPU A;  2YG2 A;  5BVT A;  5CE4 A;  4BGF A;  3EMM A;  3WYP A;  5D4A A;  3C76 X;  4MVI A;  1Q82 G;  4CPH B;  4OS0 A;  1RL6 A;  3CR6 A;  2IZB A;  4TNN A;  3JS1 A;  3ZW1 B;  5DM7 E;  3FEN A;  1ACD A;  5IO6 A;  1B0O A;  1MX8 A;  5HTD A;  2HZR A;  3EC5 A;  4L3R A;  1SY1 A;  1E2T A;  1EPB A;  2ACP X;  3FA6 A;  1IW2 A;  3VG6 A;  2A5B A;  2W2A A;  1OBP A;  3ZW2 A;  3KZA A;  2X45 A;  1LNM A;  4WCE E;  1FTP A;  1U0X A;  4EEJ A;  1HQP A;  1Y0G A;  2ANS A;  5F7G A;  5BVS A;  4Z27 A;  2JW1 A;  1OSP O;  1OPA A;  4QQ1 A;  2E4J A;  3QQ2 A;  4HPB A;  2OFB A;  3OW2 E;  3WJC A;  1W4T A;  3Q34 A;  2OFR X;  4ALB A;  4WFN E;  3P6E A;  4QAE A;  3EBW A;  2X56 A;  3FA8 A;  2FS6 A;  2IZJ A;  2GTL O;  2VDF A;  4A1H A;  1YWD A;  2FT9 A;  3CC2 E;  2IZG B;  1VWN B;  3UAQ A;  4LKP A;  2CBS A;  2CM4 A;  1PEE A;  4WFB E;  1MK5 A;  4OS8 A;  5H9K A;  4GH7 A;  2LFO A;  1E00 A;  4ZFX A;  4IOC E;  3FID A;  4DCB A;  1U17 A;  2R73 A;  1HY2 A;  1SWR A;  3T6L A;  4CPI A;  2HNX A;  3FMZ A;  1GX9 A;  1JJ2 E;  2ASN X;  2RTB B;  3VHH A;  1BEB A;  4AYH A;  5GAG G;  1VWR B;  4U46 A;  1CJ5 A;  1ICN A;  4FGI B;  2WWP A;  1QY1 A;  3RE6 A;  1SLE B;  4GE1 A;  2CBR A;  4IMN A;  2OF9 A;  4OEL A;  1VWG B;  2DJF A;  3FW5 A;  3CME E;  1JYD A;  3ZQ3 A;  3PP6 A;  3PQS A;  1LDO A;  5HZ9 A;  1X8Q A;  4U8U N;  3RY1 A;  5DM6 E;  1ZRY A;  3VU1 A;  1VQ8 E;  1EI5 A;  1K3B A;  2O62 A;  2RTF B;  4Y0R A;  1SWO A;  4WFA E;  4YGH A;  4IOA E;  1SRI A;  1W6F A;  1VWE B;  1GXA A;  4TKJ A;  5B2A O;  5K68 A;  1MM9 A;  4U9C A;  5IRW A;  4I3D A;  1JQP A;  2BS6 A;  2ZSC A;  4MEE A;  5B29 A;  3MX7 A;  3VG3 A;  4BOE A;  3OE3 A;  3GE2 A;  1YIV A;  5GAH G;  1JYJ A;  5FFH A;  4PSQ A;  2Q39 A;  1SWL A;  1IKE A;  4GJV A;  1SXU A;  2A0A A;  4ZH9 A;  1QFT A;  4HPA A;  1SLG B;  1T8V A;  3EBK A;  5EDC A;  1SWN A;  4BVM A;  5LKF A;  3FYF A;  4QYN A;  4QGV A;  1VWI B;  1ERX A;  1O1U A;  3FEL A;  3H3I A;  4O4X A;  2LB6 A;  2IZA A;  3N91 A;  2CZU A;  4OMX A;  4FQB B;  3RY2 A;  2AH7 X;  3CCU E;  3G4S E;  2IFB A;  4OS3 A;  3HPE A;  2QEX E;  4EDE A;  4JGL A;  1VQK E;  5LJH A;  1VWA B;  5LJG A;  1OBQ A;  2FTB A;  1DF3 A;  4CDE A;  2MHD A;  3K3L A;  3CCM E;  1KT7 A;  3WBG A;  1IFB A;  1Z24 A;  2OTL E;  2FWV A;  3S5V A;  3V8U A;  3VHI A;  4LKT A;  4BQU A;  3Q6L A;  3WOV A;  4IAB A;  1OBU A;  4IMO A;  4AZQ A;  1G85 A;  3P6D A;  2F01 A;  2RCT A;  3VE2 A;  1VPR A;  2BS5 A;  1VWP B;  1RLB E;  3CF5 E;  1NP1 A;  1ZNK A;  3B2H A;  3U0D A;  2QCB A;  1VWH B;  4ZH6 A;  1KQW A;  3S5X A; 
#chains in the Genus database with same CATH homology
 5B11 O;  2I5V O;  2PI3 O;  2OL8 O;  2OY7 A;  2OY5 O;  3IGE A;  2FKG A;  5B3M O;  2G8C O;  2HKD A;  1RJL C;  1P4P A;  2AF5 A;  3CKG A;  3EC5 A;  2OY1 O;  2OL6 O;  2FKJ A;  2OY8 A;  2OL7 A;  3CKF A;  1FJ1 E;  2I5Z O;  5B10 O;  3IG9 A;  3AUM O;  2OYB O;  5B2A O;  1OSP O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...