2I5ZO

The crystal structure of ospa mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
246
Chain Sequence
NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKANEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title Hydrophobic surface burial is the major stability determinant of a flat, single-layer beta-sheet.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags De novo protein
total genus 49
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2006-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2i5zO01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2i5zO02
2I5ZO 5B11O 2PI3O 2OL7A 5B2AO 3EC5A 1OSPO 2FKGA 2AF5A 1P4PA 2FKJA 2OL8O 1FJ1E 3CKFA 2OY8A 3AUMO 2OY7A 2OY1O 2OL6O 2HKDA 5B3MO 2I5VO 2OYBO 3CKGA 2OY5O 2G8CO 5B10O
chains in the Genus database with same CATH superfamily
3EM0A 3B2HA 1DZKA 1JMXA 3P6CA 1AB0A 4TNNA 1TOUA 1RXHA 3CCLE 4U8UM 2GTLN 4O3WA 5D48A 4GRJA 1Q82G 4ZR2A 4FBOA 3QKGA 1LUQA 3X00A 1D2UA 1BSYA 1NC9A 1UYNX 1GKAB 1N7YA 2BS6A 4YBPA 1HMSA 1MDCA 1BSQA 2IZEB 5IRWA 3T2WA 3P6EA 1GT1A 2CZUA 5HZ8A 1IFBA 1OEJA 5L3YA 1MEPA 3I0AA 2HYSA 1PM1X 1N9YA 3O2YA 4TLJA 2L9CA 3FEKA 3WXQA 2CBSA 1QFVA 1SRJA 4DNEA 2A0AA 1VQLE 5DM6E 3STKA 3VU1A 2BS5A 4D6BA 1BRPA 1NGLA 1GX9A 2OL8O 3RY1A 1DZMA 2KD2A 4PJ2A 1JJXA 4XMDA 1SWSA 3S26A 4YDBA 1EI5A 2W2AA 4ID2A 4YGHA 2IZAA 2ASNX 3SZIA 5JR8A 3OBLA 4QRLA 1YWBA 4MVLA 4GGZA 2RTAA 5AQ6A 4TKJA 3VG3A 4ZH9A 1LCVA 2CM4A 1YUPA 3FA6A 4ORRA 3AKMA 2PI3O 2OVSA 2ALLX 2VFBA 1CBSA 3NQKA 1SRIA 4IOAE 4IAWA 4I60A 1U18A 2QM9A 3PIPE 1YWCA 1FJ1E 3MX7A 5B27A 2OTLE 1S44A 4AW8A 3G4SE 1KQWA 4BCSA 1B56A 1GGLA 4TKHA 5HCDC 1KC8G 4K19A 4JGLA 4BJ8A 3VG4A 1VQKE 2Y32A 1X8OA 5HZ9A 2BHVA 4YFRA 4KCAA 5AEOA 4L1NA 5HA0A 2FT9A 1BEBA 1ERBA 2G79A 2BC3A 5HZQA 5FAZA 1VQME 1JQPA 4GD9A 1B0OA 2QO4A 5LJDA 2LA7A 4IMOA 1MX8A 1QVFE 3TGAA 2ZJPE 3UAQA 3ZW2A 1QVGE 3CCUE 3D95A 1DV9A 1ICMA 1W5RA 3P6DA 5GADG 3PPTA 3S5XA 3P6HA 1DZJA 4I6SA 4NYRA 4A60A 1Y9TA 1N4JA 2WEXA 1SWKA 1W4TA 4OMWA 1ACDA 3EBWA 1R0UA 1E06A 3G71E 2F09A 4U3QA 3JSQA 3G7XA 1G7NA 1N43A 3CCRE 4ZFXA 2WPUA 3DSZA 2ZSCA 2OVEA 5HA1A 2QA4E 3N91A 5FQ7E 4O9SA 3FMZA 2Q39A 3KFIA 1LIDA 1LCZA 4LKTA 4DQ3A 4I9SA 1HMTA 2HKDA 1JIWI 3B2KA 1RSTB 1PTSA 4ZGUA 2NNQA 2QMIA 4WHIA 1ZRYA 2IZKA 4EDEA 3UEXA 3JQOA 4CK4A 4WCEE 3G6EE 1YJNE 5HZ6A 1MK5A 3WJFA 1I9HA 4OS3A 2RN4A 2FWVA 1KOIA 2G78A 2X8FA 1BLRA 1VWMB 4QYPA 1VWLB 1VQ8E 5EEDA 1CBQA 1VWDB 4I3BA 4O3YA 2AT6X 1HBPA 2JMBA 4M6SA 1Y53X 3RDSA 2O62A 5GAGG 3RKGA 4M7MA 3HWEA 2IZGB 1LFOA 1OEKA 3RSWA 5GAEG 3ZW1B 2BLGA 4L3RA 3WZNA 1AQBA 4OKAA 4UY8G 5AJBA 1VWCB 5HCEC 3WJEA 1FELA 2IZDB 3OJYC 1VWPB 5K06A 1EIIA 3APVA 2BT9A 1KT4A 1X8QA 2RTRB 2GC9A 3BX7A 4BX6A 1WUBA 1HN2A 2RTPB 3PK2A 4YCEA 4WF9E 1RJLC 4QGVA 3RDXA 2WSJA 2OY7A 2XKLA 2A8GA 3IGEA 3DLLE 1LF7A 1RXJA 4AZPA 4CPEA 4ALBA 4O4XA 1SRGA 4YDAA 4BX5B 2OL7A 4IB9A 2RTMA 2M4LA 2CQLA 5BYPA 2NNEA 4Z27A 2OFMX 4I95A 3GE2A 2IZJA 3PP6A 3PQUA 2VDFA 1A2DA 3RDQA 1OPBA 3H3IA 3CCEE 3STMX 4ZHCA 4ORXA 1SWFA 1YITE 2X45A 1E5PA 4MVIA 1P6PA 4QNIA 1RLBE 1GT5A 2R56A 5KICA 1SWQA 2OL6O 2R73A 2A13A 5DG4A 2OYBO 1YJ9E 2JU3A 2CM9A 4CDFA 1K8AG 5H9NA 1MM9A 5B2AO 2Z4IA 1TW4A 1HQQA 1B4MA 2QOSC 2FRSA 1STRB 3HWFA 5LJCA 5JD2A 1HQPA 4ZHDA 5D45A 2FLJA 1LICA 3L4RA 2MF6A 1S72E 4TJZA 1ZNGA 1P4PA 5DPQA 2MJIA 4GE1A 4OS0A 1KFFA 3FA7A 5GAHG 1JMZA 2FR3A 3T6FA 1VQNE 4MISA 2RTFB 3VHMA 1N0SA 4GNWA 4CPHB 2JOZA 2RTBB 3JS1A 2FKGA 1HMRA 1SWBA 4O49A 5B5GA 4I9RA 4INNA 4Y59A 1KL5A 5B3MO 2WQ9A 2QEXE 1VQ6E 3D97A 3PIOE 1YI2E 3S5VA 1U17A 2A5CA 1GX8A 3NADA 3WJBA 2OVDA 3SOTA 2HZQA 3UEVA 4LZVA 3FW5A 3WYQA 3FA9A 5L8OA 3VG7A 5LJHA 2YG2A 2AVIA 3CC4E 1RAVA 1GX3A 2GTLM 2OFAA 1YIJE 4EKVA 1JJUA 2IZBA 5LJGA 1KL4A 3ZWEA 4AZQA 1LIBA 4NV7A 1RXKA 2F01A 4GGTA 4YGGA 3QQ2A 5FFHA 5IRAA 4IO9E 1SWCA 5F2BA 1NP4A 2NP1A 4CDDA 3ELXA 1KT3A 3WJDA 1O1UA 1SWHA 3FIDA 1ZNEA 2JN3A 4ALOA 3HOEA 1SWTA 2CAMA 3EC5A 3ZW0B 5CSEA 4FGIB 4CDCA 5D47A 3EYCA 1ZNDA 5L8NA 3F6ZB 1RSUB 4GZVA 1ICNA 3BLGA 1VWQB 4TKBA 4U67E 1VYGA 1TOWA 1BJ7A 5FQ8E 4ORWA 5K68A 1GM6A 3FIQA 4IRWA 3BU1A 3BDRA 2RTKA 2WWPA 4NLIA 3TGCA 2AT0X 2WQAE 4WFVA 3ZW1A 1OBPA 4IBAA 3U0DA 1VWGB 1EPBA 4YFQA 3RE6A 4ORYA 3BSZE 2Q4NA 4WFAE 3IFBA 3ZI8A 4UU2A 4ZHGA 3Q34A 4NP1A 4XMGA 4Y0QA 3FELA 5IO5A 4RUUA 2JGSA 3UEUA 4AZRA 3WOVA 3RWXA 2RCTA 1H91A 4GUZA 4AZOA 1N9MA 3HWGA 3CQNA 4GNYA 2CBRA 4ML7B 2RTJA 3C76X 5LJEA 1KZXA 1JV4A 1XCAA 3FEPA 3OE3A 2GH7A 4CPFA 5H9AA 1YIVA 2IZIA 3GAQA 2NNDA 3SLJA 4JHQA 3TF6A 1E00A 4YBUA 1LDQA 1VQ5E 1VWEB 2AT8X 2X32A 4DCBA 4AYHA 3C78X 3NX1A 2FS7A 4YKOA 4COTA 3BU9A 1FTPA 1ZNHA 3SLTA 2A2GA 5EDBA 4FBVA 1QABE 2FTBA 1IKEA 4C5PA 1AELA 4BBOA 4IB6A 1HXLA 2HNXA 4YCHA 2E4JA 4ODDA 1BRQA 2Y3FA 1SY3A 1JYJA 1QY0A 3U03A 2RTEB 1NP1A 2LKKA 1VWRB 5F6BA 4O4UA 5HZ5A 1JYDA 1SREA 2FR2A 4CDEA 5CHKA 4OMXA 5IRUA 2DJFA 2QOMA 4XMEA 2OF9A 2G8CO 4CSBA 5MLCH 4YGZA 2GTFX 3HTYA 3HPEA 4YVBA 2C1QA 2JU8A 1YWDA 1TXLA 3EMMA 2R74A 3CC7E 4QQ1A 4U46A 1IJ8A 3CKGA 5F1EA 3WJCA 1KT5A 4MVKA 1AVGI 1K9MG 4IB8A 4ORSA 1Q81G 3APWA 5EDCA 2AL0X 4IAXA 1VQ4E 2G5LA 1LIFA 2RD7C 3CCME 4GGRA 3BY0A 4DQ4A 3CMAE 1A18A 1CJ5A 3KQ0A 4TQ2A 1ADLA 5JVHE 1SRHA 1LPJA 3TZSA 4NNTA 1FEMA 3WBGA 1X71A 1SWGA 1ZNLA 3VGWA 1CRBA 4B55A 1OBQA 3NPOA 2FHNX 1SWUA 3BS2A 3EBKA 1VWOB 3IG9A 1ZNKA 3P02A 3RBYA 5DM7E 2RTIB 3AUMO 1G5WA 3NBXX 1GKAA 1KL3A 2CZTA 2LBAA 1CBRA 1FDQA 2OY5O 5LKFA 1FE3A 1YP7A 5AN9B 3T2XA 4FBRA 3FDCA 1VYFA 1T8VA 3VHHA 4OEMA 5B5FA 5F58A 2FHLA 2Z4HA 1I05A 2X55A 5LJBA 4NW4A 2K62A 4QGWA 1SWEA 2XSTA 3D96A 4PSQA 3HWDA 5K67A 3ZW0A 1VYOA 4BQUA 5F7GA 4GJVA 4Y0PA 3VHIA 3ZQ3A 2KTDA 1KT6A 3AKNA 3D9WA 3VG2A 1CBIA 1IKJA 4JO6A 2FKJA 1VWAB 1Y0GA 3P6GA 3WZPA 4KT5A 2HMBA 3CWKA 1Y52X 4GH7A 1M90G 2POAA 4OELA 1SWDA 5EPQA 2X8SA 3B2JA 1HBQA 4ES7A 3IA8A 3VG5A 3CMEE 4R0BA 1I06A 1KZWA 3HK1A 1NQNA 4HPAA 2LBVA 5EZ2A 4JNJA 2OY1O 3APUA 3F9DA 4XMFA 1VWKB 1VWIB 1EUOA 1OBUA 1GT3A 3MM0A 5HTDA 4D6AA 1QY2A 4KIIA 3CXCE 1PBYA 3VG6A 4YMYA 3VE1A 1SXUA 1BSOA 2C4IA 1X8PA 3DTQA 5BVQA 4Z2VA 1VWNB 3PQSA 2AF5A 3S60A 1MOYA 2Q2PA 3CD6E 1T0VA 2IFBA 1I04A 1EW3A 4IABA 1SRFA 1RBPA 3D4RA 5EEEA 4MIRA 2HLVA 4ZJ0A 3TGBA 5H1SI 3KFHA 4LQZA 2ZJRE 1B8EA 4U8UO 4RUNA 5FENA 4I3DA 1EPAA 2ZAIA 1HXZA 3NP1A 1SMPI 2L67A 1ERXA 1KXOA 2QO6A 3CCSE 1MUPA 3PECA 4U8UN 1ALBA 1NQMA 2KT4B 2Q9SA 1IIUA 2W2FA 4A1YA 3LHNA 1JJ2E 3SAOA 4EEJA 3LV4A 2IZHB 3FR5A 1L6MA 4NNSA 4BX6B 5D4AA 1KGLA 2QO5A 2OTJE 1Z24A 1DC9A 1SWAA 4ON1A 4MVEA 1WBIA 3I56E 2KW1A 1IFCA 1KQSE 4GDAA 5B29A 4BOEA 3I17A 4Y5DA 4BX7B 3SZJA 4BGFA 2IZLB 1BBPA 3MBTA 1TVQA 2DM5A 1E02A 4BVMA 5HAEA 3PEDA 1X8UA 5BVTA 4QZTA 3F8AA 2PY1A 3OD9A 2AMMX 1QG5A 1ML7A 1DF3A 1EIOA 2P8GA 3RDMA 1KT7A 1NDJA 2OZQA 2RTCB 1QQSA 3MVFA 3FR4A 2X34A 4WFUA 1SY2A 1AVDA 1DF8A 1SWLA 1SWJA 2OVAA 1KD1G 1SLEB 1SWPA 1K73G 3RDUA 5B11O 1QWDA 2OFBA 1EXSA 5F6ZA 4LZUA 2AT5X 5LKEA 1MVGA 2W2BA 1D3SA 2G7BA 2Q2MA 1O1VA 2JW1A 1SLGB 4KC7A 3WVMA 2HZRA 3SLOA 2KTSA 5HBSA 4O4OA 3CQRA 3WYPA 5HL7E 3CBSA 1W2BE 5H9LA 4ZHFA 1A57A 1Q7YG 3WJGA 1Y9LA 2UZ2A 3CR6A 3RZYA 3P24A 1SXXA 1UZ2X 1VQPE 5HWZA 1DZPA 3VE2A 5B10O 2WUTA 2N93A 4YKMA 1JBHA 3STNA 4BX5A 3FW4A 2WR6A 5C0NA 2YMSA 1FENA 3KFFA 4NLJA 2Y3EA 3PH5A 4ZCBA 4HPBA 1JZUA 5KHPA 3PH6A 2X46A 4NV8A 2JU7A 3CKFA 4GETA 2FGSA 3VPJE 4QGXA 2OF8A 5IO7A 1SY0A 1BM5A 3J7ZG 1LDOA 4XMHA 3RY2A 4EXZA 4Y0SA 3ZUOA 4CV7A 4CPIA 3T1DA 1GT4A 4GK9A 3K3LA 4Z6JA 2X56A 2A5BA 3SZHA 1I4UA 4A8ZA 1X8NA 2LFOA 1EALA 1G74A 5D8JA 5CE4A 2F73A 1SLDB 1KQXA 2AT3X 2A2UA 2MM3A 4ZHHA 1RL6A 1VPRA 4IB7A 4ZH6A 2AH7X 1O8VA 2A3FX 1STSB 1GXAA 1G85A 3O19A 3ZZVA 2AKQA 1IW2A 3PDFA 3Q6LA 4A1HA 4Z28A 3APXA 5IO6A 1OEEA 3FENA 1NJIG 4O4SA 4O3XB 1Q86G 3NQ3A 1YP6A 1SY1A 4I3CA 5HTEA 3I55E 4HWMA 4CPHA 5IXGA 2MHDA 2RTDB 2RTOB 2RTGB 3P6FA 4YFPA 1YHQE 4N7CA 1W6FA 1OPAA 3FA8A 3B2IA 4Y0RA 4N7DA 2RQ0A 5H8TA 2RTQB 1JJJA 2UYWA 3BRNA 1N8RG 4LKPA 5KIDA 4FQBB 4AZMA 4WFBE 2BSZA 1VWHB 1AVEA 3EW1A 1OSPO 1PMPA 3E3CA 1Y55X 1VWFB 1SLFB 4HPCA 3NR3A 1K3BA 2RTHB 3KVNA 2RA6A 4UU3A 1VQ7E 4OS8A 1X89A 5LJKA 4AZNA 5HCCC 3O22A 2ZJQE 5BVSA 4EQAC 3CPWE 3CF5E 5CYBA 1YWAA 2RTNB 1M1KG 3FLLA 4YH0A 3ZUIA 2C1SA 1T68X 4HFOA 1UYOX 3CCVE 1LELA 4QYNA 4BX7A 4O3ZA 4Z2PA 2IZCB 5H9KA 1SWOA 3CC2E 4GKCA 2MO5A 1UREA 3KZAA 1S2PA 3UEWA 4GU8A 4GJSA 3BX8A 1SWNA 2QCBA 2K23A 2ACOA 1LNMA 3FR2A 1BWYA 4IMNA 1YJWE 1VWJB 4WFNE 3FYFA 3CBCA 1VQ9E 1NBXA 3EW2A 3RE5A 3HOLA 2GJ5A 1QY1A 3B2LA 2MWHA 4Z2OA 3WZOA 3WZQA 4ARHA 2L5PA 1LCWA 1I78A 5FQ6E 3C77X 2DJGA 3KFGA 2RTLA 1E2TA 2WEWA 1A3YA 1SWRA 1S7DA 1XKIA 1MX7A 1PEEA 1VWBB 1PBOA 3U9PC 5JVGE 3CCQE 2OY8A 2FS6A 3NX2A 3T6LA 3CMPA 1HY2A 1QFTA 4XMCA 2IZFB 1STPA 3AEHA 4IOCE 1EQDA 3LTWA 4HPDA 2X4MA 2X8TA 4U9CA 1SA8A 3OW2E 4MEEA 2EU7X 1K24A 1SXYA 4QZUA 2L68A 2VFCA 2I5VO 3MG5A 2RCQA 1VQOE 2OFRX 2ANSA 1U0XA 2I5ZO 4KH8A 4ORUA 1SXWA 2ACPX 2ZAGA 4WBKA 4ZGFA 5AJCA 3ELZA 3NQ9A 4NYQA 4GDZA 4EFGA 4QAEA 3RDOA 3CCJE 1LIEA 1LKEA 1DFVA 2LB6A 4KC8A 2GTLO 5L8IA 3V8UA
chains in the Genus database with same CATH topology
2I5ZO 5B11O 1RJLC 2PI3O 2OL7A 5B2AO 3EC5A 1OSPO 2FKGA 3IG9A 2AF5A 1P4PA 2FKJA 2OL8O 1FJ1E 3CKFA 2OY8A 3AUMO 2OY7A 2OY1O 2OL6O 2HKDA 5B3MO 2I5VO 3IGEA 2OYBO 3CKGA 2OY5O 2G8CO 5B10O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5Z O;  5B11 O;  2PI3 O;  2OL7 A;  5B2A O;  3EC5 A;  1OSP O;  2FKG A;  2AF5 A;  1P4P A;  2FKJ A;  2OL8 O;  1FJ1 E;  3CKF A;  2OY8 A;  3AUM O;  2OY7 A;  2OY1 O;  2OL6 O;  2HKD A;  5B3M O;  2I5V O;  2OYB O;  3CKG A;  2OY5 O;  2G8C O;  5B10 O; 
#chains in the Genus database with same CATH topology
 3EM0 A;  3B2H A;  1DZK A;  1JMX A;  3P6C A;  1AB0 A;  4TNN A;  1TOU A;  1RXH A;  3CCL E;  4U8U M;  2GTL N;  4O3W A;  5D48 A;  4GRJ A;  1Q82 G;  4ZR2 A;  4FBO A;  3QKG A;  1LUQ A;  3X00 A;  1D2U A;  1BSY A;  1NC9 A;  1UYN X;  1GKA B;  1N7Y A;  2BS6 A;  4YBP A;  1HMS A;  1MDC A;  1BSQ A;  2IZE B;  5IRW A;  3T2W A;  3P6E A;  1GT1 A;  2CZU A;  5HZ8 A;  1IFB A;  1OEJ A;  5L3Y A;  1MEP A;  3I0A A;  2HYS A;  1PM1 X;  1N9Y A;  3O2Y A;  4TLJ A;  2L9C A;  3FEK A;  3WXQ A;  2CBS A;  1QFV A;  1SRJ A;  4DNE A;  2A0A A;  1VQL E;  5DM6 E;  3STK A;  3VU1 A;  2BS5 A;  4D6B A;  1BRP A;  1NGL A;  1GX9 A;  2OL8 O;  3RY1 A;  1DZM A;  2KD2 A;  4PJ2 A;  1JJX A;  4XMD A;  1SWS A;  3S26 A;  4YDB A;  1EI5 A;  2W2A A;  4ID2 A;  4YGH A;  2IZA A;  2ASN X;  3SZI A;  5JR8 A;  3OBL A;  4QRL A;  1YWB A;  4MVL A;  4GGZ A;  2RTA A;  5AQ6 A;  4TKJ A;  3VG3 A;  4ZH9 A;  1LCV A;  2CM4 A;  1YUP A;  3FA6 A;  4ORR A;  3AKM A;  2PI3 O;  2OVS A;  2ALL X;  2VFB A;  1CBS A;  3NQK A;  1SRI A;  4IOA E;  4IAW A;  4I60 A;  1U18 A;  2QM9 A;  3PIP E;  1YWC A;  1FJ1 E;  3MX7 A;  5B27 A;  2OTL E;  1S44 A;  4AW8 A;  3G4S E;  1KQW A;  4BCS A;  1B56 A;  1GGL A;  4TKH A;  5HCD C;  1KC8 G;  4K19 A;  4JGL A;  4BJ8 A;  3VG4 A;  1VQK E;  2Y32 A;  1X8O A;  5HZ9 A;  2BHV A;  4YFR A;  4KCA A;  5AEO A;  4L1N A;  5HA0 A;  2FT9 A;  1BEB A;  1ERB A;  2G79 A;  2BC3 A;  5HZQ A;  5FAZ A;  1VQM E;  1JQP A;  4GD9 A;  1B0O A;  2QO4 A;  5LJD A;  2LA7 A;  4IMO A;  1MX8 A;  1QVF E;  3TGA A;  2ZJP E;  3UAQ A;  3ZW2 A;  1QVG E;  3CCU E;  3D95 A;  1DV9 A;  1ICM A;  1W5R A;  3P6D A;  5GAD G;  3PPT A;  3S5X A;  3P6H A;  1DZJ A;  4I6S A;  4NYR A;  4A60 A;  1Y9T A;  1N4J A;  2WEX A;  1SWK A;  1W4T A;  4OMW A;  1ACD A;  3EBW A;  1R0U A;  1E06 A;  3G71 E;  2F09 A;  4U3Q A;  3JSQ A;  3G7X A;  1G7N A;  1N43 A;  3CCR E;  4ZFX A;  2WPU A;  3DSZ A;  2ZSC A;  2OVE A;  5HA1 A;  2QA4 E;  3N91 A;  5FQ7 E;  4O9S A;  3FMZ A;  2Q39 A;  3KFI A;  1LID A;  1LCZ A;  4LKT A;  4DQ3 A;  4I9S A;  1HMT A;  2HKD A;  1JIW I;  3B2K A;  1RST B;  1PTS A;  4ZGU A;  2NNQ A;  2QMI A;  4WHI A;  1ZRY A;  2IZK A;  4EDE A;  3UEX A;  3JQO A;  4CK4 A;  4WCE E;  3G6E E;  1YJN E;  5HZ6 A;  1MK5 A;  3WJF A;  1I9H A;  4OS3 A;  2RN4 A;  2FWV A;  1KOI A;  2G78 A;  2X8F A;  1BLR A;  1VWM B;  4QYP A;  1VWL B;  1VQ8 E;  5EED A;  1CBQ A;  1VWD B;  4I3B A;  4O3Y A;  2AT6 X;  1HBP A;  2JMB A;  4M6S A;  1Y53 X;  3RDS A;  2O62 A;  5GAG G;  3RKG A;  4M7M A;  3HWE A;  2IZG B;  1LFO A;  1OEK A;  3RSW A;  5GAE G;  3ZW1 B;  2BLG A;  4L3R A;  3WZN A;  1AQB A;  4OKA A;  4UY8 G;  5AJB A;  1VWC B;  5HCE C;  3WJE A;  1FEL A;  2IZD B;  3OJY C;  1VWP B;  5K06 A;  1EII A;  3APV A;  2BT9 A;  1KT4 A;  1X8Q A;  2RTR B;  2GC9 A;  3BX7 A;  4BX6 A;  1WUB A;  1HN2 A;  2RTP B;  3PK2 A;  4YCE A;  4WF9 E;  1RJL C;  4QGV A;  3RDX A;  2WSJ A;  2OY7 A;  2XKL A;  2A8G A;  3IGE A;  3DLL E;  1LF7 A;  1RXJ A;  4AZP A;  4CPE A;  4ALB A;  4O4X A;  1SRG A;  4YDA A;  4BX5 B;  2OL7 A;  4IB9 A;  2RTM A;  2M4L A;  2CQL A;  5BYP A;  2NNE A;  4Z27 A;  2OFM X;  4I95 A;  3GE2 A;  2IZJ A;  3PP6 A;  3PQU A;  2VDF A;  1A2D A;  3RDQ A;  1OPB A;  3H3I A;  3CCE E;  3STM X;  4ZHC A;  4ORX A;  1SWF A;  1YIT E;  2X45 A;  1E5P A;  4MVI A;  1P6P A;  4QNI A;  1RLB E;  1GT5 A;  2R56 A;  5KIC A;  1SWQ A;  2OL6 O;  2R73 A;  2A13 A;  5DG4 A;  2OYB O;  1YJ9 E;  2JU3 A;  2CM9 A;  4CDF A;  1K8A G;  5H9N A;  1MM9 A;  5B2A O;  2Z4I A;  1TW4 A;  1HQQ A;  1B4M A;  2QOS C;  2FRS A;  1STR B;  3HWF A;  5LJC A;  5JD2 A;  1HQP A;  4ZHD A;  5D45 A;  2FLJ A;  1LIC A;  3L4R A;  2MF6 A;  1S72 E;  4TJZ A;  1ZNG A;  1P4P A;  5DPQ A;  2MJI A;  4GE1 A;  4OS0 A;  1KFF A;  3FA7 A;  5GAH G;  1JMZ A;  2FR3 A;  3T6F A;  1VQN E;  4MIS A;  2RTF B;  3VHM A;  1N0S A;  4GNW A;  4CPH B;  2JOZ A;  2RTB B;  3JS1 A;  2FKG A;  1HMR A;  1SWB A;  4O49 A;  5B5G A;  4I9R A;  4INN A;  4Y59 A;  1KL5 A;  5B3M O;  2WQ9 A;  2QEX E;  1VQ6 E;  3D97 A;  3PIO E;  1YI2 E;  3S5V A;  1U17 A;  2A5C A;  1GX8 A;  3NAD A;  3WJB A;  2OVD A;  3SOT A;  2HZQ A;  3UEV A;  4LZV A;  3FW5 A;  3WYQ A;  3FA9 A;  5L8O A;  3VG7 A;  5LJH A;  2YG2 A;  2AVI A;  3CC4 E;  1RAV A;  1GX3 A;  2GTL M;  2OFA A;  1YIJ E;  4EKV A;  1JJU A;  2IZB A;  5LJG A;  1KL4 A;  3ZWE A;  4AZQ A;  1LIB A;  4NV7 A;  1RXK A;  2F01 A;  4GGT A;  4YGG A;  3QQ2 A;  5FFH A;  5IRA A;  4IO9 E;  1SWC A;  5F2B A;  1NP4 A;  2NP1 A;  4CDD A;  3ELX A;  1KT3 A;  3WJD A;  1O1U A;  1SWH A;  3FID A;  1ZNE A;  2JN3 A;  4ALO A;  3HOE A;  1SWT A;  2CAM A;  3EC5 A;  3ZW0 B;  5CSE A;  4FGI B;  4CDC A;  5D47 A;  3EYC A;  1ZND A;  5L8N A;  3F6Z B;  1RSU B;  4GZV A;  1ICN A;  3BLG A;  1VWQ B;  4TKB A;  4U67 E;  1VYG A;  1TOW A;  1BJ7 A;  5FQ8 E;  4ORW A;  5K68 A;  1GM6 A;  3FIQ A;  4IRW A;  3BU1 A;  3BDR A;  2RTK A;  2WWP A;  4NLI A;  3TGC A;  2AT0 X;  2WQA E;  4WFV A;  3ZW1 A;  1OBP A;  4IBA A;  3U0D A;  1VWG B;  1EPB A;  4YFQ A;  3RE6 A;  4ORY A;  3BSZ E;  2Q4N A;  4WFA E;  3IFB A;  3ZI8 A;  4UU2 A;  4ZHG A;  3Q34 A;  4NP1 A;  4XMG A;  4Y0Q A;  3FEL A;  5IO5 A;  4RUU A;  2JGS A;  3UEU A;  4AZR A;  3WOV A;  3RWX A;  2RCT A;  1H91 A;  4GUZ A;  4AZO A;  1N9M A;  3HWG A;  3CQN A;  4GNY A;  2CBR A;  4ML7 B;  2RTJ A;  3C76 X;  5LJE A;  1KZX A;  1JV4 A;  1XCA A;  3FEP A;  3OE3 A;  2GH7 A;  4CPF A;  5H9A A;  1YIV A;  2IZI A;  3GAQ A;  2NND A;  3SLJ A;  4JHQ A;  3TF6 A;  1E00 A;  4YBU A;  1LDQ A;  1VQ5 E;  1VWE B;  2AT8 X;  2X32 A;  4DCB A;  4AYH A;  3C78 X;  3NX1 A;  2FS7 A;  4YKO A;  4COT A;  3BU9 A;  1FTP A;  1ZNH A;  3SLT A;  2A2G A;  5EDB A;  4FBV A;  1QAB E;  2FTB A;  1IKE A;  4C5P A;  1AEL A;  4BBO A;  4IB6 A;  1HXL A;  2HNX A;  4YCH A;  2E4J A;  4ODD A;  1BRQ A;  2Y3F A;  1SY3 A;  1JYJ A;  1QY0 A;  3U03 A;  2RTE B;  1NP1 A;  2LKK A;  1VWR B;  5F6B A;  4O4U A;  5HZ5 A;  1JYD A;  1SRE A;  2FR2 A;  4CDE A;  5CHK A;  4OMX A;  5IRU A;  2DJF A;  2QOM A;  4XME A;  2OF9 A;  2G8C O;  4CSB A;  5MLC H;  4YGZ A;  2GTF X;  3HTY A;  3HPE A;  4YVB A;  2C1Q A;  2JU8 A;  1YWD A;  1TXL A;  3EMM A;  2R74 A;  3CC7 E;  4QQ1 A;  4U46 A;  1IJ8 A;  3CKG A;  5F1E A;  3WJC A;  1KT5 A;  4MVK A;  1AVG I;  1K9M G;  4IB8 A;  4ORS A;  1Q81 G;  3APW A;  5EDC A;  2AL0 X;  4IAX A;  1VQ4 E;  2G5L A;  1LIF A;  2RD7 C;  3CCM E;  4GGR A;  3BY0 A;  4DQ4 A;  3CMA E;  1A18 A;  1CJ5 A;  3KQ0 A;  4TQ2 A;  1ADL A;  5JVH E;  1SRH A;  1LPJ A;  3TZS A;  4NNT A;  1FEM A;  3WBG A;  1X71 A;  1SWG A;  1ZNL A;  3VGW A;  1CRB A;  4B55 A;  1OBQ A;  3NPO A;  2FHN X;  1SWU A;  3BS2 A;  3EBK A;  1VWO B;  3IG9 A;  1ZNK A;  3P02 A;  3RBY A;  5DM7 E;  2RTI B;  3AUM O;  1G5W A;  3NBX X;  1GKA A;  1KL3 A;  2CZT A;  2LBA A;  1CBR A;  1FDQ A;  2OY5 O;  5LKF A;  1FE3 A;  1YP7 A;  5AN9 B;  3T2X A;  4FBR A;  3FDC A;  1VYF A;  1T8V A;  3VHH A;  4OEM A;  5B5F A;  5F58 A;  2FHL A;  2Z4H A;  1I05 A;  2X55 A;  5LJB A;  4NW4 A;  2K62 A;  4QGW A;  1SWE A;  2XST A;  3D96 A;  4PSQ A;  3HWD A;  5K67 A;  3ZW0 A;  1VYO A;  4BQU A;  5F7G A;  4GJV A;  4Y0P A;  3VHI A;  3ZQ3 A;  2KTD A;  1KT6 A;  3AKN A;  3D9W A;  3VG2 A;  1CBI A;  1IKJ A;  4JO6 A;  2FKJ A;  1VWA B;  1Y0G A;  3P6G A;  3WZP A;  4KT5 A;  2HMB A;  3CWK A;  1Y52 X;  4GH7 A;  1M90 G;  2POA A;  4OEL A;  1SWD A;  5EPQ A;  2X8S A;  3B2J A;  1HBQ A;  4ES7 A;  3IA8 A;  3VG5 A;  3CME E;  4R0B A;  1I06 A;  1KZW A;  3HK1 A;  1NQN A;  4HPA A;  2LBV A;  5EZ2 A;  4JNJ A;  2OY1 O;  3APU A;  3F9D A;  4XMF A;  1VWK B;  1VWI B;  1EUO A;  1OBU A;  1GT3 A;  3MM0 A;  5HTD A;  4D6A A;  1QY2 A;  4KII A;  3CXC E;  1PBY A;  3VG6 A;  4YMY A;  3VE1 A;  1SXU A;  1BSO A;  2C4I A;  1X8P A;  3DTQ A;  5BVQ A;  4Z2V A;  1VWN B;  3PQS A;  2AF5 A;  3S60 A;  1MOY A;  2Q2P A;  3CD6 E;  1T0V A;  2IFB A;  1I04 A;  1EW3 A;  4IAB A;  1SRF A;  1RBP A;  3D4R A;  5EEE A;  4MIR A;  2HLV A;  4ZJ0 A;  3TGB A;  5H1S I;  3KFH A;  4LQZ A;  2ZJR E;  1B8E A;  4U8U O;  4RUN A;  5FEN A;  4I3D A;  1EPA A;  2ZAI A;  1HXZ A;  3NP1 A;  1SMP I;  2L67 A;  1ERX A;  1KXO A;  2QO6 A;  3CCS E;  1MUP A;  3PEC A;  4U8U N;  1ALB A;  1NQM A;  2KT4 B;  2Q9S A;  1IIU A;  2W2F A;  4A1Y A;  3LHN A;  1JJ2 E;  3SAO A;  4EEJ A;  3LV4 A;  2IZH B;  3FR5 A;  1L6M A;  4NNS A;  4BX6 B;  5D4A A;  1KGL A;  2QO5 A;  2OTJ E;  1Z24 A;  1DC9 A;  1SWA A;  4ON1 A;  4MVE A;  1WBI A;  3I56 E;  2KW1 A;  1IFC A;  1KQS E;  4GDA A;  5B29 A;  4BOE A;  3I17 A;  4Y5D A;  4BX7 B;  3SZJ A;  4BGF A;  2IZL B;  1BBP A;  3MBT A;  1TVQ A;  2DM5 A;  1E02 A;  4BVM A;  5HAE A;  3PED A;  1X8U A;  5BVT A;  4QZT A;  3F8A A;  2PY1 A;  3OD9 A;  2AMM X;  1QG5 A;  1ML7 A;  1DF3 A;  1EIO A;  2P8G A;  3RDM A;  1KT7 A;  1NDJ A;  2OZQ A;  2RTC B;  1QQS A;  3MVF A;  3FR4 A;  2X34 A;  4WFU A;  1SY2 A;  1AVD A;  1DF8 A;  1SWL A;  1SWJ A;  2OVA A;  1KD1 G;  1SLE B;  1SWP A;  1K73 G;  3RDU A;  5B11 O;  1QWD A;  2OFB A;  1EXS A;  5F6Z A;  4LZU A;  2AT5 X;  5LKE A;  1MVG A;  2W2B A;  1D3S A;  2G7B A;  2Q2M A;  1O1V A;  2JW1 A;  1SLG B;  4KC7 A;  3WVM A;  2HZR A;  3SLO A;  2KTS A;  5HBS A;  4O4O A;  3CQR A;  3WYP A;  5HL7 E;  3CBS A;  1W2B E;  5H9L A;  4ZHF A;  1A57 A;  1Q7Y G;  3WJG A;  1Y9L A;  2UZ2 A;  3CR6 A;  3RZY A;  3P24 A;  1SXX A;  1UZ2 X;  1VQP E;  5HWZ A;  1DZP A;  3VE2 A;  5B10 O;  2WUT A;  2N93 A;  4YKM A;  1JBH A;  3STN A;  4BX5 A;  3FW4 A;  2WR6 A;  5C0N A;  2YMS A;  1FEN A;  3KFF A;  4NLJ A;  2Y3E A;  3PH5 A;  4ZCB A;  4HPB A;  1JZU A;  5KHP A;  3PH6 A;  2X46 A;  4NV8 A;  2JU7 A;  3CKF A;  4GET A;  2FGS A;  3VPJ E;  4QGX A;  2OF8 A;  5IO7 A;  1SY0 A;  1BM5 A;  3J7Z G;  1LDO A;  4XMH A;  3RY2 A;  4EXZ A;  4Y0S A;  3ZUO A;  4CV7 A;  4CPI A;  3T1D A;  1GT4 A;  4GK9 A;  3K3L A;  4Z6J A;  2X56 A;  2A5B A;  3SZH A;  1I4U A;  4A8Z A;  1X8N A;  2LFO A;  1EAL A;  1G74 A;  5D8J A;  5CE4 A;  2F73 A;  1SLD B;  1KQX A;  2AT3 X;  2A2U A;  2MM3 A;  4ZHH A;  1RL6 A;  1VPR A;  4IB7 A;  4ZH6 A;  2AH7 X;  1O8V A;  2A3F X;  1STS B;  1GXA A;  1G85 A;  3O19 A;  3ZZV A;  2AKQ A;  1IW2 A;  3PDF A;  3Q6L A;  4A1H A;  4Z28 A;  3APX A;  5IO6 A;  1OEE A;  3FEN A;  1NJI G;  4O4S A;  4O3X B;  1Q86 G;  3NQ3 A;  1YP6 A;  1SY1 A;  4I3C A;  5HTE A;  3I55 E;  4HWM A;  4CPH A;  5IXG A;  2MHD A;  2RTD B;  2RTO B;  2RTG B;  3P6F A;  4YFP A;  1YHQ E;  4N7C A;  1W6F A;  1OPA A;  3FA8 A;  3B2I A;  4Y0R A;  4N7D A;  2RQ0 A;  5H8T A;  2RTQ B;  1JJJ A;  2UYW A;  3BRN A;  1N8R G;  4LKP A;  5KID A;  4FQB B;  4AZM A;  4WFB E;  2BSZ A;  1VWH B;  1AVE A;  3EW1 A;  1OSP O;  1PMP A;  3E3C A;  1Y55 X;  1VWF B;  1SLF B;  4HPC A;  3NR3 A;  1K3B A;  2RTH B;  3KVN A;  2RA6 A;  4UU3 A;  1VQ7 E;  4OS8 A;  1X89 A;  5LJK A;  4AZN A;  5HCC C;  3O22 A;  2ZJQ E;  5BVS A;  4EQA C;  3CPW E;  3CF5 E;  5CYB A;  1YWA A;  2RTN B;  1M1K G;  3FLL A;  4YH0 A;  3ZUI A;  2C1S A;  1T68 X;  4HFO A;  1UYO X;  3CCV E;  1LEL A;  4QYN A;  4BX7 A;  4O3Z A;  4Z2P A;  2IZC B;  5H9K A;  1SWO A;  3CC2 E;  4GKC A;  2MO5 A;  1URE A;  3KZA A;  1S2P A;  3UEW A;  4GU8 A;  4GJS A;  3BX8 A;  1SWN A;  2QCB A;  2K23 A;  2ACO A;  1LNM A;  3FR2 A;  1BWY A;  4IMN A;  1YJW E;  1VWJ B;  4WFN E;  3FYF A;  3CBC A;  1VQ9 E;  1NBX A;  3EW2 A;  3RE5 A;  3HOL A;  2GJ5 A;  1QY1 A;  3B2L A;  2MWH A;  4Z2O A;  3WZO A;  3WZQ A;  4ARH A;  2L5P A;  1LCW A;  1I78 A;  5FQ6 E;  3C77 X;  2DJG A;  3KFG A;  2RTL A;  1E2T A;  2WEW A;  1A3Y A;  1SWR A;  1S7D A;  1XKI A;  1MX7 A;  1PEE A;  1VWB B;  1PBO A;  3U9P C;  5JVG E;  3CCQ E;  2OY8 A;  2FS6 A;  3NX2 A;  3T6L A;  3CMP A;  1HY2 A;  1QFT A;  4XMC A;  2IZF B;  1STP A;  3AEH A;  4IOC E;  1EQD A;  3LTW A;  4HPD A;  2X4M A;  2X8T A;  4U9C A;  1SA8 A;  3OW2 E;  4MEE A;  2EU7 X;  1K24 A;  1SXY A;  4QZU A;  2L68 A;  2VFC A;  2I5V O;  3MG5 A;  2RCQ A;  1VQO E;  2OFR X;  2ANS A;  1U0X A;  2I5Z O;  4KH8 A;  4ORU A;  1SXW A;  2ACP X;  2ZAG A;  4WBK A;  4ZGF A;  5AJC A;  3ELZ A;  3NQ9 A;  4NYQ A;  4GDZ A;  4EFG A;  4QAE A;  3RDO A;  3CCJ E;  1LIE A;  1LKE A;  1DFV A;  2LB6 A;  4KC8 A;  2GTL O;  5L8I A;  3V8U A; 
#chains in the Genus database with same CATH homology
 2I5Z O;  5B11 O;  1RJL C;  2PI3 O;  2OL7 A;  5B2A O;  3EC5 A;  1OSP O;  2FKG A;  3IG9 A;  2AF5 A;  1P4P A;  2FKJ A;  2OL8 O;  1FJ1 E;  3CKF A;  2OY8 A;  3AUM O;  2OY7 A;  2OY1 O;  2OL6 O;  2HKD A;  5B3M O;  2I5V O;  3IGE A;  2OYB O;  3CKG A;  2OY5 O;  2G8C O;  5B10 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...