2I5ZO

The crystal structure of ospa mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
246
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKANEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title Hydrophobic surface burial is the major stability determinant of a flat, single-layer beta-sheet.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags De novo protein
total genus 49
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2006-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2i5zO01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2i5zO02
2PI3O 2OL8O 2FKJA 5B2AO 5B3MO 5B10O 2AF5A 2OL6O 2OY5O 1FJ1E 2OY1O 2HKDA 3CKGA 1P4PA 2I5VO 3EC5A 2OYBO 2OY7A 2OL7A 3CKFA 2G8CO 3AUMO 1OSPO 2FKGA 2OY8A 2I5ZO 5B11O
chains in the Genus database with same CATH superfamily
3FR5A 1ZNGA 2X8SA 1NQMA 1YUPA 3FEPA 4ORRA 4N7CA 1B4MA 4NV7A 2A2UA 5HZ8A 2ZJQE 1SRJA 1VQKE 1KC8G 5CHKA 3CMEE 1N43A 3E3CA 4PSQA 4NYRA 1H91A 3SZHA 3CMAE 1VQ5E 1YWBA 3WJDA 2ACPX 1YIJE 5HL7E 2IZDB 3P6DA 2R56A 2BSZA 3PDFA 4JNJA 4BX5B 2RCQA 3HPEA 4ZGUA 4NLJA 4NNTA 1SWSA 1GX9A 2Q39A 4QZUA 2M4LA 1HXLA 1IW2A 4ES7A 2WWPA 2LBAA 1SWLA 1NJIG 5AN9B 5LKEA 4CSBA 4YFPA 2JN3A 2W2AA 2GTLM 3VE2A 2ZJPE 2QO6A 2A5CA 2CQLA 1PMPA 5F58A 4U9CA 2OY8A 1EW3A 1HN2A 5HBSA 4DCBA 4YMYA 2IZIA 3KFIA 3RDMA 1QFTA 2FTBA 1DF8A 1SY2A 1ALBA 4ZHDA 2IZJA 3MBTA 4N7DA 4CDDA 3RDSA 4O4XA 2Q2PA 2PY1A 2L68A 3JSQA 2RTQB 3U0DA 3VE1A 2CZTA 1OBUA 4ZFXA 4KC7A 3J7ZG 4LQZA 4DQ4A 2RTBB 2G79A 2W2BA 1UYNX 3FIDA 2BLGA 5L8NA 4YBUA 5D4AA 2RTGB 1X8QA 5FENA 5EPQA 3LHNA 5EEDA 5FQ6E 2CAMA 3SZJA 2RTFB 2RTJA 3VHMA 1LNMA 2L9CA 2VDFA 2EU7X 1EI5A 3LTWA 1U18A 3FA8A 1PEEA 3WBGA 4BX7B 1SWOA 1MUPA 5BVTA 4QYPA 4WFUA 2ZAIA 1W2BE 3VG4A 1MEPA 5LJCA 5L8IA 4A60A 4BX6A 2IZLB 2CZUA 1QY1A 3NPOA 3WZNA 4UY8G 2HYSA 4QGWA 4MVLA 3NX2A 1HXZA 2RTLA 4MIRA 5H9KA 1VQME 4GGTA 5AJBA 3APWA 4JGLA 2I5VO 4AW8A 4WHIA 3HWGA 3PEDA 3WZQA 3D97A 1JZUA 4OS3A 5F6BA 3BX8A 2BC3A 4FQBB 1S2PA 4U67E 4INNA 5IRAA 4XMGA 5HTEA 1SXUA 1W4TA 2A5BA 1EXSA 3WZPA 1U0XA 4RUUA 3APUA 4L3RA 1UZ2X 3RBYA 2OVAA 2BS6A 2ZAGA 4GETA 1W5RA 4D6BA 1LFOA 2X55A 4NLIA 1RLBE 4AZMA 2OVEA 4YDAA 2HKDA 2AT6X 4O4SA 3T6LA 1AVEA 1G85A 1IFCA 4CPIA 3S60A 1OBQA 1LDQA 1CBSA 1T8VA 1SMPI 2VFBA 5H9NA 3NBXX 1VWJB 3ZI8A 3CC4E 3ZW0A 1SWKA 3BSZE 1Y55X 3D96A 3WJCA 3P6GA 1KOIA 4MISA 4CPHB 5IO7A 1SRIA 1BEBA 2GTLO 4AYHA 1QFVA 1FJ1E 4QZTA 4GNYA 3FIQA 3D9WA 2RA6A 4ZHHA 2HZQA 4NP1A 2NNEA 2Q4NA 3CKGA 3B2JA 3I55E 2G7BA 2NNQA 2Y3EA 1Y53X 4WF9E 3T6FA 2RTEB 4Y0RA 3CC2E 3HWFA 2FR2A 2BT9A 5H1SI 3MX7A 5B11O 3CCVE 5FQ7E 5HZQA 2RTCB 3V8UA 1D3SA 4U8UN 1KL4A 2JOZA 3OBLA 2G5LA 3UEVA 2RN4A 5B5FA 2IZHB 2AMMX 5MLCH 1N8RG 2X46A 1DZPA 1MVGA 3S5XA 3VU1A 4XMDA 4XMFA 3T2XA 3G7XA 3EW2A 4HPBA 5D45A 3HOLA 2ACOA 2RTHB 4QGXA 2UYWA 2WSJA 2LBVA 3Q6LA 1CRBA 4ORWA 2X8TA 1G74A 2FKGA 4YFQA 1BWYA 5HA1A 3OJYC 4TJZA 2WUTA 2KT4B 2WR6A 2F73A 4GNWA 5KHPA 4OEMA 3RDXA 1PBOA 2RQ0A 1GGLA 2I5ZO 1NDJA 1AELA 5CE4A 3FA7A 4YKMA 1SWBA 4ZCBA 4Z28A 1N9MA 2QO5A 5HCEC 2X45A 1OBPA 2KTSA 4CPFA 2QEXE 1X71A 1YWAA 4O49A 3OD9A 1LPJA 1P4PA 1ACDA 2BS5A 1RXJA 1PM1X 1NP4A 1VWCB 1JQPA 3CPWE 4M7MA 4ZHGA 3P02A 1TW4A 1SLDB 3FA9A 1KQWA 1DF3A 1K73G 3KFGA 1VQ9E 1EPAA 3VG7A 2Q2MA 3ZW2A 4Z27A 1VWOB 3AEHA 3O19A 1S7DA 1O8VA 4AZQA 4O3XB 1GT4A 2PI3O 2FKJA 1IIUA 1BRQA 3G4SE 1LIFA 2WQAE 1PTSA 4WCEE 4IRWA 3ZW1B 3NADA 5EDBA 5FAZA 3SLJA 3P6FA 4IAXA 1M90G 3HWEA 1SXYA 1Q7YG 4YBPA 1KL3A 1EIOA 2OL8O 1GX3A 2NP1A 1KT4A 2MM3A 1GT5A 1VWFB 4K19A 4U8UM 2IZBA 3VGWA 3HWDA 1YJWE 4O3YA 3NX1A 5H8TA 3B2IA 5K67A 1VPRA 1JBHA 4C5PA 3BU1A 1VWDB 3FENA 4YDBA 5LJGA 5HCCC 1GT3A 2F01A 1G5WA 1SWNA 3CCLE 1VQ8E 1ERXA 3K3LA 4LZUA 3S26A 2FRSA 2IZEB 3WXQA 1YJ9E 1JV4A 3CKFA 1UYOX 1SWJA 1LIDA 1VQ7E 1VQ4E 3RY2A 1I05A 3OE3A 4ALOA 4TNNA 1QVGE 1Q81G 2OY1O 2A3FX 1NQNA 1M1KG 3DLLE 5DG4A 1EALA 5K06A 3RE6A 1LUQA 5GAHG 1KT3A 4CV7A 4IABA 2K62A 3WZOA 3TZSA 1KQXA 1X8NA 1S44A 1DC9A 1K3BA 1GM6A 3RSWA 1N7YA 1BBPA 3RKGA 4LZVA 3KQ0A 2IFBA 2Y3FA 3UAQA 1JYDA 1N9YA 1S72E 5AEOA 3VHHA 3CC7E 1Y0GA 3MG5A 4FGIB 1DFVA 4OELA 4XMEA 4YCEA 3O2YA 3TGAA 1B8EA 1DZMA 1JIWI 1X8UA 4IAWA 4DNEA 3CR6A 4BBOA 5CYBA 2FGSA 2BHVA 5F2BA 1YI2E 3PH5A 1K9MG 3CQNA 3RDOA 1IJ8A 3SLOA 4A8ZA 1SWAA 5DM6E 5B27A 2OF8A 3VG2A 2A2GA 2P8GA 2YG2A 5IRWA 2LKKA 5DM7E 3GE2A 4Z2PA 2AT0X 3IGEA 2L67A 1LDOA 2RTRB 1QY0A 2IZKA 3F9DA 3U03A 2RTOB 1K24A 4ZHFA 2MO5A 2IZFB 1YJNE 2RTAA 2JU8A 4OMXA 2OTJE 3GAQA 4HFOA 2ZSCA 1MK5A 1VWHB 2AT5X 1RBPA 3BLGA 1JJXA 2OY5O 1KL5A 1SWHA 2GJ5A 4BX6B 4B55A 2XKLA 4GKCA 2OVSA 3T1DA 5HAEA 2LB6A 1GKAA 1ZRYA 4U8UO 4EDEA 3CMPA 3IA8A 4IMNA 3ZUOA 4OS0A 4Z6JA 1LCZA 1LIBA 5IRUA 2KW1A 1O1VA 3ELZA 3I56E 1E02A 3P6HA 1VYOA 2R73A 4IOCE 1CJ5A 1KFFA 2HNXA 2IZGB 5LKFA 2VFCA 4DQ3A 1ZNLA 2OTLE 1GX8A 1RSUB 1VWPB 4AZPA 1MDCA 3NQKA 2AF5A 4TKHA 2X8FA 1BSOA 1Q86G 4FBOA 1IKJA 2E4JA 1ZNKA 3VG6A 3FEKA 4IB7A 4ARHA 4PJ2A 2AKQA 2DJGA 4KT5A 1SA8A 1FENA 4CK4A 3FW5A 5EDCA 3MM0A 1OEKA 1A18A 2AH7X 3ZW0B 3PQSA 5L8OA 3QKGA 5JD2A 1JMXA 3NQ3A 5CSEA 2OY7A 4WBKA 3STNA 3BS2A 1VWQB 4OKAA 4CDEA 1SWQA 3KFHA 1EIIA 2OF9A 2DJFA 4BVMA 1ERBA 1JJJA 5GADG 1HY2A 3FR4A 3CCME 4LKTA 2MF6A 3CCRE 1TOUA 4YVBA 1ICNA 1SRHA 1T68X 2RTMA 5HZ9A 5LJBA 1QVFE 3D95A 3HTYA 3PIOE 1QABE 3WYQA 1LIEA 4QRLA 5BYPA 3F8AA 3BDRA 1B56A 1ICMA 3VG5A 3FA6A 3WJGA 1A3YA 4YH0A 5D47A 3HOEA 1K8AG 1GT1A 5B10O 3AKNA 3EW1A 1Y9LA 1SWFA 1AB0A 3OW2E 4IB9A 1FDQA 1TOWA 2QA4E 1Y52X 1LCVA 3WYPA 1SWGA 1Q82G 3SLTA 1STPA 1KT6A 5B29A 3FLLA 3SZIA 2ASNX 2IZCB 2OYBO 2QO4A 2FHLA 4IB6A 5B3MO 2ALLX 4GGZA 4BOEA 2GTLN 1MX7A 1JYJA 4Z2OA 2Z4IA 5B5GA 4TLJA 1R0UA 3FELA 3FR2A 1SWRA 1W6FA 1AVDA 2RTIB 1G7NA 5JVGE 3C78X 1I04A 3G71E 4O3ZA 2QM9A 4O4UA 1MOYA 3BU9A 4EXZA 1LELA 4HPAA 5AJCA 1MM9A 2NNDA 2W2FA 4O4OA 2AVIA 3DTQA 3CD6E 2RTPB 2GH7A 4QYNA 3BRNA 5IO5A 4YKOA 4WFNE 4QAEA 2LFOA 3PIPE 3IFBA 2OFAA 2RTKA 4GK9A 1AQBA 4CDFA 4ZGFA 4R0BA 3SAOA 2FLJA 4A1HA 4ODDA 1ZNHA 3O22A 5HZ5A 1YHQE 5F7GA 1JMZA 2JU7A 4GH7A 4WFVA 1VWRB 5L3YA 1DZJA 2DM5A 3NQ9A 3MVFA 1XKIA 4I3BA 3G6EE 1MX8A 5GAEG 2Z4HA 1E06A 1O1UA 2QOSC 4ZH6A 2HLVA 1STSB 4Y0SA 3AKMA 4GDZA 1VWNB 4ZJ0A 1VQPE 1SY0A 2WPUA 1UREA 4KH8A 4YGZA 4IO9E 4ZH9A 1E2TA 3NP1A 3QQ2A 3N91A 4MVEA 4BQUA 4YFRA 1RJLC 3BY0A 1BRPA 3ZZVA 4Y0PA 1FEMA 1VWGB 4BX5A 4L1NA 3JQOA 3F6ZB 3SOTA 2FS6A 1SY1A 2FHNX 1EPBA 3X00A 1BSYA 3CCSE 1D2UA 3EBWA 2RTDB 4AZRA 2IZAA 3CCEE 1SWUA 1A2DA 2X56A 3T2WA 2L5PA 2WQ9A 2GTFX 1N4JA 5FQ8E 1WUBA 4FBRA 1XCAA 2R74A 2OL7A 2JGSA 1GXAA 3AUMO 1OSPO 3IG9A 4QGVA 3L4RA 4GGRA 1TXLA 1NP1A 3VG3A 1QWDA 2CBSA 4ML7B 3CF5E 1Z24A 3CWKA 4AZNA 1I78A 1T0VA 1YWDA 4Z2VA 4A1YA 1BJ7A 1KT7A 2QMIA 1B0OA 1SWCA 4I95A 5EEEA 3STMX 2OZQA 3HK1A 1PBYA 2A8GA 5BVSA 4IBAA 1L6MA 1LF7A 2YMSA 1LKEA 5H9AA 3EC5A 3H3IA 4ORSA 2RD7C 2K23A 3FMZA 2ANSA 1X89A 2LA7A 3FDCA 1HBPA 3ZUIA 1E00A 3APVA 2JW1A 1JJUA 1BLRA 3RDQA 2POAA 3B2LA 1HQQA 5LJEA 1QG5A 1SLEB 4GDAA 2AT3X 5HWZA 1FE3A 5K68A 2N93A 2OVDA 4M6SA 4EFGA 3RWXA 1YP7A 1A57A 3UEWA 4OMWA 1E5PA 3NR3A 3P6EA 4BX7A 2CBRA 5AQ6A 2XSTA 4I60A 4U3QA 1TVQA 2OFRX 4IMOA 1LCWA 3EBKA 2MJIA 4KCAA 1VWLB 3WVMA 3TF6A 5C0NA 1EQDA 4EQAC 4Y0QA 1QQSA 4MVKA 3C76X 4U46A 3FYFA 3P24A 4TKBA 2WEXA 2OFMX 1HMTA 1DV9A 5D48A 3STKA 4TQ2A 2A0AA 4IB8A 5LJDA 5HCDC 4CPEA 1KZXA 1VWIB 2A13A 3CBCA 4OS8A 4D6AA 4UU2A 2CM4A 5EZ2A 2FS7A 1I4UA 1FTPA 2KD2A 1HMRA 2X34A 1CBQA 4CDCA 5IO6A 1VYFA 1YIVA 3RE5A 1VYGA 2ZJRE 2Y32A 1CBRA 1NBXA 1VWMB 1RXHA 5KICA 1GKAB 1EUOA 5FFHA 1NC9A 2G78A 4YGGA 4Y59A 2QCBA 3C77X 4IOAE 1ZNDA 5HTDA 2X32A 2FWVA 4NW4A 4ORYA 4NNSA 4BGFA 1AVGI 4GJVA 2RTNB 1X8OA 3CBSA 1VWBB 2HZRA 4GE1A 1RL6A 4CPHA 1STRB 1JJ2E 4QNIA 2AL0X 3RZYA 2O62A 1KXOA 3PP6A 3UEXA 1HBQA 1U17A 3PPTA 1VWEB 1SRFA 3U9PC 1KQSE 4MVIA 4GZVA 3ELXA 4YGHA 2G8CO 2Q9SA 3PECA 3CCJE 1ML7A 2GC9A 1KD1G 2FR3A 5H9LA 1CBIA 1X8PA 3KZAA 4ORUA 1LICA 1RAVA 2OL6O 3S5VA 3CXCE 1N0SA 3PH6A 1HMSA 5F1EA 4HPCA 4I3CA 5F6ZA 4BJ8A 4ORXA 1KT5A 1OPBA 5LJHA 4Y5DA 3CCQE 4ID2A 4I9SA 1YITE 1QY2A 1SLGB 5HZ6A 5JR8A 3CQRA 4O9SA 5GAGG 3CCUE 3KFFA 4JO6A 3WOVA 4EKVA 1YP6A 4KC8A 2JMBA 1I06A 3DSZA 1KGLA 2X4MA 4HWMA 3LV4A 1OEJA 5LJKA 2QOMA 1WBIA 4GD9A 2MHDA 4ZHCA 4ZR2A 1BM5A 3EMMA 2C1QA 3B2KA 4QQ1A 1NGLA 4I9RA 5IXGA 3PK2A 1ZNEA 1DZKA 1SWEA 1SXWA 3P6CA 1IFBA 1KZWA 3WJBA 1OEEA 1SXXA 1Y9TA 2C1SA 1VWKB 3WJFA 3PQUA 4ON1A 4GU8A 4JHQA 3B2HA 3EYCA 3ZQ3A 2HMBA 3EM0A 1VQ6E 5B2AO 4BCSA 1ADLA 1SWPA 4GJSA 3TGBA 2OFBA 2FT9A 3JS1A 4XMHA 1SWDA 4AZOA 2MWHA 1SREA 4MEEA 4GUZA 2JU3A 1BSQA 1VQLE 5D8JA 1I9HA 1VWAB 5KIDA 2UZ2A 4LKPA 4EEJA 4XMCA 1P6PA 1SWTA 1IKEA 2AT8X 1VQOE 2WEWA 3ZW1A 4I3DA 4WFBE 4NYQA 4I6SA 4ALBA 4WFAE 3I17A 3APXA 3VPJE 4COTA 1SLFB 1RSTB 2C4IA 3BX7A 5DPQA 4NV8A 3FW4A 3WJEA 4TKJA 5BVQA 4KIIA 3RY1A 1FELA 3VHIA 5JVHE 3D4RA 4RUNA 3Q34A 1SY3A 1OPAA 1SRGA 1VQNE 3KVNA 1RXKA 2CM9A 4UU3A 2KTDA 2RCTA 4FBVA 3UEUA 4YCHA 3RDUA 3I0AA 1HQPA 5HA0A 4O3WA 3TGCA 3ZWEA 2F09A 1YWCA 4GRJA 4HPDA
chains in the Genus database with same CATH topology
2PI3O 2OL8O 2FKJA 5B2AO 5B3MO 5B10O 2AF5A 2OL6O 2OY5O 1RJLC 1FJ1E 2OY1O 2HKDA 3CKGA 1P4PA 2I5VO 3EC5A 2OYBO 2OY7A 2OL7A 3CKFA 3IGEA 2G8CO 3AUMO 1OSPO 3IG9A 2FKGA 2OY8A 2I5ZO 5B11O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI3 O;  2OL8 O;  2FKJ A;  5B2A O;  5B3M O;  5B10 O;  2AF5 A;  2OL6 O;  2OY5 O;  1FJ1 E;  2OY1 O;  2HKD A;  3CKG A;  1P4P A;  2I5V O;  3EC5 A;  2OYB O;  2OY7 A;  2OL7 A;  3CKF A;  2G8C O;  3AUM O;  1OSP O;  2FKG A;  2OY8 A;  2I5Z O;  5B11 O; 
#chains in the Genus database with same CATH topology
 3FR5 A;  1ZNG A;  2X8S A;  1NQM A;  1YUP A;  3FEP A;  4ORR A;  4N7C A;  1B4M A;  4NV7 A;  2A2U A;  5HZ8 A;  2ZJQ E;  1SRJ A;  1VQK E;  1KC8 G;  5CHK A;  3CME E;  1N43 A;  3E3C A;  4PSQ A;  4NYR A;  1H91 A;  3SZH A;  3CMA E;  1VQ5 E;  1YWB A;  3WJD A;  2ACP X;  1YIJ E;  5HL7 E;  2IZD B;  3P6D A;  2R56 A;  2BSZ A;  3PDF A;  4JNJ A;  4BX5 B;  2RCQ A;  3HPE A;  4ZGU A;  4NLJ A;  4NNT A;  1SWS A;  1GX9 A;  2Q39 A;  4QZU A;  2M4L A;  1HXL A;  1IW2 A;  4ES7 A;  2WWP A;  2LBA A;  1SWL A;  1NJI G;  5AN9 B;  5LKE A;  4CSB A;  4YFP A;  2JN3 A;  2W2A A;  2GTL M;  3VE2 A;  2ZJP E;  2QO6 A;  2A5C A;  2CQL A;  1PMP A;  5F58 A;  4U9C A;  2OY8 A;  1EW3 A;  1HN2 A;  5HBS A;  4DCB A;  4YMY A;  2IZI A;  3KFI A;  3RDM A;  1QFT A;  2FTB A;  1DF8 A;  1SY2 A;  1ALB A;  4ZHD A;  2IZJ A;  3MBT A;  4N7D A;  4CDD A;  3RDS A;  4O4X A;  2Q2P A;  2PY1 A;  2L68 A;  3JSQ A;  2RTQ B;  3U0D A;  3VE1 A;  2CZT A;  1OBU A;  4ZFX A;  4KC7 A;  3J7Z G;  4LQZ A;  4DQ4 A;  2RTB B;  2G79 A;  2W2B A;  1UYN X;  3FID A;  2BLG A;  5L8N A;  4YBU A;  5D4A A;  2RTG B;  1X8Q A;  5FEN A;  5EPQ A;  3LHN A;  5EED A;  5FQ6 E;  2CAM A;  3SZJ A;  2RTF B;  2RTJ A;  3VHM A;  1LNM A;  2L9C A;  2VDF A;  2EU7 X;  1EI5 A;  3LTW A;  1U18 A;  3FA8 A;  1PEE A;  3WBG A;  4BX7 B;  1SWO A;  1MUP A;  5BVT A;  4QYP A;  4WFU A;  2ZAI A;  1W2B E;  3VG4 A;  1MEP A;  5LJC A;  5L8I A;  4A60 A;  4BX6 A;  2IZL B;  2CZU A;  1QY1 A;  3NPO A;  3WZN A;  4UY8 G;  2HYS A;  4QGW A;  4MVL A;  3NX2 A;  1HXZ A;  2RTL A;  4MIR A;  5H9K A;  1VQM E;  4GGT A;  5AJB A;  3APW A;  4JGL A;  2I5V O;  4AW8 A;  4WHI A;  3HWG A;  3PED A;  3WZQ A;  3D97 A;  1JZU A;  4OS3 A;  5F6B A;  3BX8 A;  2BC3 A;  4FQB B;  1S2P A;  4U67 E;  4INN A;  5IRA A;  4XMG A;  5HTE A;  1SXU A;  1W4T A;  2A5B A;  1EXS A;  3WZP A;  1U0X A;  4RUU A;  3APU A;  4L3R A;  1UZ2 X;  3RBY A;  2OVA A;  2BS6 A;  2ZAG A;  4GET A;  1W5R A;  4D6B A;  1LFO A;  2X55 A;  4NLI A;  1RLB E;  4AZM A;  2OVE A;  4YDA A;  2HKD A;  2AT6 X;  4O4S A;  3T6L A;  1AVE A;  1G85 A;  1IFC A;  4CPI A;  3S60 A;  1OBQ A;  1LDQ A;  1CBS A;  1T8V A;  1SMP I;  2VFB A;  5H9N A;  3NBX X;  1VWJ B;  3ZI8 A;  3CC4 E;  3ZW0 A;  1SWK A;  3BSZ E;  1Y55 X;  3D96 A;  3WJC A;  3P6G A;  1KOI A;  4MIS A;  4CPH B;  5IO7 A;  1SRI A;  1BEB A;  2GTL O;  4AYH A;  1QFV A;  1FJ1 E;  4QZT A;  4GNY A;  3FIQ A;  3D9W A;  2RA6 A;  4ZHH A;  2HZQ A;  4NP1 A;  2NNE A;  2Q4N A;  3CKG A;  3B2J A;  3I55 E;  2G7B A;  2NNQ A;  2Y3E A;  1Y53 X;  4WF9 E;  3T6F A;  2RTE B;  4Y0R A;  3CC2 E;  3HWF A;  2FR2 A;  2BT9 A;  5H1S I;  3MX7 A;  5B11 O;  3CCV E;  5FQ7 E;  5HZQ A;  2RTC B;  3V8U A;  1D3S A;  4U8U N;  1KL4 A;  2JOZ A;  3OBL A;  2G5L A;  3UEV A;  2RN4 A;  5B5F A;  2IZH B;  2AMM X;  5MLC H;  1N8R G;  2X46 A;  1DZP A;  1MVG A;  3S5X A;  3VU1 A;  4XMD A;  4XMF A;  3T2X A;  3G7X A;  3EW2 A;  4HPB A;  5D45 A;  3HOL A;  2ACO A;  2RTH B;  4QGX A;  2UYW A;  2WSJ A;  2LBV A;  3Q6L A;  1CRB A;  4ORW A;  2X8T A;  1G74 A;  2FKG A;  4YFQ A;  1BWY A;  5HA1 A;  3OJY C;  4TJZ A;  2WUT A;  2KT4 B;  2WR6 A;  2F73 A;  4GNW A;  5KHP A;  4OEM A;  3RDX A;  1PBO A;  2RQ0 A;  1GGL A;  2I5Z O;  1NDJ A;  1AEL A;  5CE4 A;  3FA7 A;  4YKM A;  1SWB A;  4ZCB A;  4Z28 A;  1N9M A;  2QO5 A;  5HCE C;  2X45 A;  1OBP A;  2KTS A;  4CPF A;  2QEX E;  1X71 A;  1YWA A;  4O49 A;  3OD9 A;  1LPJ A;  1P4P A;  1ACD A;  2BS5 A;  1RXJ A;  1PM1 X;  1NP4 A;  1VWC B;  1JQP A;  3CPW E;  4M7M A;  4ZHG A;  3P02 A;  1TW4 A;  1SLD B;  3FA9 A;  1KQW A;  1DF3 A;  1K73 G;  3KFG A;  1VQ9 E;  1EPA A;  3VG7 A;  2Q2M A;  3ZW2 A;  4Z27 A;  1VWO B;  3AEH A;  3O19 A;  1S7D A;  1O8V A;  4AZQ A;  4O3X B;  1GT4 A;  2PI3 O;  2FKJ A;  1IIU A;  1BRQ A;  3G4S E;  1LIF A;  2WQA E;  1PTS A;  4WCE E;  4IRW A;  3ZW1 B;  3NAD A;  5EDB A;  5FAZ A;  3SLJ A;  3P6F A;  4IAX A;  1M90 G;  3HWE A;  1SXY A;  1Q7Y G;  4YBP A;  1KL3 A;  1EIO A;  2OL8 O;  1GX3 A;  2NP1 A;  1KT4 A;  2MM3 A;  1GT5 A;  1VWF B;  4K19 A;  4U8U M;  2IZB A;  3VGW A;  3HWD A;  1YJW E;  4O3Y A;  3NX1 A;  5H8T A;  3B2I A;  5K67 A;  1VPR A;  1JBH A;  4C5P A;  3BU1 A;  1VWD B;  3FEN A;  4YDB A;  5LJG A;  5HCC C;  1GT3 A;  2F01 A;  1G5W A;  1SWN A;  3CCL E;  1VQ8 E;  1ERX A;  3K3L A;  4LZU A;  3S26 A;  2FRS A;  2IZE B;  3WXQ A;  1YJ9 E;  1JV4 A;  3CKF A;  1UYO X;  1SWJ A;  1LID A;  1VQ7 E;  1VQ4 E;  3RY2 A;  1I05 A;  3OE3 A;  4ALO A;  4TNN A;  1QVG E;  1Q81 G;  2OY1 O;  2A3F X;  1NQN A;  1M1K G;  3DLL E;  5DG4 A;  1EAL A;  5K06 A;  3RE6 A;  1LUQ A;  5GAH G;  1KT3 A;  4CV7 A;  4IAB A;  2K62 A;  3WZO A;  3TZS A;  1KQX A;  1X8N A;  1S44 A;  1DC9 A;  1K3B A;  1GM6 A;  3RSW A;  1N7Y A;  1BBP A;  3RKG A;  4LZV A;  3KQ0 A;  2IFB A;  2Y3F A;  3UAQ A;  1JYD A;  1N9Y A;  1S72 E;  5AEO A;  3VHH A;  3CC7 E;  1Y0G A;  3MG5 A;  4FGI B;  1DFV A;  4OEL A;  4XME A;  4YCE A;  3O2Y A;  3TGA A;  1B8E A;  1DZM A;  1JIW I;  1X8U A;  4IAW A;  4DNE A;  3CR6 A;  4BBO A;  5CYB A;  2FGS A;  2BHV A;  5F2B A;  1YI2 E;  3PH5 A;  1K9M G;  3CQN A;  3RDO A;  1IJ8 A;  3SLO A;  4A8Z A;  1SWA A;  5DM6 E;  5B27 A;  2OF8 A;  3VG2 A;  2A2G A;  2P8G A;  2YG2 A;  5IRW A;  2LKK A;  5DM7 E;  3GE2 A;  4Z2P A;  2AT0 X;  3IGE A;  2L67 A;  1LDO A;  2RTR B;  1QY0 A;  2IZK A;  3F9D A;  3U03 A;  2RTO B;  1K24 A;  4ZHF A;  2MO5 A;  2IZF B;  1YJN E;  2RTA A;  2JU8 A;  4OMX A;  2OTJ E;  3GAQ A;  4HFO A;  2ZSC A;  1MK5 A;  1VWH B;  2AT5 X;  1RBP A;  3BLG A;  1JJX A;  2OY5 O;  1KL5 A;  1SWH A;  2GJ5 A;  4BX6 B;  4B55 A;  2XKL A;  4GKC A;  2OVS A;  3T1D A;  5HAE A;  2LB6 A;  1GKA A;  1ZRY A;  4U8U O;  4EDE A;  3CMP A;  3IA8 A;  4IMN A;  3ZUO A;  4OS0 A;  4Z6J A;  1LCZ A;  1LIB A;  5IRU A;  2KW1 A;  1O1V A;  3ELZ A;  3I56 E;  1E02 A;  3P6H A;  1VYO A;  2R73 A;  4IOC E;  1CJ5 A;  1KFF A;  2HNX A;  2IZG B;  5LKF A;  2VFC A;  4DQ3 A;  1ZNL A;  2OTL E;  1GX8 A;  1RSU B;  1VWP B;  4AZP A;  1MDC A;  3NQK A;  2AF5 A;  4TKH A;  2X8F A;  1BSO A;  1Q86 G;  4FBO A;  1IKJ A;  2E4J A;  1ZNK A;  3VG6 A;  3FEK A;  4IB7 A;  4ARH A;  4PJ2 A;  2AKQ A;  2DJG A;  4KT5 A;  1SA8 A;  1FEN A;  4CK4 A;  3FW5 A;  5EDC A;  3MM0 A;  1OEK A;  1A18 A;  2AH7 X;  3ZW0 B;  3PQS A;  5L8O A;  3QKG A;  5JD2 A;  1JMX A;  3NQ3 A;  5CSE A;  2OY7 A;  4WBK A;  3STN A;  3BS2 A;  1VWQ B;  4OKA A;  4CDE A;  1SWQ A;  3KFH A;  1EII A;  2OF9 A;  2DJF A;  4BVM A;  1ERB A;  1JJJ A;  5GAD G;  1HY2 A;  3FR4 A;  3CCM E;  4LKT A;  2MF6 A;  3CCR E;  1TOU A;  4YVB A;  1ICN A;  1SRH A;  1T68 X;  2RTM A;  5HZ9 A;  5LJB A;  1QVF E;  3D95 A;  3HTY A;  3PIO E;  1QAB E;  3WYQ A;  1LIE A;  4QRL A;  5BYP A;  3F8A A;  3BDR A;  1B56 A;  1ICM A;  3VG5 A;  3FA6 A;  3WJG A;  1A3Y A;  4YH0 A;  5D47 A;  3HOE A;  1K8A G;  1GT1 A;  5B10 O;  3AKN A;  3EW1 A;  1Y9L A;  1SWF A;  1AB0 A;  3OW2 E;  4IB9 A;  1FDQ A;  1TOW A;  2QA4 E;  1Y52 X;  1LCV A;  3WYP A;  1SWG A;  1Q82 G;  3SLT A;  1STP A;  1KT6 A;  5B29 A;  3FLL A;  3SZI A;  2ASN X;  2IZC B;  2OYB O;  2QO4 A;  2FHL A;  4IB6 A;  5B3M O;  2ALL X;  4GGZ A;  4BOE A;  2GTL N;  1MX7 A;  1JYJ A;  4Z2O A;  2Z4I A;  5B5G A;  4TLJ A;  1R0U A;  3FEL A;  3FR2 A;  1SWR A;  1W6F A;  1AVD A;  2RTI B;  1G7N A;  5JVG E;  3C78 X;  1I04 A;  3G71 E;  4O3Z A;  2QM9 A;  4O4U A;  1MOY A;  3BU9 A;  4EXZ A;  1LEL A;  4HPA A;  5AJC A;  1MM9 A;  2NND A;  2W2F A;  4O4O A;  2AVI A;  3DTQ A;  3CD6 E;  2RTP B;  2GH7 A;  4QYN A;  3BRN A;  5IO5 A;  4YKO A;  4WFN E;  4QAE A;  2LFO A;  3PIP E;  3IFB A;  2OFA A;  2RTK A;  4GK9 A;  1AQB A;  4CDF A;  4ZGF A;  4R0B A;  3SAO A;  2FLJ A;  4A1H A;  4ODD A;  1ZNH A;  3O22 A;  5HZ5 A;  1YHQ E;  5F7G A;  1JMZ A;  2JU7 A;  4GH7 A;  4WFV A;  1VWR B;  5L3Y A;  1DZJ A;  2DM5 A;  3NQ9 A;  3MVF A;  1XKI A;  4I3B A;  3G6E E;  1MX8 A;  5GAE G;  2Z4H A;  1E06 A;  1O1U A;  2QOS C;  4ZH6 A;  2HLV A;  1STS B;  4Y0S A;  3AKM A;  4GDZ A;  1VWN B;  4ZJ0 A;  1VQP E;  1SY0 A;  2WPU A;  1URE A;  4KH8 A;  4YGZ A;  4IO9 E;  4ZH9 A;  1E2T A;  3NP1 A;  3QQ2 A;  3N91 A;  4MVE A;  4BQU A;  4YFR A;  1RJL C;  3BY0 A;  1BRP A;  3ZZV A;  4Y0P A;  1FEM A;  1VWG B;  4BX5 A;  4L1N A;  3JQO A;  3F6Z B;  3SOT A;  2FS6 A;  1SY1 A;  2FHN X;  1EPB A;  3X00 A;  1BSY A;  3CCS E;  1D2U A;  3EBW A;  2RTD B;  4AZR A;  2IZA A;  3CCE E;  1SWU A;  1A2D A;  2X56 A;  3T2W A;  2L5P A;  2WQ9 A;  2GTF X;  1N4J A;  5FQ8 E;  1WUB A;  4FBR A;  1XCA A;  2R74 A;  2OL7 A;  2JGS A;  1GXA A;  3AUM O;  1OSP O;  3IG9 A;  4QGV A;  3L4R A;  4GGR A;  1TXL A;  1NP1 A;  3VG3 A;  1QWD A;  2CBS A;  4ML7 B;  3CF5 E;  1Z24 A;  3CWK A;  4AZN A;  1I78 A;  1T0V A;  1YWD A;  4Z2V A;  4A1Y A;  1BJ7 A;  1KT7 A;  2QMI A;  1B0O A;  1SWC A;  4I95 A;  5EEE A;  3STM X;  2OZQ A;  3HK1 A;  1PBY A;  2A8G A;  5BVS A;  4IBA A;  1L6M A;  1LF7 A;  2YMS A;  1LKE A;  5H9A A;  3EC5 A;  3H3I A;  4ORS A;  2RD7 C;  2K23 A;  3FMZ A;  2ANS A;  1X89 A;  2LA7 A;  3FDC A;  1HBP A;  3ZUI A;  1E00 A;  3APV A;  2JW1 A;  1JJU A;  1BLR A;  3RDQ A;  2POA A;  3B2L A;  1HQQ A;  5LJE A;  1QG5 A;  1SLE B;  4GDA A;  2AT3 X;  5HWZ A;  1FE3 A;  5K68 A;  2N93 A;  2OVD A;  4M6S A;  4EFG A;  3RWX A;  1YP7 A;  1A57 A;  3UEW A;  4OMW A;  1E5P A;  3NR3 A;  3P6E A;  4BX7 A;  2CBR A;  5AQ6 A;  2XST A;  4I60 A;  4U3Q A;  1TVQ A;  2OFR X;  4IMO A;  1LCW A;  3EBK A;  2MJI A;  4KCA A;  1VWL B;  3WVM A;  3TF6 A;  5C0N A;  1EQD A;  4EQA C;  4Y0Q A;  1QQS A;  4MVK A;  3C76 X;  4U46 A;  3FYF A;  3P24 A;  4TKB A;  2WEX A;  2OFM X;  1HMT A;  1DV9 A;  5D48 A;  3STK A;  4TQ2 A;  2A0A A;  4IB8 A;  5LJD A;  5HCD C;  4CPE A;  1KZX A;  1VWI B;  2A13 A;  3CBC A;  4OS8 A;  4D6A A;  4UU2 A;  2CM4 A;  5EZ2 A;  2FS7 A;  1I4U A;  1FTP A;  2KD2 A;  1HMR A;  2X34 A;  1CBQ A;  4CDC A;  5IO6 A;  1VYF A;  1YIV A;  3RE5 A;  1VYG A;  2ZJR E;  2Y32 A;  1CBR A;  1NBX A;  1VWM B;  1RXH A;  5KIC A;  1GKA B;  1EUO A;  5FFH A;  1NC9 A;  2G78 A;  4YGG A;  4Y59 A;  2QCB A;  3C77 X;  4IOA E;  1ZND A;  5HTD A;  2X32 A;  2FWV A;  4NW4 A;  4ORY A;  4NNS A;  4BGF A;  1AVG I;  4GJV A;  2RTN B;  1X8O A;  3CBS A;  1VWB B;  2HZR A;  4GE1 A;  1RL6 A;  4CPH A;  1STR B;  1JJ2 E;  4QNI A;  2AL0 X;  3RZY A;  2O62 A;  1KXO A;  3PP6 A;  3UEX A;  1HBQ A;  1U17 A;  3PPT A;  1VWE B;  1SRF A;  3U9P C;  1KQS E;  4MVI A;  4GZV A;  3ELX A;  4YGH A;  2G8C O;  2Q9S A;  3PEC A;  3CCJ E;  1ML7 A;  2GC9 A;  1KD1 G;  2FR3 A;  5H9L A;  1CBI A;  1X8P A;  3KZA A;  4ORU A;  1LIC A;  1RAV A;  2OL6 O;  3S5V A;  3CXC E;  1N0S A;  3PH6 A;  1HMS A;  5F1E A;  4HPC A;  4I3C A;  5F6Z A;  4BJ8 A;  4ORX A;  1KT5 A;  1OPB A;  5LJH A;  4Y5D A;  3CCQ E;  4ID2 A;  4I9S A;  1YIT E;  1QY2 A;  1SLG B;  5HZ6 A;  5JR8 A;  3CQR A;  4O9S A;  5GAG G;  3CCU E;  3KFF A;  4JO6 A;  3WOV A;  4EKV A;  1YP6 A;  4KC8 A;  2JMB A;  1I06 A;  3DSZ A;  1KGL A;  2X4M A;  4HWM A;  3LV4 A;  1OEJ A;  5LJK A;  2QOM A;  1WBI A;  4GD9 A;  2MHD A;  4ZHC A;  4ZR2 A;  1BM5 A;  3EMM A;  2C1Q A;  3B2K A;  4QQ1 A;  1NGL A;  4I9R A;  5IXG A;  3PK2 A;  1ZNE A;  1DZK A;  1SWE A;  1SXW A;  3P6C A;  1IFB A;  1KZW A;  3WJB A;  1OEE A;  1SXX A;  1Y9T A;  2C1S A;  1VWK B;  3WJF A;  3PQU A;  4ON1 A;  4GU8 A;  4JHQ A;  3B2H A;  3EYC A;  3ZQ3 A;  2HMB A;  3EM0 A;  1VQ6 E;  5B2A O;  4BCS A;  1ADL A;  1SWP A;  4GJS A;  3TGB A;  2OFB A;  2FT9 A;  3JS1 A;  4XMH A;  1SWD A;  4AZO A;  2MWH A;  1SRE A;  4MEE A;  4GUZ A;  2JU3 A;  1BSQ A;  1VQL E;  5D8J A;  1I9H A;  1VWA B;  5KID A;  2UZ2 A;  4LKP A;  4EEJ A;  4XMC A;  1P6P A;  1SWT A;  1IKE A;  2AT8 X;  1VQO E;  2WEW A;  3ZW1 A;  4I3D A;  4WFB E;  4NYQ A;  4I6S A;  4ALB A;  4WFA E;  3I17 A;  3APX A;  3VPJ E;  4COT A;  1SLF B;  1RST B;  2C4I A;  3BX7 A;  5DPQ A;  4NV8 A;  3FW4 A;  3WJE A;  4TKJ A;  5BVQ A;  4KII A;  3RY1 A;  1FEL A;  3VHI A;  5JVH E;  3D4R A;  4RUN A;  3Q34 A;  1SY3 A;  1OPA A;  1SRG A;  1VQN E;  3KVN A;  1RXK A;  2CM9 A;  4UU3 A;  2KTD A;  2RCT A;  4FBV A;  3UEU A;  4YCH A;  3RDU A;  3I0A A;  1HQP A;  5HA0 A;  4O3W A;  3TGC A;  3ZWE A;  2F09 A;  1YWC A;  4GRJ A;  4HPD A; 
#chains in the Genus database with same CATH homology
 2PI3 O;  2OL8 O;  2FKJ A;  5B2A O;  5B3M O;  5B10 O;  2AF5 A;  2OL6 O;  2OY5 O;  1RJL C;  1FJ1 E;  2OY1 O;  2HKD A;  3CKG A;  1P4P A;  2I5V O;  3EC5 A;  2OYB O;  2OY7 A;  2OL7 A;  3CKF A;  3IGE A;  2G8C O;  3AUM O;  1OSP O;  3IG9 A;  2FKG A;  2OY8 A;  2I5Z O;  5B11 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...