2I60H

Crystal structure of [phe23]m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
228
structure length
221
Chain Sequence
VQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXTERIOR MEMBRANE GLYCOPROTEIN(GP120)
publication title Combinatorial optimization of a CD4-mimetic miniprotein and cocrystal structures with HIV-1 gp120 envelope glycoprotein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 40
structure length 221
sequence length 228
chains with identical sequence R
ec nomenclature
pdb deposition date 2006-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i60H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i60H01
3L1OH 3O8XC 4NGHH 1LO2L 2B1HL 3B9KB 1PQZA 1IGTA 1S7VA 3CMOL 3L95B 4RWHA 3QCUH 1BOGA 3P0YH 3EGSA 3C6LB 4PJAE 1SYVA 2XWTB 3W39A 1HQ4A 4RMQA 2EEBA 3PNWA 2FSEA 3U7WH 3F7YA 3OR7B 1G1YA 1G9NC 4OD2B 1J05B 4QWWD 3I3DA 3L5XH 2EIZB 1XF2A 1I7ZB 2R1WB 1J9CT 2DIAA 3MNZA 5EBMA 1IBGL 4L4TE 4X9FA 4XNUH 5C0ND 4JRWA 1AHWA 1EUTA 4F7MB 4F7PA 3MV8D 3S35H 3S5LB 3UTOA 4P57A 3CLFL 4QKXB 1KJ3L 4PJIE 2F19H 3KLSA 3STZA 4APQC 3RL1A 1FG2A 2NX5B 4O2CA 5K9QI 4LSPL 3BKJH 4CW1A 3QR2A 1D5MB 4M1CD 1UB6A 2QL1A 4G9FD 3LY6A 3LQZA 4MLSA 3EJYC 1H3WM 1FPTH 4HIEA 3FRUB 4X6DF 2BHZA 1DUYA 3MV8A 3QQ3B 2R2BA 4UOW1 3KXFD 5HHOD 5AAMA 3CFCL 4LOUC 3EYOA 1MCCA 1UJ3A 3FB6A 3QWQB 4BFEA 4NJAL 1A3LH 1CD1A 3H6JA 4Z7NF 4YXHH 4XNMB 3GJFA 1P53A 3VXSB 4G9FA 5MEQA 5JZ7C 3U2SA 3KXFA 4OB5L 5HHOA 3DX8B 2XQBH 4OIIL 4RFNB 4AENB 2D7PA 3UPCA 2FX8L 4ZUVB 4GLRH 1OP9A 1H3UA 5AEAA 1AO7D 4MJ6B 1MFBL 3ZYJA 3TNMB 4POZC 1U8IA 3A67H 1J0JA 3C2AH 4MXWH 4UTBL 1OL0A 4HUWB 2HVKB 4DN3H 1P4LA 1QRNB 3DETD 5E2VH 3D0VB 4LSTH 5TE4L 5C0BD 4NC1C 1R3KB 2BHUA 1U8MB 5IW6A 3QG7H 1AO7A 4K7PY 1XIWD 3U30C 4GH7B 1YEJL 1LO3H 5C09B 3HPJA 5TF1H 1MUJA 3WD5H 4YDJB 4N90D 4RWYH 3WJLC 1EBPA 3LV3A 1U95B 1CD9B 5C0BA 1P2CA 4OCRL 4JRXD 3FT4A 1GGCL 4IDJL 4JHWH 4DW2H 2WANA 2DMCA 3T1FA 3WNMA 3VI3F 2Z92B 4WW2C 4XNXL 5CZKA 1RY7B 3QI9C 2D3VA 4H8WH 5ADPL 1JPGA 3ILQC 1OOAA 4M6OH 3ZMRA 1QFWL 4G8GA 4U1GB 2WW8A 1JHLH 1O7SA 2M2DA 3LH2L 3QXDA 2GY7B 4XVSL 5HVHB 1Y0LA 4JRXA 4MCZB 4QRPE 2AERT 3D9AL 3FB7B 4KRNA 3KLAB 1K4CB 2YD4A 1T7VA 3RNQB 1Z0NA 1HI6B 4IMKC 1UM5H 2CLVB 1SJEB 3MJGX 3RUGE 5L0QC 2OLDA 1MIEH 4GRLB 3TWCH 2CXKA 4B0MM 3HG1D 1SVCP 3O3EB 5I19L 5TE6H 5GGUB 3E6FB 3QFDA 3MJ6A 4XCCL 3SKMB 4M48H 3MBXH 1RUAH 3KPTA 1RU9H 2X4TB 4FG6C 4HCRA 3FRPG 4WTWA 1LO5B 4QYOB 1WT5A 4DAGL 4XPHL 3U0TB 4GJTB 4UZGA 3V4PL 4RA3A 1VESA 3VFRA 3QRGH 4AEFA 4NHUA 1NMBH 4WJ5B 4OGXL 4L4VB 3HG1A 5DZNA 3TNNA 4P2QB 2FYYA 4QRTA 4KH2A 1JWUB 1NUNB 4YGVA 4FQLL 1KN4L 2F8OA 3CZFB 4MB5A 4JRYB 4MWFB 4U3HA 3O41A 3HZKA 4ZTPL 1YDPA 4AL8L 1A7OL 3RAJL 3MRHA 4N0YH 1INDL 3OKLB 1GPOL 2R4RH 1LWRA 1HINH 3QQ4A 1YEDA 4HHAB 4IM8A 4MNHA 2ZG1A 3DV4A 3MXWL 1HNGA 3T0WA 4XCEA 1HCVA 3VW3L 1KB5A 3QHFL 3KPNA 2BSSA 3IXAA 1ZLSL 5JPMB 2BY1A 5C0AE 1B6DA 1N7MH 3GRWA 1SMAA 4LVNC 4BJLA 4DFHA 4LK4A 1IL1B 1SEQL 4YXLH 4MQXC 1QHOA 5E08H 2J88L 3U0WH 2AEIT 5FIEA 3BQUA 5IVXA 2DYPB 1IC7L 1U41A 4L8CA 5JPNA 1RZKC 4K9EL 5E2WL 1G7MB 4HWZB 4M62L 3SE8L 3VI4F 5E8DL 3ETBF 4MLIA 1JMZA 4NO0D 4DVBA 4GUPA 3B9KD 1LEIB 3CZJA 3L3JB 3NPZB 1D9KD 1XF5B 3KYAA 3C6LD 4Y4FC 2J8UB 5IBUG 2HJKB 5IQ9A 1BREA 3FFDA 3MLRH 4ZMAT 2DLFL 1KB9K 2HLAB 1PG7L 1IKNA 1Q0YL 5JHDE 5I1JH 4D9LL 4NO0A 4YPJA 4K3EL 3JWOH 3VDBA 5CIPH 5AG8A 3OR6B 5F1KC 1D9KA 3WIFB 2DLEA 4QRSA 4G8EB 3HR6A 3TESA 1QOKA 4KK6D 3HZMA 3LRSA 4HIIA 3SDYL 4XCYB 3W0WE 1N0XL 3IB4A 3G5ZB 4L8BA 5TH2B 1B90A 3R1GH 2MKLC 3CXDL 4HS8L 4ZYKA 4HUXA 2YC1A 4L29B 3HC3L 5ISZB 3TCXA 1MQKL 3O11B 1JV5B 4R96B 2J7LA 1MFCL 1A6AA 3PWPD 4Z76A 1PBYA 4O2EA 4ZUTB 3WFHB 5EPMB 5D5ME 4X5LA 3L3GA 1CT8B 5IBUB 2EC9T 5C08E 1S9WB 4HW6A 2VXUH 4J23A 1G9NL 4DKFH 1CL7H 3ECBA 3FT2A 2MOVA 1OVZA 3IU4H 2Q8BL 3GMMB 4PRPE 2GJJA 5EFIB 3PWPA 2O26U 5CEZD 1MJ8H 2XNAB 4JFYA 3ZTJH 1GOFA 2RB8A 4Y1AB 3TIEA 3P3YA 3VD9A 4JN1L 5LAXB 4Q7DA 4PJ5E 1IC4H 3QDAA 5FAAA 2FJGA 5EUOA 3RVXD 4PB9L 5F1OB 3MV9D 4OAWA 3DVGB 4JFQB 4YDLB 3GSQA 3KPLA 1QRND 3L3DA 3PDOA 3LS5L 3CGTA 5FA3B 4FHBD 3EJZD 1Q9LA 1CICB 3O2DH 4QHUA 3KPMA 5C8JB 4DQOH 1HKLH 4XBGA 1MH5B 5C09D 3HI5H 1JPFB 1M05A 4BZ2L 5A16A 3MV9A 4ZPTA 1YMMD 3HI1A 1F58H 2EH8H 3O6KL 5EOCH 2V2XA 1UH4A 3VXRB 5D71H 3SGKC 4WFEE 1P84J 5SWQB 5DRXA 5C3LD 2IAND 4Z9KB 3EFFB 2FEDD 3ZDZE 1U8KB 4HKZA 4I2XE 4MNQB 3CVIH 5DUMH 4O5LL 3G5VA 1AGEA 1YMMA 2VR5A 2E6PA 4XHQA 5ID0A 3SKOB 5IHUL 5D70L 3O3AB 2IANA 5D6DA 4U1IA 1P5VA 4LSRH 5FM5O 4CN1A 3GO1H 4RMWA 3UBXB 1DQJB 2NW2B 2OL3H 1FC1A 3T4YA 3GMPA 4P4KB 2A6IB 4HFUL 1TQBB 2MJWA 2CRYA 4XVTL 2A6DA 1KPVA 4LARL 3V7AE 2IG2L 3BPNC 2VMFA 4GRLD 1YN7A 3MO1A 5IGXH 1ZSDB 4G5ZH 1CFTB 5DO2C 5I8OH 4X7SH 2YSSB 5SWZB 4PGZA 3SHSA 4M7KL 3QA3A 3NA9L 2HT4D 1JP5A 1OTTD 1XH3B 5CJXA 1MPAL 1X5AA 2IH1A 4KHTH 3W81A 4G6AD 3WFEH 2VISB 4B41A 1MI5E 4KJQD 4UT9L 2ARJB 4FQQB 1KF9B 2B7DT 3AXLA 3F58H 2NY1C 3DSNA 4CNIB 2CGRH 1JWSA 2EDFA 4P2QD 4PJAB 1VGKB 4P3WA 3RWDB 3NCCB 3K2MC 1NAKL 5H37H 2WINB 3CVHA 5HYSA 2HRLA 4ORGA 2UWEF 4BZYA 4NUGH 3LKSA 1RULH 5F1NB 5HGBB 5BXFA 1KPRA 1EV2E 1MWAL 3DUSB 3BKYL 1HSAB 2A73B 5T33H 1VEOA 5E2TL 3ULUF 3P9LB 2EECA 2QSVA 3NFSH 4U1HA 1UYWH 5HI5D 2Q8AH 2RJMA 2W9DL 4MAYC 3GIVA 5GGQL 3K2UH 1A0QH 5JW4R 2JK5A 4PJFA 3D25A 4PS4L 3UTTE 3IDGB 5DJCB 4OLUL 4X6CE 4PJIB 2FR4A 1H3VA 1LK3L 5ENWB 2D0FA 1FN4B 3RP1A 4E41E 4EDWH 2EDKA 4HMCA 3VA2C 5B39G 2B2XH 4IMLA 4P59L 2BK8A 3H42L 1T0MB 5K33A 5DDHA 4E9LA 4JANB 5DZOA 2VE6A 3ULUH 1AJ7L 3VXUA 5K9KA 4R4BB 4QRQA 4KPHH 4M5ZH 5DHXB 1F11A 2OR7A 1ZT1B 4RISL 3UO1L 1JGLL 3V4UH 2EXYD 1O5DT 2DJ4A 3L5JA 3MYJA 1MFAL 3DBXA 1DFBL 2EH7L 2GJ6D 5F1SA 1GAFL 5CGMA 3HC0A 4NZUH 5DHYB 4JFFD 4DKDC 2DQFA 2EE2A 1UH2A 5HGGS 1U8NA 4FQHA 3S34H 2OQJA 2X4OA 5HYEA 5EO9A 4NNPL 4UDUA 4QOKD 1KYOJ 2AGJL 2ZOKB 3BEWB 5EC1B 5KG9A 3MZGB 3WBDA 5IF0A 2XZAL 2VAAB 5C0DB 5TPWL 1VSCA 1G0YR 2EXWC 1OAYH 5B39B 1S7QB 4XBEL 2GJ6A 2MCPH 4KROC 4UQ3A 5HY9A 2UYLA 1H9VA 1C16B 4P49A 3TT3L 4JFFA 4RCAA 2G75B 5BZDB 4S0SD 4HK0B 2VZOA 4ZS6C 4QOKA 2X9WA 4ELMA 3SDCB 4YDKL 5GRJH 2APVA 4YDIH 1JGVL 4YFEA 3NTCL 1FO0B 1LO0H 3AAZA 1TJIL 1TJHL 4FFZH 2IAMC 4NQSA 4LEXL 1EJ6A 3VXTB 4BSJA 2JJUA 3MGTA 3IJYA 4OLYL 4L3ED 3WFBL 3RWJA 2IC2A 3MREB 5HHVL 1BGXL 3ZHKA 2C1OA 3MJ9H 1MCOL 1E28B 3KR3L 3LPGA 4WV1C 1WZKA 3CNKA 4P23B 4ZQKB 1Q0XL 2PXYA 3D1MC 2EYTA 3DSFH 5C9JB 4TOYH 2IGFL 2ATPA 1I7UB 5KANG 5BOPA 2RGSA 3P4NA 5IROA 1XZ0B 1U8PB 4L3EA 3CAFA 1PAMA 1IVLA 3HCVB 4OM0H 5CUSH 1DTUA 2YD5A 5J13C 1SBSH 4J6RH 1DQLH 4JHAL 3EYSH 2L7JA 2MKWA 4C4KT 2HYMA 4UV4H 2BP3A 3FO2B 3ZYZA 1NUGA 3UP1A 1IAMA 2KZWA 2VXQL 4N68A 4ZNEE 2YXFA 1B0WA 3D6GA 2H2PD 5T3ZH 3UPAA 4A2MA 2V9TA 5JDSB 4G6KL 1MEXL 3MJ8B 4F33B 1FZMA 3GSRA 2BMKA 1BQSA 4WWKA 3EOTL 3SQOH 1BJ8A 2V2WB 1A7RL 3ARBC 3IDIA 1BX2B 5I73B 3MCG1 3U36A 1J8KA 2VKWA 1PKOA 2ZUTA 3FB5A 4H88H 5DRNA 5ILTL 5CJOL 3BN9C 4JGUA 3OHXA 5FOJA 4M6MH 2FX7L 4YX2L 2VC2L 1QR4A 3Q5OA 3QUXC 4OD1L 3WJJA 1AI1H 1FZJA 3WHXB 3QNYA 3UTQB 3MJ7A 5KSBF 3CFJB 1PSKL 3NIGE 2FL5B 3MLXL 3EOBA 1B0RB 2X7LB 4NUJB 15C8H 3J7HA 4H1LA 4OF8A 3HUJB 1FGVL 3NN8A 5C0AB 1FSKB 3IFLH 4QXTB 4RGNB 2E7LC 5DJ8B 3DLQR 3FTGB 2ADIA 4EXKA 1NLDH 2X4RB 4JQXA 1AE6L 5GS0L 3DTXB 4L9LB 3H3PH 2JTDA 1IEAA 1JBJA 5DJ0B 5J57B 2K7PA 2JJTA 3QIWB 3SDAA 4GW5A 5A2LH 5FM8A 4LASL 4PYGA 1CFBA 4Z7OF 1CR9H 3QUYB 2YRPA 2BSRA 2YMXH 2PTTB 3PG2A 1I4FB 3T1WA 3QG6B 1HIML 1NC4B 1CGYA 5EC2B 4ZAKD 3BEVA 2AJVL 3U9UA 2GK2A 3WUWG 3O6FA 4W4OA 2X4PB 3ARGB 5DURB 2HA1A 3JXAA 5JHDB 3BH9B 4Z77B 4XPTL 1C5DB 3D85B 1KIPB 2GSGA 2IFFH 5DD6B 1TVHA 2A77H 2LABA 2Z8VC 2F58L 2YN3A 5F7DB 4ZAKA 2R1XA 2CLZA 4JFZL 4OLVL 1X5LA 2NY3B 5ETUA 4PG9B 3OKMA 3FQNB 2FECI 1C12B 3H3BC 4O2FA 3G5YA 1N5AA 4GW4B 3SQBA 2HKHH 3JWOC 4M61A 5KBNC 1TZGL 3MRFB 3KJ4C 4GXUN 4HMDA 1IAKB 3HNSL 4L1DA 2Y06H 3ZE1E 4DZBA 3VWJD 4JCLA 3RY4A 4HS3A 3S97C 1XF3B 3RWGA 3VFUA 5D7SH 1Q94B 4D9QD 1ZEAL 1AGFA 4EUPH 3C9NA 3L1OL 5L8KB 4LBEA 4NGHL 1F13A 2QBWA 1ZHKB 3D39E 3QCUL 2EC9U 4PRPB 3O4OB 4LF3B 1CQKA 2SEBB 2XTJD 3LN9A 1JTTA 3PJSB 2R1YB 3V8OA 4ENED 5I1HH 1T5WA 3VWJA 3X11A 4Y4KD 4Z7QF 5J11B 3ARED 5GSRB 1N5YH 3U7WL 3AU1A 3QULA 4IRSB 3BD3A 4LMQI 4C4KO 4EDXA 1KTDA 4K3JH 3CD4A 5IFHH 2DTMH 3GMOA 2YUWA 3CLEH 3QUKB 3VFOB 2WUCH 4XNUL 3RVWC 1B0GB 4JPVL 3FFCD 1GC1C 3T0EE 4LFHD 1ZLVH 3LZFH 5IT2L 3S35L 2QLVB 1PY9A 4Y4KA 3AREA 1I3RB 3H8NA 2D7NA 4JM4H 4FNLL 2NY0C 3BGMB 3QEGH 4NFCA 1KPUB 3V7AG 1ND0A 3O0RH 4FXLA 1BFOB 1DVFC 1T7YA 3BKJL 5IP4A 4F37K 5E1AA 3RZCC 1ZLUH 3CFEA 3FFCA 1FPTL 1GGIH 3I9GH 3WKMH 1MCNA 4NCC1 3UAJD 1MCPH 4NO3A 2CO7B 1HHJB 3JWNC 4JPIB 2DQCH 3HI6H 2R0WH 5E9DB 5DHVH 5JMRA 5IBLC 2HFFB 4UMGA 3ARSA 1A3LL 4I2XB 5C6TL 2P42B 4FN0A 1CG9B 4YXHL 1HYRC 1NFKA 1IEBB 4NKOA 5F9OH 3LMJL 1S7TB 1MVFA 3QEQD 2ID5A 3W11C 5J06A 4IIQA 5DRWB 2ZG3A 3ALXA 4GAJH 4NKQB 2XQBL 2HG5A 4U1MB 5DEFB 1RQ5A 4PFEA 3UDWA 3VE0A 1UQSB 4I18C 4OKVB 4D3CH 4MQTB 4XAKE 3LQMA 2CUIA 2I9LA 4UDTA 3A67L 3C2AL 3HE6A 3V4VL 5JORB 2DJSA 5B38A 3QEQA 4RQQA 5SWSE 4KV5F 3MRJA 4DN3L 3HZYB 4TVSa 1WWAX 4LSTL 3TPKA 1ZVSB 1FZOB 3V6BR 1S3KL 1TENA 3GB7A 1XGPA 2Z31B 3LHPH 3PDGA 2NQCA 3QG7L 1MI5B 4ZFOB 1NAMH 4U1KA 3C60B 4PJHE 1LO3L 4HK3J 3RZWA 3KYNB 5TF1L 3TFKD 4Z78B 3WD5L 4Y4HC 1BQLH 1I1YB 3WHE1 3GSOA 3EDKA 4PJDA 4Y2OA 3TEUA 4QHLA 1QSED 4NZTH 3B4NA 4RMVA 4HLJA 1WEJH 1EXUA 1CFQA 4JZJB 2ZP0T 4PBWD 3UCRA 4NQUA 4YC2C 4NWTL 5FA4B 3QNZB 4H8WL 4OKDA 5HYJB 1X6LA 3DRQB 5DFVC 2VUOA 4PJ7E 2EO1A 2LV4A 3VXPA 4KK8C 5CFHA 4RGND 5HD8D 1QSEA 1TCMA 1SY6A 4X6CB 1RHFA 1RHHB 3K8KA 4MVBD 4E41B 2WMPA 2NLJB 4ODTH 1MIEL 1P9MC 3W5NA 3CU7A 3CFBA 5ALCH 1D5IH 3QUZC 3RPIA 2CLRB 1UWEL 3BO8B 5TE6L 4YHNB 1QFOA 2IQAB 3I3BA 3CUPB 3MBXL 1AGCA 2GSIA 1RUAL 1IGYB 1RU9L 2PCPA 5GS1B 4X9HA 1VENA 3VGAC 4NZDA 1KIQB 3QRGL 4JN2A 3MA9H 3KDMB 4Q6IC 1AKJA 1NMBL 4OFDA 1A7PH 1W8OA 1CDCA 1U91A 5AZ2H 3GJFH 2NY2C 1W72A 5FKPB 4PJ9C 5JIHA 5I8EA 3ULUC 2UZYB 1J7VR 5ICXB 2VR9A 2EE6A 4DGVH 4JO3L 2R4RL 1HINL 4DUXA 1A7QL 1ZWIA 2ARWA 5DQ9B 4UT7H 4FQ1H 4PTUA 4KKCD 5DGQA 3GUTA 1EZVX 4HG4J 3IKCB 4HULB 5D6CA 3PXJA 1GGYA 3RA7L 2BCKB 3GSUB 1E27B 4QLRA 1N7ML 5HI3D 1AD9A 1KUMA 4YXLL 3DV6A 3O9WD 1HDMA 5JNYB 1U92B 2EIBA 5E08L 2DLHA 4M6AA 1T3FA 3VH8A 5A43C 1RZIB 5GSVA 1A4JB 1U8OA 4IRJC 4U1JA 5JIIA 1VADB 3A0OA 1HH6A 1NDGA 3RI5F 2OSLA 2CPCA 2HJFA 3IF1A 1IILE 3TLRA 5H8DA 2VLKE 3GHBH 1YNLL 1G6VK 1HXMB 4KRMB 1H5BA 3FN3A 3VD7A 2Q3ZA 3O9WA 3G5XB 3UTZA 3WS6A 1QEWA 1TCRB 4PGDB 4XBPA 1AQDA 4HEME 4HLZH 5DLML 4S11A 2WBJC 3MLRL 4ALAH 5IB5B 3ARDB 2NXYD 5D1XC 5I9QC 3WS3B 2ZUQB 1F97A 5EOTB 5E0QA 5I1JL 3HAEH 3PWLA 4KDWA 1RUKH 5D7JD 4KKBC 2FBOJ 3KLHC 5I6XB 2YUXA 3FO0H 4X4MA 4LAQL 4RMUA 2VRAA 5KS9A 5HPMA 1AXSB 2BDNH 3TJEL 4R97B 4F58H 2NNAB 3AB0C 2ZWLT 5FHAH 1KENH 4WI6A 3CJJA 3T4AA 3R1GL 3RKDD 5CP3H 5D7JA 1NGYA 3FCTA 4U0RC 5L8JB 2QQLL 4M8QA 4XXCC 4QNPE 4PV9A 1X44A 3VGHA 5L2KA 3O2WH 1HK6A 2NY6C 5J1TC 4HCRH 3P73B 1AD0B 2W9EH 2IPUK 1G9MH 3IFPA 5DQDH 5E9DD 1EDQA 2VXUL 4WO4D 4EQ2A 4OCXL 5C6PB 3AMKA 2F53B 4DKFL 1A9EB 1IAOB 4R4FH 2VABB 3IU4L 2OTWA 5SX4H 4F15C 1VFUA 1QP1A 3ES6A 4I9WD 4I3RH 4TSAH 5IVXF 1MJ8L 3G04B 3NFNB 3MACH 4IS6B 1F6AA 1FBIH 3TO4C 3FAWA 1T1YB 2QJDA 1BBJA 3EIFA 3FQTB 1WIPA 3BUYB 1FVCB 1OWRM 4WO4A 5IJKC 1WWCA 1NANH 3L5WA 3OJDA 2CDFA 5JOFA 2ADGA 2JCCE 4C83B 1N6VA 1QFWM 1TJGH 1QBBA 4QRUA 3MRPA 4ONFH 1RV6X 1ZHLA 2EKSA 4KZDH 4PP2B 2E3VA 4KXZH 3DMMB 3U82B 4FQIL 3QXTA 4K7FA 1JGDB 5HGAB 2DQDH 3GMQB 2Y1VA 3SGEH 4JZOB 3VFMB 1ZT7B 1G7IB 5T1KB 4DQOL 1HKLL 3IDYB 3INUH 2Q1EA 3HI5L 1YMHA 3E8UH 3V5KA 1J0IA 2Y5TA 1Y18A 2EH8L 5EOCL 4HKBA 1WIOA 4RAVA 5D71L 1F90L 1QLEH 3MLTA 1WC7A 1WF5A 2C9AA 1NGWB 4XI5C 1MCLA 3NZHL 4BH7A 4TUJA 2EEDA 4EI6A 3CVIL 5DUML 4JQVA 3TZVC 3DJ9A 3KPQA 2C5DC 1AR2A 2B39A 2F5BH 3TA3C 1U93A 5HYJD 4PY8J 4JY6B 3U4EA 4LCWE 1CE6B 2ZKHH 1EK3A 1FC2D 3BESR 3HZVB 4X4XB 4ZTOH 4OV5B 5EB9A 1XCQA 4LSRL 2XQYG 3GO1L 5DD3H 4NJ9H 2W65B 3B5GA 4X4YA 3F5WA 4K3GA 5I8KH 4P2OD 4R3SB 4X6DE 3MUGB 1TXKA 5GS3A 4AIZA 5T1LB 2WM0A 1HH9A 2WBWB 4JJ5A 1IGJA 1QQDA 4NRXB 1NKRA 5LJYH 3C5ZA 5IGXL 3LQAC 5HYFA 3WN5C 4NRZB 2PTVA 4X7SL 5I8OL 5I1AB 2YR3A 4HGKC 5J8OA 4Z7NE 3HB3C 4KHTL 3JTTA 3FO1B 3TCLB 3AM8A 3WFEL 4P2OA 4BKLB 2IPUG 2HVJA 4MA1B 1Z3GH 2J5LC 1S78C 1OQOA 3F58L 1BFTA 4G9DA 3D39B 3C09B 4AYFA 2CGRL 4PLJD 2B1AH 4P4RB 1XGQA 3WL9A 4DKAA 3S3SA 5AYQA 2F15A 1QUNA 5F7MC 4P0DA 2P5EE 5FXCH 1IM3B 4NUGL 5FK9A 4GQ9H 2FGZA 2F54E 4XCNA 1RULL 2Y7QB 5I1IH 4NPYA 5T33L 5ESQB 3VFNB 2JIXB 3V6OE 2Y23A 2JJSA 1MWAB 3NFSL 5C0GA 1UYWL 3MOAH 2Q8AL 3T0EB 2IH3A 5CEZH 4LPUA 4NRYB 5AD0B 5F88B 1BJMA 3K2UL 4KDTC 1A0QL 4RGOH 3TJHD 2UZIH 1J88A 3EZ8A 1FFPA 3I2CL 1XF4B 4PJBA 3T0DA 4M93C 4OGYH 1A2YB 2X6MA 1JCKA 3NGBC 4M1DH 1PEWA 2B2XL 3LEYH 4OLXH 1K2DA 5FYKD 4ZODA 2ZCHH 1D5ZA 1WIUA 1C08A 3VI3E 2Q7YA 3ULUL 5E8PA 4KPHL 4M5ZL 4NDMB 1I9RH 1KULA 5IOPA 1L7TH 5K9JH 4YBLC 2NMSA 4XGZB 5C70A 2E9BA 2PR4L 3LKNB 3ARDD 1OLLA 4GAYB 4M4RA 3V4UL 3RVVD 4HIHA 3NH7H 4ODUB 3UPRB 2IADA 3LEXA 4K8RD 4XP9H 4NZUL 3U4BL 2Y72A 3QCTH 1F4WH 1VFAA 4K94H 3U9PH 2OTPA 3S34L 1OT2A 3V7MA 5FV2A 1T6VN 1E4XH 1W0YT 2YPKA 2E7CA 4QY8B 4PTTA 1A3RH 3E2HC 1KCSH 1JIBA 4OJFH 5E8EA 1JTOA 1OAYL 1WBZB 5ANMA 1RJZB 4LHUB 4MYWB 5EU6D 2MCPL 5SWSB 4LCCB 1NBZB 4F9PA 4YHPA 5CAYB 3WLWD 1PVHA 3PL6B 3NCJH 5DMGD 5CSGA 1I7TB 3UXFA 1S7SB 5D2NA 4YDVA 1ZHBA 5GRJL 2C1PB 4YDIL 2AK4D 3OL2A 2KUTA 1MHCA 1I1AC 4GMTH 4I77H 1FLTX 1YEKL 4WVRA 2ZJSH 5EU6A 2F53D 2AJSH 2KQMA 5A2KH 3VRIB 4PJFF 1NCBL 4BUGA 4XVJH 2XIDA 2WIIB 3SN6N 3CVHH 4W6XB 4XPGH 2DWEB 2QKIA 3V5DA 5ERWB 2OXGA 2VLRD 1FJ1A 4R7DB 2EDXA 1S9KC 4OF6A 3MLPA 5TFSH 2AK4A 3MJ9L 4L8DB 2NY4D 5F9AC 3BP4A 4WTXA 3MRIA 4A6YL 2GIYA 3VXQB 3DSFL 1PLGH 3LB6C 4PG2C 4PJ7B 4TOYL 4YFDB 4N5UA 1AP2A 1QLFB 1YNKH 5CUSL 4ZFGH 2HT2D 5K9OB 1SBSL 1W2KT 2VLRA 4J6RL 1DQLL 3EYSL 3DMMD 2HMIC 4QCIB 4UV4L 3NZ8B 2CDEB 1CF8L 4P5KA 3DI2B 1KJVB 1EEYA 5KZCB 1U36A 1A6UH 1YY9D 5ADOL 4GO6B 3W2DH 4OGZA 4X6FA 3VFWB 1AHWC 3DURA 2W0FB 4FQXB 4MDJA 2J8UF 5T3ZL 4YIQB 3X3FH 5FO9B 3F6IA 2Z35B 4CADB 2KL6A 2AJZB 1T21B 2YZ1A 1L0QA 4ZSOB 4ZUUA 3CFKB 3RWEB 2DKUA 1MREH 1JVKA 3TV3H 4EIZC 3NOIA 2R69H 4OCYH 5C0FB 1T0NB 3ULSB 3QQ9D 4H88L 5HXMA 2APXA 1W0VB 5GRUH 4BQ8A 1ONQB 4M6ML 4HAFA 3MOQA 3FQUA 4JY5H 4ELMF 1AI1L 1G7HA 2BVQB 4JFDE 4C57C 3AS2A 3QXAA 3IETB 5DMJB 3MRDA 1RD6A 4NNXB 1BLNB 3MQIA 5D1ZC 4P9HC 4NQEE 1CFNB 2CDGB 5DJXB 2BY3A 3I6GB 2QR0B 4R4NC 2VLME 1HHIB 3N1MC 2NYYD 3FB8B 1FL6A 3IFLL 1K8DA 3BISA 2B0SH 3L3OA 1AR1C 1NLDL 2BNRE 1WBXB 3F7QA 3H3PL 4EN3B 4LRNH 3PF2A 1QR1A 3RWCA 5E2UH 1AGBA 4Q58C 4PREB 1G7LA 4N1HB 4LP4A 3JVGA 2VLKB 1YA5A 4CJ1A 1MLBA 3OKDA 3BP6A 3VFTA 1KN2H 5IW3A 2ARJQ 1FV1B 5C92A 5KW9H 3B9AA 1M71A 2XXCB 3G6JA 4G80B 4JPKH 2ZUYA 1UXSA 1I7RA 4PJXA 1L9MA 4KI5D 3P4OA 3BDBA 4U6TA 3WNPA 1WSST 3WDIA 3BZEB 3BPOB 4KRPC 4JM2B 2Z93B 3U7YH 2IFFL 5B8CC 5DMIH 2A77L 2K1MA 1S8DA 4QRRE 4WUUE 4Z7UA 4DCQA 3DETC 3IFOB 5FO7A 5IMLB 3P77B 1YPZA 3WIHL 5A3IC 3MROA 3GI9H 1QO3A 4LKCB 1XGYH 4GRWB 4H26B 4MXQC 4N0FB 1S7RA 1XIWC 4JDZA 4NO5B 4PJ8B 4HJJH 5C0CA 3STLA 3IXTA 1EPFA 3E1F1 3BP7B 1L0XA 3G08A 3OBAA 1S9VA 2Y06L 1PZUB 5E4EB 1KBGL 2H32B 2BNUA 3T2QA 1Y6MR 2LVCA 1OPGH 2D4DA 2VYRE 2LAGB 4JB9H 3V6ZB 2YPLA 1JK8A 5IEHA 1I85C 2A6JB 4JGMA 2PW1A 3IAGC 3D3VD 2H26A 1UA6H 2AKRA 4XAWH 3U46A 4ONOA 3TBVA 4TNWF 5I1HL 3DX9A 4NP4L 3WFZA 4R2GB 3S3PA 1JYXA 3B8YA 3QWOB 1MJJA 2EDWA 1W0WB 1N5YL 2C4XA 2VLLB 1ORQA 4L3CB 4K3JL 3BZFA 4KK9D 2DTML 3HR5B 1RK1B 2JCCB 2L4OA 3D3VA 4HUVB 5E8NB 1A1OB 2WUCL 2HFTA 3PE9A 3GMLB 4MJIE 5HYIA 1M4KA 1R3LA 3LZFL 5MI0B 3I75A 3RGHA 3MRGA 3PL6D 2BVTA 2Y5EA 43C9B 4CVXA 1DBJH 1CDBA 1KV3A 1PD6A 4LLVB 4QXUL 2E9WA 4JM4L 1DEEA 4B50A 4POYA 3L7EA 3QEGL 4YK4C 4NT6A 3FRPA 1U8JB 3O0RL 1K85A 4N9GA 2BSTA 4BH8B 2YKLH 2A74A 4HGWB 1XR8B 4HWNA 1CXHA 3TPUA 4RGMC 2UWEE 1JZ8A 1UADC 1GGIL 3I9GL 4Y5VB 3WKML 1MCPL 5IVZA 2DQCL 3DROA 3ULVD 4N8CH 1LDPH 3HI6L 2R0WL 5I66A 2FNBA 2LU4A 3ULUE 1OAUL 4LGPB 5F6IC 4LDOB 3U6RA 1WZ1H 1CBVH 5BJTA 3GSNL 1NCCH 1RZ8A 5IMKB 4G7YH 5F9OL 1RUPH 4ZXBD 1CGUA 1A6WH 2UY7A 4MNGE 4WFHE 2BY2A 4HUKB 5CMAB 5D1QD 4XMKH 4PJIF 2G5BB 1F8TH 2DQJL 5BS0E 3KLDA 2FJFB 3BWAB 3IJSB 4HZLB 2FIKA 3HRZB 4UV7H 1NKOA 3NCYS 4HIJA 4X6DB 3WE6A 3M8OL 2X70B 5EZLB 2XXMB 3MZTA 4ZXBA 4HQQH 3UJJH 3B9KC 2YWYA 1CYGA 4XB8A 4LRIC 5GGTH 1H0DA 3I6LE 4GKZA 3ZTNH 4X99A 1XGUB 5D1QA 5EIQA 3ALPA 3C6LC 5EORH 3WLBB 3LHPL 4FQXD 1FE8H 1LP9A 4BZ1H 2R2HA 4Y88A 5DFTA 5DA4A 5CZXD 1NAML 2H2SC 3N50A 4HXAH 2DJUA 3B2UC 1V7MH 1QNZL 4QF1B 4IRZH 4JDTH 4PD4K 1P6FA 1BVLA 2FATH 4JFOB 4J4PD 2FO1A 3UTSB 1OTSD 1WFNA 3CXHK 1BQLL 1MCDA 2IMMA 3L7FB 4JHZA 2P5EB 4Z0XB 2X1XR 2O61A 4PRDA 4NZTL 1T7WA 1GGBH 3SO5A 5A2IH 2F54B 4WCYH 2BY0A 3E6HA 4UU9A 4S1RH 1ZT4B 2VXVH 5HHME 4HPYH 5HDOA 4XRCB 1N2RB 4EEEA 4X5XA 2NPLX 3DYPA 4N8VB 4J4PA 1HILB 4JO1H 4Q2ZB 4LLDA 4UNUA 1GZQB 1WICA 2PUQT 1KC5H 1QLRB 1RJLB 1FRGH 3SJVE 1JN6A 4WFFD 3BHBB 4UB0L 2AV7A 3ZSSA 4HV8B 1IAII 4LGRB 5FO8B 1MIMH 4D0BA 4ODTL 4JFPB 3FAXA 1D5IL 1LQSR 1EO7A 4MJ2A 5KN5A 1IQWH 2WWMC 3QZWB 1J10A 4IOSD 1RURH 5D96B 4XWOD 4P5TD 1H8SA 3U0PB 3EYVB 3EAKA 2IALB 4JO4H 4EKXA 1AIFA 2KH2B 2P7TB 1W8NA 3K80A 3ARTA 2XWBA 2I5YH 5KVDL 3PV6B 4RFNC 5F1IA 1RK0B 5T3ZE 3RWFB 1U2CA 5L9DH 4C56E 2NZ9D 4XXDB 1A7PL 1QA9A 3FQRB 4Q74A 2Y36H 5AZ2L 1BM3L 4JM2D 4WHTA 4P5TA 4MMXC 3CX2A 5F71A 4PLKD 5IHBA 3BYTA 4H25A 4LLMB 1FCCA 3IVKA 3VFGL 2CKBA 4DGVL 1MJUH 4F2MA 1MAMH 1IFHH 1S7XA 2DF3A 4Z7WA 4YR6B 5DTFB 3WO4B 5GRVL 3GSVB 4UT7L 4FQ1L 2HFEA 3MXVH 4ODSH 1K6QL 4TVPD 3GMNB 1XF1A 4S0TD 5DGRA 3G9VA 1P7QA 4OUUA 2Q6WA 3BPCB 4K3DH 5D7IA 3V95A 5EBGA 1UT9A 1T1WA 1A9BA 4NQDE 1SJHA 6CGTA 2WLYA 3AY4A 2NXZB 4M3KB 4G43A 3RY6C 3SGJA 3GHBL 1MLCA 1IKFL 1I8MB 5KSBE 4U1GC 3OAYH 3B5HA 1VHPA 1FGNH 3N1FC 2ORBH 3MR9B 5T3XD 4HDIB 5HVHC 4PRNA 5DYOA 1A5FH 3HS0B 5H35B 5C0IB 4WEBH 2VKXA 3QEUA 1I1CA 4HJ0D 2AXHA 4MHHI 1EEZB 3SCMD 3KYKH 3HUJF 1U8HA 1JWMB 1RUKL 4WU7A 4GRLC 5SV3A 3QDMD 2E7BA 4L4TA 3X3GH 3U79A 2BDNL 3SE3A 3W9EA 1LD9B 5CIPB 1OTTC 4L8SB 4Z7OE 5IJVB 2CH8A 5HTSA 4F58L 3ZTJG 4KJQC 4PV8B 5FHAL 1KENL 3SCMA 1CE1H 3VXME 1IC1A 5DUBB 1FFOA 1XCTA 3QDMA 4U31A 1DCLA 1KFAH 2ZZUT 4J3SA 3RNKB 1R3HB 3QQNA 1HHHB 1CFSA 1CDIA 3NFPA 4KKLD 1F45A 4HCRL 2W9EL 5DQDL 1G9ML 3D69A 3B9DA 1K4DB 1XGTA 1XR9B 1S9XA 3SE9H 2XN9E 4OCLC 4WFGE 5KSAD 3NCMA 1FCGA 1V3JA 4R8WH 5ESAA 4R4FL 3F65A 1J11A 3L3KB 4P2YA 4Y19E 5HI5C 2DQIL 4YBHA 2Z0BA 1FNHA 4I3RL 4KVCH 5DD5H 9CGTA 3MACL 3B2VH 1FBIL 3P30H 4P5MA 3GSXA 1KT2A 5EBWA 4LVOB 1T1XA 5KSAA 1CGVA 1OGTB 4LSDA 4NQEB 4NYLA 3LCYA 5H94B 2DI8A 3BH8A 1YY8B 1KB5L 4YJZL 1TJGL 4PPTA 3GRWL 4ZD3H 4ONFL 5MERB 1I1FA 4H0GA 1GCFA 2BVPA 4KZDL 4ISVA 3MFFB 4PR5B 3O4LD 2P4AB 3LVEA 4OBRA 5GGSY 5IKCB 2DQDL 5EZJB 2AJXH 2R0ZL 1CLOL 3BZDA 2XKNA 3I02A 3INUL 5J6GA 2B4CH 1AH1A 5CEYB 3E8UL 5KS9F 1JNHB 3EYFB 2MCG1 4Z7QE 4QXGH 3RIFF 2PW2B 3UTSD 4LMQE 1QLEL 1C5BL 3O4LA 5DVOA 3TIDA 4KJYA 4PB0H 1YEFH 2XY1A 2P8LB 4GKNB 3WIIL 5C0EB 2I9TA 1FYHB 4KUZH 2EDTA 4CMMB 3MLSH 2F5BL 1D3CA 1DBBH 2ED9A 3V6FA 1WISA 3QDGD 4PYHA 4QRRB 3N1PC 4WW1A 1K5NA 4S2SA 3X14B 4JG0L 3UYRH 1LO2H 1YN6B 2FEEI 5LGJB 2B1HH 4ZTOL 3CMOH 2R0KH 5F7EH 4QRPA 5ABDE 5DD3L 3IDNB 4NJ9L 4QHKI 2X42A 4LCUA 3JUYA 5IHZA 3OKKA 5I8KL 4X9BA 5CKGA 3RGVD 4AEHH 5TDNA 1EERB 1JF1A 3RUGA 1T22B 2COQA 2YD9A 5IHLB 1KLFA 3QDGA 3NCEB 5BRZE 2V5YA 5CHNB 1K8IB 2VSDA 2ATKA 4X7TB 1Q9KA 4ETQA 3X12B 4XPBL 3O6ML 4YWGH 4J8RB 5ID1B 3RGVA 4S1QH 5FUCC 1NMCB 1Z3GL 1PFCA 1IGMH 3ZKMC 3CLFH 5BZWB 1KTLB 1S7UB 3BIAX 2B1AL 4WENB 5LWYH 2Z91B 5HGHB 3RJDA 2CRIA 4OFKA 3KPOA 1KXTB 3OKNA 4YDLC 1QSFD 2IWGA 4GQ9L 1Q9WA 4OZHB 5JW4Q 5CD5D 4RRPA 3C8KB 4YPGA 4KV5E 4LNVA 1DN0B 2FO4A 1XGRA 2EZ0D 1DQQA 4N1CA 2ICWA 1H3XA 4HXBH 4ZG1A 4N0UA 5IB1A 3MOAL 2X10A 4MJIB 4Y5XB 5CEZL 3VFVB 2FBJH 1QSFA 1LILA 4RGOL 5DT1L 5GGSA 1KIRB 5DJ6A 3OX8A 3NA4A 4OGYL 4F7TB 3KPSD 1GHFL 4M1DL 3L3HB 3TP4A 2ZCHL 3N1GC 2UWEB 2JKXA 3QEHA 5IBTH 3A6BH 3MBEB 5HI4C 1FFNA 5HHXH 1SEBA 4FQ2H 1I9RL 3VWKB 5K9JL 1L7TL 3D2UB 2QADB 3GGWB 3MV8E 3MRRA 4OIBA 4TTDD 5DJAA 3W9DA 5TE4H 3PIQA 3VGGA 3KPSA 1EAPB 4P4KC 3F7VB 1HSBA 5DVMA 1TQBC 4JVUA 3NH7L 1JZ2A 1N8ZA 3LPFA 4OF5A 1OGAD 4DZ8A 2DQTL 3M1BB 4I5BA 4MNGB 4XP9L 3H9HA 4J1UB 1RPQA 3ZT6A 3QCTL 2C3WA 1F4WL 4G9FE 4K94L 3U9PL 4RDQF 1DJSA 4LPVA 5BS0B 2JJWA 1E4XL 3GNMH 4H5SB 3Q3GA 5IFAH 5T5NF 3KXFE 1A3RL 2D03H 5HHOE 1NC2B 3W0WA 4HUUA 5D8JH 4OJFL 4XNQA 1OGAA 4NM8L 5IFJB 1A3QA 5MEOA 2C4FU 4XNXH 3PHQA 4TRPH 5EU5A 1I3VA 1ORSA 3NCJL 3IGAA 2EDRA 3DRTA 2EDLA 1NCNA 4ZAKC 1L7IH 1RFDH 4XHJD 3AS0A 3S36X 5D5MA 5DQJA 5FKAB 3IDMB 4GS7B 4JZNB 2VZ3A 1BIIB 3DX7B 2OYPA 3MSPA 4NN6B 4OZFA 5C08A 2BZDA 1WZMA 3WUWA 2CR6A 3DARA 3G9AB 1A4KA 2ZJSL 1AO7E 3IU3B 1II4E 5CBEB 1BZQK 1A7NH 4ODXA 1R5IA 4GBXD 4X5WA 1IE5A 4Q0XH 3LN4B 2IF7A 4DGYL 5ICYA 2P8MB 2OTUA 3MUZ1 4WDIA 3CVHL 5F89B 4GAGL 3P0GB 4PJBF 2M8XA 4Y16B 3QNXA 4PJCA 5C0BE 3JV6A 3MMEB 5TFSL 1SBBA 2E27H 1OY3B 5HHMB 3PABB 5FB8A 1JI2A 3QFJA 4YHYB 2I60H 3CSYB 4CL7A 3EOAA 3ILPA 5CBAB 3AB0B 4OTXH 2QSCH 4FXKA 1OF2B 4PJ5A 4XPHH 3DX6A 4DAGH 1PLGL 4GBXA 4Q9QH 1OSZB 2PO6B 4MD4A 2H3NA 4OZIA 4A6YB 2H8PB 1FZKA 1YNKL 4OGXH 1I8KA 4N90E 4ZFGL 3UZEA 1HEZA 1MCFA 4MDIA 3MTRA 1E4KC 4TYUA 3LPWA 1U8LA 3UROR 3L3IB 4JRXE 2J8HA 2DIJA 1S5HB 4DWHA 5INDA 1H3TA 1INDH 3I3EA 3MFGB 3HE7D 2X4NA 3W2DL 5CLWA 3MXWH 1QFPA 2H6PB 1KXVC 2CIKB 1ZLVK 4KGJA 1LEGA 4BFBD 5IMMA 2AVGA 1YC8A 1U3HD 1MAKA 3MUJA 2UV3A 3AREC 4WTZA 1REIA 1UB5A 4K07A 2DLGA 1QD0A 4OI9A 1MREL 3TV3L 4C56B 1GRWA 3RRQA 4OCYL 2J88H 4LCIH 4NNYA 4NM4H 3HE7A 1ZLUK 1NQBA 4Y2DB 4Y5YA 5FYKH 1WAAA 1NGXB 3RTQD 4IOFD 5DJ2A 5GRUL 4K55A 2J1KA 3HG1E 4RMTA 3DECA 4JY5L 1U3HA 1N59B 3CX5J 2ADFL 5JXED 5JW5B 3SDDB 1T4KB 3MV7B 3SDCC 1BOYA 2WAHA 5DRZA 1JZ3A 3B9VA 3RTQA 5IB3B 4K8RH 4RAUA 1YJDC 2EYSB 1Q0YH 1MCEA 3BXNA 4HK3N 3NCBB 3S4SG 1KNOB 3QHTC 5HVFB 4LLWB 4TSBL 5JXEA 5F9WB 2BERA 4LRNL 3DO7B 3BW9B 4NQDB 3DHJA 4PY7A 3QPQC 5KAQF 1D6EA 5JO5A 3BPLC 1G0DA 3S98A 5IVXE 1Z5LB 4EI5D 2V9RA 4LQFL 4JR9L 2WQRA 3VDCA 5KSBB 1R5VA 2GT9B 4P23C 1KN2L 3SPVA 1FL3A 4LKXB 4M8VA 5EBLB 5KW9L 2ADJB 3RDTB 3FQXA 3T8XB 3PWUA 4JPKL 2HN7A 2F74B 3CXDH 1ZMYA 5F21B 1DANT 1KEGH 3SE4C 4OLWH 3QJHA 3O45A 2DTSA 2GFBA 4N0RA 3KPPA 1MFCH 3R06A 4EI5A 1ETZA 3U7YL 1CQYA 4EUPG 3V0VB 4MHHG 3CH8A 3CH1A 3KNBB 5DMIL 3TBWA 1WV7T 1NEZG 4GG6B 3NIFF 1NBYA 3FOLB 5D9SB 2FJHA 4NQTA 3GI9L 1PYWA 5INCB 1XGYL 4PGCB 3UTTA 5BW7A 5CSZA 2J12B 4HJJL 1HOCA 3JV0A 3VXMB 5BCAA 4PLOB 3LN5A 3TFKC 4PJEA 1U8QB 3SY0B 5I73C 4HS6B 5IG7A 5FDWB 3VFSB 2OJEB 5HHNB 1UEMA 4X0KA 3QIBB 5TE7H 4KK5C 2MMXA 5ITFB 3ESVF 1NGQL 3BD5A 4JREB 1OPGL 4HWBA 5I18L 2OMBA 2D0GA 2XN9B 2A2QT 4JB9L 2BC4B 4MD0A 3TH2T 3QO1A 2E6QA 4G6FB 4DK3A 1M7DA 3LRGA 1MCRA 1YUHB 4Y19B 1NJ9A 1UA6L 1A1MB 1NPUA 1FSKC 4AZ8A 4RGNC 1NEZB 4HX1A 1B88A 3O81A 3TN0D 1LK2B 2GJZB 4P3DA 2CD0A 2H9GA 4PRBA 5EU3A 3PWPE 4L9LC 3KG5A 2HRPH 3QIWC 1ZK9A 4QTHA 3PHOB 4PRIB 3RBGA 2FWOB 3QUYC 5AUMB 3HA0A 3NGBB 3QT2A 3TN0A 2CIIA 2K9UA 3ZHLA 3HPLA 2N7AA 1UZ8B 4ZOBA 1MY5A 5CEZE 4DOHB 4F7CB 2ESVB 3EO1B 2C3VB 4NO2B 4XVUC 1BZ9B 5KSVB 5IHUH 3VXNA 5SX5H 1BFVH 1HXYB 2X9YA 2YKLL 4LNRB 3O3UN 3EYQC 3ARFB 1D5BB 1H3GA 3DVFA 4OFYD 2J4WL 5B4MD 3VRLF 5IV2A 1YPZF 4I4WB 4KI5F 4O02H 2PF6A 3RVUD 1OTUC 2AJ3A 3OXSA 2ILLA 3FQWB 4LARH 1EAJA 5DEZA 4OSUL 4N8CL 1LDPL 5E6IB 3MV9E 5I1EH 4P46B 3MRNB 1WLHA 2NY3C 4R0LB 2WWKT 1JHTA 1QRNE 1RZ7H 5DHVB 2CUMA 4KKCC 3VCLA 1CBVL 1A14L 3B3IB 2XFXA 4NBXB 2B4CC 1MPAH 2AK1H 4G7YL 4OFYA 5FYKU 2I07A 5HI3C 1JUFB 3VMPA 2HJLA 2W0KA 3V5HA 5I1DA 1A6WL 3GSNB 5C09E 5DVNA 2D7TH 2DQUL 3O8XD 1HHGB 1YMME 4I0PB 5L2JA 1F8TL 5DK0B 1R0AL 3ET9F 4X98A 2BOCB 4UV7L 1NAKH 4EVNB 2IANE 2AP2A 5E94A 4BSWA 3TBTA 1LE5B 2W9LA 3GIZH 1NFIA 4HQQL 3UJJL 3RI5K 5IB4B 2DL2A 4GAFB 5BRZB 4X6BB 4DEPB 1MWAH 3ZTNL 1MCSA 4ZNEA 3O4OC 3O8XA 5E2TH 1CLYL 1FE8L 4GKSB 1D5XA 4KY1H 4BZ1L 5DMKB 1NBQA 5DSCA 3NAAL 4BK4A 2YBRA 2BVUA 5GIRB 2I24N 5J11C 8CGTA 4XZUB 4HXAL 1TVBA 1V7ML 4MS8C 4IRSC 1G6RA 4IRZL 4JDTL 1NAMB 4ODWB 2FATL 1IQDA 5DI8B 4DTGH 4Y2DD 1N26A 4APQD 1PQZB 1IGTB 2FD6L 1S7VB 2Q76A 1BOGB 4G8IA 3V8CA 4WI8A 3EGSB 4ONGH 3D48R 4WCYL 4NKMA 2R29L 3EJYD 4S1RL 1SYVB 2VXVL 4HPYL 3W39B 1HQ4B 4ZOAA 1WVZA 2FSEB 3PNWB 4OFIA 3MV7D 1VB9A 1U42A 2VL5A 3F7YB 4JO1L 2W0PA 1S5IH 4LOUD 1HWHB 1IGFH 4S1DC 3C87A 5MHSD 4KMQA 1T04A 4WGVB 4APQA 3T65A 1KC5L 1XF2B 1FRGL 4OUOA 2K3TA 3MNZB 5EBMB 1KCUH 4HKJA 4P2QE 2HTKC 3PQYD 1MFAH 1AHWB 1QBAA 1DFBH 4QT5A 1GAFH 4F7PB 5C07D 3HFMH 3ELAT 1KEML 1YNTA 1MIML 3HRPA 4P57B 4PJFE 5A2JH 4YHIA 2HLFD 4E42A 2AABH 2VQTA 3STZB 3RL1B 1FG2B 3ULVF 1VEMA 4O2CB 1M7IA 1RURL 3HKFA 1J1PL 4JO4L 4CW1B 1N3NA 4TUKL 3GSWA 5LKNA 1UB6B 3HMWH 4RFEA 3RDTD 4POZD 3LQZB 1BIHA 2E8ZA 3PQYA 2I5YL 4HIEB 1DUYB 3MV8B 5C07A 5JOPD 1LE9A 2R2BB 5DWUH 3W82A 3SEPA 2FLRT 4LSSH 2BX5A 3EYOB 2ED8A 1UJ3B 3FB6B 4NQVA 8FABA 3MLUL 2Y36L 1CD1B 4YDKH 5IB2A 3KHQA 4LSUL 3GJFB 4G9FB 5MEQB 5I17A 3ULVH 5DEGA 1TJIH 1TJHH 1MJUL 1FP5A 1TPXB 2Z31C 4YXKH 3U2SB 3KXFB 4HLZG 5HHOB 1ZGLA 5IR1A 1FORL 3MXVL 4ODSL 2J8UE 3ROOA 3C60C 1XFPA 3HAEG 1ACYL 4YNYA 1U8IB 4UILH 3QI9D 3F7RA 4K3DL 3MRLA 1Q0XH 3DIFA 3ILQD 5IIEA 2GJ6E 2DICA 3SGDI 4LPXA 1P4LB 4JFFE 3CC5A 3WJLA 5KOVC 4HBQA 3PUCA 3QH3A 4JZJC 4JLRA 2WWKO 2W91A 5IW6B 3RQ3A 3NCYP 4Y8DC 4QOKE 4ELME 1AO7B 1O0VA 1JNNH 2YXMA 4RAHA 4WW2A 4Q97A 2P24A 3HPJB 5F97E 5F6HI 3QI9A 1FGNL 1NMAH 4M9OA 1MUJB 1ZTXH 2ORBL 1INEL 1CVRA 1A5FL 2D31A 2VTFA 1CTOA 2YS4A 3LV3B 5C0BB 1LEKA 1P2CB 4ONHA 4HAGA 3CFIC 3FT4B 3KYKL 3VGBA 4G6KH 3T1FB 3TYFA 1MFDH 1KLGA 2HKFL 2VDQH 2Z9TA 4AM0B 3GBMH 2ITDA 4IMKA 5C0RL 4PRID 4PP1C 1JPGB 3X3GL 1JYWA 3MRCA 4G8GB 2PN5A 4LPWA 3LRHA 2HTLD 4HD9A 1QBLH 5ILTH 4WI2A 5GS1C 2YK1H 2P5WD 3QXDB 4L3EE 1KGCD 1Y0LB 1ZA3A 2V5RA 4JRXB 4QHMA 2ESVD 1CE1L 5D2LA 3LKOA 2X09A 2KDGA 4WU5A 2FHCA 4HT1H 4FFWC 1YEHL 1MAJA 1PSKH 1IJ9A 1HQRA 5FUCE 4PLJC 1KFAL 3DUHA 1VGEH 3MPCA 1G7PA 3T0AA 4Z7WF 2WBKA 1UWXH 3QFDB 2P5WA 5E6ID 3VXOA 4FTVD 3UBXI 5D72H 1BFSA 4JM2F 4NFBA 4MQXD 4KU1A 1MCWW 4R8WL 5E24E 5JOEA 3VFRB 5IM7A 2ZUXA 3BIBX 5F7UA 1IT9H 1W72L 4NHUB 4I0KA 5D7IF 4C58B 1Z2KA 1KJ2A 3HG1B 3MRMA 3TNNB 4QRTB 2FYYB 1F5WA 4YGVB 3B2VL 4GRWF 3O41B 3P30L 4FTVA 4I0PD 5BOZG 2AQ3A 2G2RA 4X6EA 2IBBA 5CJ8A 2UUDK 1CXIA 3HZKB 1YDPB 1NEUA 3EDDA 3MRHB 3QQ4B 1BPVA 1YEDB 3LKPA 4MNHB 3DV4B 3EO0A 4JKMA 5A40E 4XCEB 3H7LA 5CILL 5HHPA 3OWEA 2KQNA 1KB5B 4X7EC 4Z5RA 2BXYA 2BSSB 4LEOA 3IXAB 3TYGH 1ED3A 4EBQL 1I8LC 1ZS8A 2F58H 3ARVA 4GRWH 3ARDC 3BQUB 5IVXB 1Z0MA 4X9GA 4OLVH 4JFZH 4Y4FA 3H7BA 2ZUQC 1T66C 2J6EA 4PJHA 4F8QA 1K3ZA 4L8CB 3GDBA 5JPNB 4QXGL 2DI9A 5M94B 4F9PC 3DYOA 5I6XC 3OKYA 4DVBB 1CZ8H 4GUPB 3WKNA 4HF5L 2C3HA 2VWEE 1T0PB 1JGEA 4PB0L 1YEFL 1YZZA 3RIAF 3S5LG 4EXPX 3T2NH 4R97C 5HSFA 5IQ9B 4J7RA 4KUZL 4CJ0A 3FFDB 1DANU 1RZGA 3DVIA 3MLSL 5T1MA 4UUJA 1DBBL 4M1GH 3NMEA 4M6NL 5C6WH 3TM6A 2VDRH 5DJZA 1ZEAH 2V5SA 3MRQA 4NO0B 3THMH 3UYRL 3TF7C 5T3XH 1ADQA 3TGXA 2R0KL 5F7EL 2P49B 3CPLA 3CFDA 1D9KB 4QRSB 3QO0A 4AEHL 4RNRA 5DK2A 1KCRH 3GEWB 3HZMB 3LRSB 4HIIB 5BVJA 5F72S 2QSTA 1QSVA 4LU5H 1AY1H 4L8BB 1J0YA 1JRHI 1M6OA 4ZYKB 4HUXB 4MZ2A 2YC1B 4TQEH 1EBAA 5J9PA 2WIMA 3V0WH 2PYFA 1A6AB 4JPVH 4YWGL 4Z76B 4O2EB 2DBJA 4S1QL 2VDMH 5IT2H 1IGML 3L3GB 1NCTA 4FNLH 3PGCA 3TT1H 4HC1A 5LWYL 3ECBB 3FT2B 1ROWA 1NDMA 1A8JH 1BQUA 4KHXH 1LO4H 1U3JA 3PWPB 4WEUD 4H0IA 1G1CA 3DMMC 4JFYB 4JFHD 4F9LC 2R9HD 1WCBA 2GAZA 2ZSWA 2HH0H 4D9QE 1UKTA 3TIEB 1OAQL 5HYQA 4HXBL 3IDYC 3H2WA 1P7KA 4ZO6A 5C6TH 1EVTC 3DYMA 2FBJL 2D4FA 2FJGB 2R2EA 5EUOB 5D93B 1CFVH 2XTJE 3LMJH 4OAWB 4NCC2 3MLVL 3WXVL 2PNDA 3GSQB 3KPLB 3IJHA 2A38A 3L3DB 3SGKA 3PDOB 2Y9RT 3S96A 5HHQA 1Q9LB 2LFGA 4QTIH 5IBTL 3A6BL 4QHUB 2FIRT 3KPMB 3QAZB 4W81A 4ZPVA 43CAA 4XBGB 2G9HA 2LU3A 1M05B 5HHXL 4FQ2L 5A16B 3MV9B 1RMFH 4XC1H 4ZPTB 3V4VH 3HI1B 2VZUA 3FFCE 2V2XB 2Y6SC 3G6AA 5GJTH 2HT3C 1H8OA 3NABL 5DRXB 1S3KH 4ZFOL 5DO2D 3TO2A 6FABH 2DN7A 4HKZB 5C2BH 5DS8A 2AQ2A 1MCKA 2OZ4H 5EA0H 5IK3A 3G5VB 4G42A 1AGEB 5I1LA 1YMMB 3OKOA 2OMNA 4G8GD 1DZBA 3PWJA 5IFAL 3GNML 5ID0B 5HYSG 2D03L 2VXTL 5I16A 2IANB 5D8JL 1UWGL 4U1IB 5I15H 4MA1C 3T4YB 3GMPB 1KG0A 3C09C 4TRPL 2YN5A 4NWTH 2A6DB 1KPVB 4AQOA 5EN2A 2XY2A 5KANI 2W0LA 1L7IL 1RFDL 1YN7B 2GUOA 3MLZL 3MO1B 3QEQE 4UNVA 2EDOA 2XG5A 2JB5H 1T5XA 3QA3B 3UJTL 4KUCD 2IH1B 4NBYB 2ICWI 2D9CA 1A7NL 4Q0XL 3RWIA 3MRBA 1RUQL 3AXLB 5F7FA 4B7LA 3T0EC 3WV0A 4N9OB 1EHNA 1UWEH 1DEDA 1JWSB 4WGWB 3OAZH 1NGPH 1UKSA 1L6XA 1ZGLP 2H41A 3CVHB 4MAYA 4JKLA 4TULH 2E27L 5HYSB 3X13A 3GHEH 4ORGB 4ZFFA 2I60L 2D0HA 3LKSB 5B22A 3GJEA 3MLYH 2QSCL 4OTXL 3DUUA 5BXFB 1KPRB 5F93C 4Q9QL 1WCQA 1DLHA 5CINH 4U1HB 1HHKA 1KLUA 3GIVB 1QSEE 2JK5B 4LVEA 4KVNH 4PJFB 1VKXA 3D25B 2FR4B 1L6ZA 3BQUD 4JO3H 4MCYA 3OQ3B 1A7QH 1ERNA 1DDHA 3PP4H 4IMLB 3MNWA 4MSWA 5CSBA 2EXWD 3HUJE 3TH4T 3RA7H 5DDHB 2O93L 3OGOE 2VE6B 4RGNE 4OZ4A 1GH7A 4KROD 5F7KC 2JELL 3VXUB 5K9KB 4JFED 4QRQB 1EEUA 4LCIL 1F11B 1P84K 3QJFA 4NM4L 5FYKL 5GHWH 5BV7H 4ZS6D 1U3YA 1T7XA 2E9IA 4LCCC 5CEXA 4LCWA 3PL6C 3MYJB 3DBXB 1YNLH 4NQCD 1F3RB 1FVEA 4U1LA 3HC0B 2MHAA 2IAMD 4JFEA 2DQFB 1U8NB 1R3JA 2R0LH 4FQHB 4YO0A 1F2XK 2OQJB 3FT3A 2X4OB 5I75B 4W4NA 1WFTA 5EO9B 5DLMH 4UDUB 2DDQH 3HTLX 5KG9B 4K8RL 1X5KA 5IF0B 3BGFB 2GTWA 3OB8A 1YEGH 3P9MA 3KYMA 4NQCA 2VN4A 2GJ6B 4UQ3B 4XH2A 5F3HA 4ZUSA 2UYLB 5HY9B 2AW2A 4FMFA 2IAMA 4JFFB 1LHZA 4LAQH 4WUKH 1T03H 5CGYD 1CI5A 4UBDD 4OZFH 5D7LD 1UM4H 3OKEA 5FYJD 3BE1H 3MA7A 4QOKB 5F7NC 4ELMB 4OZIF 3TJEH 1PZ5A 1KCKA 1A6PA 4BSVA 3AAZB 4WV1A 3DNKA 2M26A 2UVEA 2YRLA 4NQSB 5GGVY 1KEGL 2BOBA 4OLWL 2QQLH 4PGEA 3MGTB 1BQHA 3IJYB 5D7LA 2VDLH 4XX1E 3RWJB 4H20H 1G7QA 4LLYA 1A21A 4JAMA 4XCFL 1YQVL 1CDHA 5I8CA 2C1OB 3C5JA 4XTRC 4OCXH 4D0CA 2LTQB 1U6AL 2PXYB 5TDPA 2EYTB 4FQXC 2ATPB 2XKSA 1E0OB 4X4ME 3P4NB 3REVA 4L3EB 5KS9E 5CZXC 4C59B 1EVUA 1ES0A 1KIUA 3BN9D 5CP7A 1A1NA 1B2WL 1WAAF 5HVGB 3VRJA 3QUXD 3RWHA 1P69B 2GHWB 4ESKA 1OTSC 1FNGA 2D7MA 3PP3K 5HDBF 3K1KC 4U6HA 5TE7L 3ARBA 4JKKA 3QDHA 1IGCH 1N64H 4Y7MA 2GY5A 4AY0A 3DO3A 4OM1H 3MX0A 5CD3A 5E00A 3RPKA 3QUXA 4Q9CA 5DUPH 1FZMB 3GSRB 2BMKB 3UBXG 2D7OA 4FQIH 1AXTH 4WWKB 5JTWA 1J0HA 4OF7A 1EO5A 3IDIB 3P40A 5I2IA 3IDUA 3U36B 1NSNL 2VSCA 3LOWA 4HFWA 3FB5B 5DRNB 3DGGA 4JJHA 4MXVF 2ERJB 3OHXB 3MRKA 4GSDH 3U48A 2DD8H 2E7LA 4EN3C 3TBSA 1F90H 2HRPL 5ESVA 1FZJB 3QNYB 1I9JH 3MJ7B 5GS0C 1AGDA 3NZHH 5E9DE 1J1OH 5FUOH 2VITA 1T83A 4U7MA 3EOBB 1EGJH 3F6LA 1KYOK 3T2OA 4H1LB 3LKRA 1MRFL 3NN8B 1UGNA 5IWLC 3EHBC 5FV1L 4I9WE 5ELIA 4NKDA 4J3XA 5CJQH 2ADIB 1F6LL 3TBYA 5ACZA 4OZGA 4YAQA 1NFDA 2ZOLA 3OGCA 1F4XH 4LL9A 1BFVL 1IEAB 3BPOC 4JM2C 3SDAB 4GW5B 32C2A 5FF6A 3K7UA 4O02L 1QFWI 3BP5A 2BSRB 1ZHNA 4G8FA 5I1EL 4OZHF 5MEND 4XNYH 1N4XL 4Z18A 1RZ7L 4PJEF 4KKNA 3BEVB 4PJ8C 2X4UA 3U9UB 3JSSA 3MV01 3O6FB 4KTDL 2AK1L 1DLFH 4F57H 3OAYK 2NTFA 4X7CC 5CS7A 5JMOC 2GSGB 3WSQH 1JE6A 1EUUA 1ZVHA 2D7TL 1BZ7A 2P8PA 1TVHB 1R3IH 1RUMH 3H0TA 1CD0A 5DD1L 5MENA 4AEIL 4RZCA 5E4EC 3MNVA 4ZAKB 2R1XB 5FGBC 3JWDL 2CLZB 5ETUB 1HWGB 3OKMB 3GIZL 2FZ3A 4PGBA 4O2FB 3HNVH 2QQNH 2RQ8A 3G5YB 1LNUA 1PW3A 1N5AB 1CLCA 4YZFF 2N1KA 3JV4A 5HYJE 4M61B 1VFBA 4KY1L 4R2GC 4O51A 1BAFH 2OXHA 1FNAA 4DZBB 4HWBH 4DJMA 4HS3B 1G7JA 3VXUD 3RWGB 35C8H 5IW1A 4K23L 3VFUB 2DQEL 2X05A 1V8HA 5C71A 3I2CH 1AGFB 4HIXL 3C9NB 3EYUL 4DTGL 4LBEB 4F37F 5IVOA 3UJIL 5MI0C 2X4SA 1N6QH 4ONGL 3RZCD 1CN4A 3ZDYF 4JFDA 1T5WB 3VWJB 1JF6A 1YEIH 3X11B 2A83A 1B9ZA 3ARQA 3AU1B 3QULB 1S5IL 1IGFL 5IBLD 2XZQH 4JKPH 4EDXB 1KTDB 2PR4H 5DC9B 1L0YA 3Q1SL 1X5FA 1UVQA 3GMOB 4Y5VC 3JBG7 1DVFA 1KCUL 4GQPH 4XP6L 2XTJB 5MEPA 3RZCA 3ZE0F 2BVOA 4JQIH 2BNRA 3HFML 4OQ1A 3U4BH 5F70A 4Y4KB 3VA6A 5KSAC 3AREB 4XWGH 3WXWL 2AABL 1BMGA 1DUZA 4PJBE 2UVFA 4XP1H 1ND0B 3SOBH 3O2DA 1JNLH 5E1AB 5B38G 3QUMA 3HMWL 1FIGH 3CFEB 3PGFH 3FFCB 4P2RD 3FOMA 1MRDH 2DKMA 1K3IA 1WZLA 4NO3B 1P4IH 5DWUL 1ZLWH 1QFUH 2A9MH 4LSSL 1FAKT 4NN5B 1SYSA 5IEKA 3MV11 1U9KA 2PYED 4I18A 2XWJA 5DZLA 1IM9D 4WUUA 4NKOB 5FYKE 3ULVL 1YEKH 4CMHB 1BJ1H 4P2RA 1X6NA 2PXYD 4YE4L 1C8PA 1J1XH 4YXKL 4CVZA 4IIQB 1NCBH 1B3JA 4Y4HD 5DMYA 1YEEH 2HG5B 2RR3A 4R90L 3VE0B 4MQ7A 4JFXA 5BO1H 2GCYA 1MHEA 1I8IA 1NL0H 2OL3A 2PYEA 2R15A 3BPLB 2I9LB 4UDTB 2GK0A 4UILL 1IM9A 3HE6B 5ANME 3KPRD 5TQ2L 2ICES 5B38B 2P43B 3QEQB 4RQQB 4A6YH 5DFVD 3MRJB 4AH2A 4Y4HA 4CAGA 3GB7B 4WHYH 4KK8D 1XGPB 2V2TA 3I6KA 3MCLH 4J3TA 1G6RH 4LQ1A 4FRWA 5D2NE 3TC9A 3V6OC 1JNNL 1IZKA 4U1KB 2X44D 4WWKD 1CF8H 1NMAL 4H8WC 5LCVH 4OLZH 3T77A 3KPRA 1ZTXL 2ZSVA 3C08H 1H15A 5EU6E 3GBNL 4RA0C 5ADOH 1YECL 3QUZD 3GSOB 2APBA 4PJDB 4J3VA 4QHLB 3RGVC 4MA3A 1CLZH 4YHKH 5E1HB 1EXUB 1MFDL 1X5YA 1CFQB 2VDQL 2J3SA 1Z9SA 5I1GH 4UI2A 1TDQA 2AK4E 3GBML 4ZDHA 5J1AA 4Z7VA 3WEXA 4E5XA 2F53E 4U6VH 5D96C 3Q6FA 3RX7A 3M17A 3QUZA 1RVFH 1QBLL 3VXPB 2YK1L 2A0LD 2RHEA 5E5MA 1QSEB 1FYTD 4PJ9D 3B6SA 2VLRE 1TZIA 2Z8WC 5CZVL 4HT1L 5F44A 1A6TA 5F3BA 3ZHDA 2E9JA 1VGEL 3CFBB 3SDAD 4Y8AA 1FNEA 1FL5A 3RPIB 4HMEA 4Q6IA 4UIMA 4OBSA 1FYTA 1AGCB 4PJ9A 3C5SA 5D72L 2GSIB 3WO4C 2Q87A 2PCPB 3AC0A 1Q1JL 4FXGA 3NIFE 3CDGA 1J8HD 3OJVC 4GG6F 4U6YA 3O6FD 4JN2B 4F8TA 1IT9L 4IRJD 4F80A 3EDFA 3PV7A 1AKJB 1U91B 1F3JA 1W72B 5D4QA 5I8EB 4PY8I 4NQXA 4WNQA 4XX1G 5TGBA 3K8MA 5EU7E 4P9ML 4WW2F 2A9NL 2NXZC 1J8HA 1ZWIB 4IRJA 2WBJD 1QPPA 4PTUB 1NCWH 5IMOA 3GUTB 3V79C 3QDJD 5D1XD 5D6CB 2CO6B 4JO2H 2RFXA 3TYGL 1AD9B 3VG9B 3BMVA 4KKBD 3KLHD 1OAKH 3DV6B 5HJ3A 1HDMB 3IS1X 1FNFA 5EO0A 3OXRA 5F7WC 1T3FB 3VH8B 3WIHH 2FGWH 3NPSB 4TVPL 5GSVB 2ICCA 1U8OB 4U1JB 2WBJA 1HH6B 1NDGB 2OSLB 1P5UA 2HJFB 3QDJA 4D9RD 3IF1B 5D1XA 1X7QA 1QTYT 1CZ8L 2NY7H 2OK0L 3G6DH 1H5BB 1OAZH 3O9WB 4L8SC 2DOCA 5D2LF 3UTZB 1QEWB 1HE7A 2YUVA 4XBPB 3T2NL 4AEEA 1AQDB 4GW1A 2XPGA 4AQ1B 5EU4A 1KBGH 4RBPH 4N5ED 4M1GL 2NY6D 3ISWA 2VDRL 3T0BA 4OI8A 1CGXA 3PWLB 3H9SD 5EUKA 3THML 3SKNA 5FGRA 5T3XL 1CXFA 5JR1H 3SJVA 1BF2A 2P47B 4IOIA 5KSUA 5KS9B 5EIIA 5HPMB 4QHKJ 3VRLE 5GZNC 1YPZE 4KI5E 4NP4H 2XOTA 1KCRL 5HDQH 5M7QA 4D2NA 4U1SA 2NXYB 4IHOA 3TO4D 4LU5L 1AY1L 1U58A 3T4AB 2X1WL 4A2LA 5D7JB 3H9SA 4M3JA 1NGYB 3AVEA 3FCTB 2MQ3A 4TQEL 4M8QB 1X5JA 4PV9B 4NWUL 3V0WL 3RFZC 5LQBH 5L2KB 5AYUH 1Q9OA 2VDML 4LVOC 1JGUH 4WWID 5GGRY 3IFPB 4MA8H 3TO4A 4QXUH 1EZVY 3BIKA 4JDVA 3TT1L 5IJKA 3MGAA 1JRHL 2OTWB 1F3DJ 3JTSA 4NSKA 4KHXL 1LO4L 1HZHH 2R56H 3ES6B 3S37X 4LSQH 1YQ2A 4U6XA 1F6AB 2JB6A 4B53A 1BBJB 1GL4B 2HH0L 2W38A 5EO1A 3LEVH 4WO4B 1OAUH 5J12B 5E8OA 3BSZL 1KCVH 3L5WB 1MHHA 3OJDB 2CDFB 4XPFL 5JOFB 3FONA 2ADGB 3GSNH 1VACA 3D3VE 4HG4K 1UENA 4QRUB 3TZVD 2C7UA 1CFVL 3HE6D 3MRPB 3TA3D 4AT6A 1PKQA 2CK2A 3I50H 3UTPD 1ZHLB 2EKSB 2ITCA 2Y07H 2I26N 4K7FB 2DQJH 2J6EH 5E95B 2V6HA 1WUNT 5D7KD 2XTLA 4QTIL 3UZVB 4HJGA 2YUZA 1YMHB 3M8OH 3CIQA 5CLTA 5T1DH 2Y5TB 3TZVA 1I75A 1RMFL 1Y18B 2HAZA 4XC1L 4NFDA 3V5KB 3TA3A 5GJTL 4HKBB 4RAVB 1NBVL 2XT1B 1WC7B 3MLTB 4K2UH 4BH7B 6FABL 5CGTA 1UH3A 4TUJB 3HB3D 5C2BL 4EI6B 3K1DA 3MCKA 2OZ4L 3KPQB 5EA0L 1QNZH 5DF0A 2EDYA 1KJMA 3F62A 1TTFA 1U93B 1Y6NR 1S78D 1ADQH 3U4EB 3S4SA 3O3DA 3HNTH 3DVNA 4UAOB 5J6HA 5ICZA 3ULVE 3N85H 3WN5A 4HH9A 3M45A 1R5WA 1TQCC 1XCQB 5I15L 1NMCC 1Y6KR 2BRRH 4X4YB 3F5WB 4U2ZA 4F3FA 1WGOA 4ODVL 4AIZB 1T20A 4EQ3A 1HH9B 3QPXL 2C3XA 4JJ5B 1IGJB 1QQDB 3C5ZB 1BWWA 1UXWA 4UOW0 2JB5L 4LCYA 4UB0H 3JTTB 5GGRA 1C1EH 5FGSA 4P2OB 2MPAH 5KVFH 2HVJB 3RVTD 1R24A 4EUPA 4G9DB 4Y5XC 2EIDA 1AKJD 2NY5H 2DLIA 3WL9B 1XGQB 1JJUA 1NGPL 2DMBA 3KJ6H 4TULL 2VQ1A 2N56A 4BA8A 3FJTA 4JPWL 4KDTA 3GHEL 5FK9B 3MLYL 4XCNB 3REWA 4MX7A 5KVDH 1DE4A 1F4AA 1FFRA 1T89C 2FDBP 4ZSOE 4NPYB 1BVKA 2VIRA 5CINL 1HYSD 3Q5YA 3GMRA 3LSOA 3MBEC 1XMWA 5C0GB 1BM3H 4U3XA 4WEMB 2IH3B 3VWKC 3VJ6A 3TVMD 2IPKA 2QADC 5BQ7A 4KVNL 5F9JA 5E99H 1C7TA 4R7NA 3LKQA 3VFGH 1FFPB 4PJBB 3EDJA 4I48A 4O9HH 3VMNA 3PP4L 1K6QH 4ZS7H 3D18A 1K2DB 4UIKL 1D5ZB 3S36L 3HMXA 1C08B 3F12A 2Q7YB 3TVMA 1Q72H 2VDKH 4WFFE 3QIUD 5E8PB 3B9EA 5F96H 3NVQA 5SX5K 4RX4D 1T1ZA 5IOPB 1MVUA 3R0NA 2EYRA 1QVOA 5GHWL 5BV7L 5I76A 3D0LA 4HIHB 4LLAA 2IADB 3LEXB 3O3BA 1IKFH 1I1AD 1UJTA 3K0WA 5T5FL 1WFUA 2AXGA 3QIUA 4B7IA 1F6FB 3ROLA 1VFAB 2R0LL 4RX4A 4GS7C 3BFOA 1DQDL 4NN6C 3L9RA 4RFOL 2YPKB 4Z7WE 2DDQL 4PTTB 2OP4H 4LLQA 2A1WL 2XI9A 4KGLA 1I3UA 5KAQG 5E8EB 3CU1A 4YHMH 5F7YC 3KWWA 2VLJD 5LGKA 1FVDA 1YEGL 5ANMB 1I1AA 1KTRL 3BAEH 4YHPB 2DWDA 1Z6JT 4KUCF 3LB6D 4WUKL 1T03L 4Y16C 5I71B 2XQYK 5L2KD 5D7IE 2OR8A 3BWUC 4OQTA 1UM4L 1F42A 4XP5H 1JF5A 2VXSH 3BE1L 4FQPA 5D2NB 4YDVB 1ZHBB 4YHYC 4GRWE 3VFPA 5C0JA 7CGTA 2HMID 4TVPE 1MHCB 3ALWA 2VLJA 2PO6C 3BX7C 5EU6B 3KYOA 5FECA 4N0CD 4PG2A 3CDYA 1MCQA 2YD2A 3C6SA 5GS2D 2FH8A 2QKIB 1RIVH 2VDLL 3V5DB 4H20L 1FJ1B 2GQHA 5CWSA 4URTB 3GM8A 4AK1A 3VGDA 2AK4B 3BP4B 3RL2A 3MRIB 4UQ2A 1VCAA 4ZO9A 2NCMA 4TUOA 4KJWC 2DQGH 4KQ3H 4OGAC 2DQIH 1AP2B 2BVYA 2XACC 5T3XE 5DA0B 2X4QA 4U1NA 2VLRB 1B4JL 2BNQD 3L6FA 4KJPC 5J3HD 1NGZA 4DN4H 2GTZA 3AUVA 2NY4B 4ACPA 4Y2DC 4FOMA 4P5KB 1EEYB 3MLWH 5D1ZD 1IGCL 1N64L 1UFUA 1N6UA 1KB5H 3QDME 4FQJH 1RIUL 4R4ND 4X6FB 3DURB 2YD3A 3GRWH 4MDJB 4OM1L 3CCHA 3H9YA 4ZUWA 3FZUC 2BNQA 5DUPL 3SDDC 1AR1D 3IDJA 4GLRI 1AXTL 4ZUUB 1GZPA 4KWUA 4KQ4L 1X3DA 2R0ZH 1BD2D 1OP3K 2VO5A 1CLOH 5D1ZA 2DMKA 2FHBA 2Q86A 5ALBH 4BK5A 4GSDL 5F9WC 3KS0J 2DD8L 2AQ1A 5FOBA 2ICEA 3FQUB 4MB4A 2R23A 4K71B 1G7HB 1C5BH 3O2VH 1I9JL 5ITBL 2HLFC 3QXAB 3QB7C 4D8PA 4DUWA 1J1OL 3MRDB 5FUOL 3DHMA 3OPZH 4KKAC 4ELKA 1EGJL 1INQA 1BD2A 3MODH 3WIIH 3RHWK 1MF2H 5MP6H 1CU4H 3SO3B 3RDTC 1OARH 1FL6B 4KRPD 5HGDA 1A64A 2ZUWA 1K8DB 1ZV5A 5JW4M 5CJQL 3L3OB 4JG0H 4M43H 3C5ZD 2R4SH 1F2QA 1F4XL 4TNVF 5C86A 4YHZL 1EFXD 3Q5TA 2V7HA 5A3ID 1QR1B 2WP3T 3RWCB 5KVEH 1AGBB 1G7LB 4MXQD 1BHGA 5DJYA 1MLBB 4QGYA 3OKDB 5FUZL 3BP6B 3VFTB 3FMGH 5B8CA 4PRHD 4ZOCA 4XNYL 5F8QC 1M71B 3G6JB 4CDGC 3AS1A 1UXSB 1I7RB 3D5OF 4PJXB 3P4OB 3O4LE 1EFXA 4MJ5A 2E6JA 5FYJH 3EZJB 1DLFL 4XPBH 4F57L 3O6MH 3N9GH 1XIWA 3BVNA 4JKWA 2A6KA 5EUOF 4AM0A 4RIRA 3WSQL 4E0RA 4BFIA 3PWVA 3HAEA 1R3IL 4FABH 3QIBC 1RUML 2ZUSA 5F8RC 2AV1A 4PRHA 1S8DB 4Z7UB 4DCQB 3UTSE 2W60A 3SBWC 3PWNA 5FO7B 2Z8RA 4V1DD 3SDXA 1YPZB 4JREC 4Y0GA 1A6ZA 3MROB 1VA9A 3H3KA 1QO3B 4ZFZA 4LLUA 1S7RB 2EIEA 4JDZB 2QQNL 3HNVL 5C0CB 1P1ZA 1MELA 3STLB 3ARPA 3IXTB 4X8JA 4F7EA 5CP3A 3G08B 2AI0L 3QDGE 1I85A 1S7WA 5E7BA 2JLLA 1TZHA 3N06B 4PJGA 1BAFL 1S9VB 1RJYA 4V1DA 1WFOA 2N7BA 4HWBL 2QQQA 1ZA6A 2XV6B 2BNUB 35C8L 3BRDA 5DT1H 2EKJA 3P4MA 4I3GA 3J8F7 5HVWA 2YPLB 1JK8B 5IEHB 3PGDA 5IUSA 4NKIH 3BZ4A 1GHFH 2PW1B 4LHUG 5EZIH 1OD7A 2HTLC 4OZGF 2H26B 2FHFA 2AKRB 1LMKA 1N6QL 3U46B 1NFDF 1UWXK 3TBVB 4WY7H 5E6ZA 4PRAA 1F02I 5TDOA 3DX9B 1EO8L 3HLAA 1YEIL 4GRMA 4OCSH 1MJJB 1UZ6F 3FO9A 4J2XA 1JNJA 4QHNA 4D0DA 5EULV 2XZQL 1ORQB 3ARFC 4JKPL 2NW3A 4M9PA 1NCUA 4HKXA 4BQ6A 3BZFB 5L6YH 3CSGA 4JY4A 5IQ7H 3D3VB 5H2BA 3ZL4H 3QCVH 4YEEA 2BVEA 4N0UE 4GG8A 4JQIL 2DQTH 3MGOA 5E6IC 2I27N 1R3LB 2LAAA 3I75B 4P46C 3MRGB 1QSFE 4R0LC 2C3GA 2AXFA 2K7QA 4CVXB 4XWGL 1JZ5A 3DXAD 2GITA 1RJCA 1C5CH 1DEEB 5DJDA 3L7EB 2IPTH 1MSPA 4NT6B 4M7ZB 4XP1L 2V7NA 1OB1A 4YHLH 4N9GB 3SOBL 2BSTB 3RKPA 2A74B 1JNLL 3UEZA 1FIGL 4MD5A 3PGFL 5JLZA 3TPUB 4NM8H 4I0PC 5GGVH 1MRDL 2Z4QA 4KMTH 1Z9MA 1P4IL 5IVZB 3DROB 1QFUL 5EZOL 5AZEH 2A9ML 3DXAA 2YEZA 5I66B 3FHAA 1KCLA 4YBQD 3U6RB 3RBSA 5IESH 3E3QC 3KPSE 2XKUA 5BJTB 2H2SD 1S9YA 1RZ8B 4CKVX 4DEPC 3B2UD 3WYRA 2IQ9L 4UT6H 3B9KA 1QHPA 1J1XL 3L95A 4LRIA 4DGYH 1YEEL 1MOEA 4U3CA 3QYCA 3NCFB 5B3NA 1OW0C 3C6LA 4GAGH 4LIQH 5BO1L 2XWTA 1NL0L 2FIKB 4X80H 4HIJB 3WE6B 2WP3O 1CL7I 3OR7A 2EDEA 4RMSA 4ZXBB 4K7PX 1OGAE 4OD2A 1AC6A 1J05A 2NX5D 1CWVA 1H0DB 2EIZA 1I7ZA 2R1WA 4GKZB 4X99B 5D1QB 2VOTA 2CUHA 3ZT5A 1LP9B 1WBYB 5E2JA 2R2HB 4F7MA 2RCSH 3MCLL 1G6RL 3RIAK 2E8YA 3S5LA 4ORZC 1QG3A 2AEWA 2V5TA 5LCVL 2OBGA 4OLZL 5F6HJ 3C08L 1BVLB 2NX5A 3CSBA 2YD1A 2WWMD 4AIOA 3NIDF 1D5MA 1OD9A 4NBZB 4WI4A 1FQ9C 3VXSD 2O61B 4OT1L 4PRDB 1GC1H 4BQ9A 2QV2A 1CLZL 4YHKL 3FRUA 3QQ3A 5FYJU 4PJCE 1ZE3C 3E6HB 4UU9B 3U4AA 5I1GL 1T6WA 2EEAA 4X5XB 1EFQA 4QWWC 3QFJE 5C3TA 4U6VL 2NY5C 4LLDB 3NACH 2CJUL 4X9IA 1RVFL 2UZXB 4XNMA 4HBCL 5C0NC 4OZIE 3VXSA 4XP4H 1JN6B 2AV7B 1FNSL 2ADFH 3DX8A 2LQRA 5L7XH 1UJ3C 4AENA 1MCJA 4D0BB 4ZUVA 3GFUA 3AS3A 5DD0H 3ZE2F 2AEPH 5KN5B 4MJ6A 3TNMA 3QUMH 5A2FA 4M1CC 1AIFB 5EH1A 2R9HC 1TPXC 4HUWA 1I9IH 2HVKA 4FQCH 2XWBB 4TSBH 1QRNA 5F1IB 3D0VA 1R3KA 1U8MA 1HNFA 2OJZL 1QA9B 3ARZA 1CDYA 4LQFH 4JR9H 3QBTB 4WHTB 5C09A 1WAAE 4P5TB 4M4PA 4YDJA 3ARUA 4H25B 5HDBE 2Q20A 1U95A 1J5OL 2CKBB 3IVKB 4F2MB 1S7XB 4Z7WB 2OI9B 1KB9J 1NCWL 1H8NA 2HFEB 1DQMH 3CSPA 3N0PB 2Z92A 5C0CD 4JO2L 1G9EA 3ZKXB 3RY6A 3IDXH 1P7QB 1LGVA 4OUUB 2Q6WB 1OAKL 2FB4H 1NLBH 5D7IB 2FGWL 3VD5A 1QSZA 1T1WB 1A9BB 4MCZA 4Z7VF 1SJHB 3FB7A 3KLAA 1CS6A 4MXVE 3K81A 1K4CA 4YGAB 3RNQA 1HI6A 4G43B 2CLVA 1MLCB 1SJEA 2YPLD 2WV3A 2NY7L 4GRLA 3G6DL 2ZCKH 1GGTA 1OAZL 2N4IA 2YHGA 4AG4L 4L4VD 3O3EA 2WZPD 5GGUA 5JUEH 2RIKA 3E6FA 4PRNB 5DYOB 4JRYD 4FZ8H 1E4WH 4YHOL 3SKMA 1IRAY 3QEUB 1NGQH 4Z6AT 2X4TA 5BVPH 5I18H 1LO5A 4QYOA 1U8HB 3MOBH 3U0TA 2VDOH 4WU7B 2FECL 5JR1L 5JXAH 3OAZK 4WJ5A 4L4TB 4L4VA 4P2QA 1JWUA 2EE3A 3W9EB 3CZFA 4MWFA 4JRYA 4DGIL 5HDQL 4OFVA 1G9MC 1WT5C 3SCMB 3EO9H 3ZYIA 2WUBL 3OKLA 4OZHE 1MFNA 3U1SH 2JE8A 2DYPD 2Q3AA 3WDJA 4HHAA