2I60H

Crystal structure of [phe23]m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
228
structure length
221
Chain Sequence
VQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXTERIOR MEMBRANE GLYCOPROTEIN(GP120)
publication title Combinatorial optimization of a CD4-mimetic miniprotein and cocrystal structures with HIV-1 gp120 envelope glycoprotein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 40
structure length 221
sequence length 228
chains with identical sequence R
ec nomenclature
pdb deposition date 2006-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i60H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i60H01
1J1OL 2CXGA 5MEQB 3D85A 4GUPB 1PZUB 4RMRA 3MRBA 1SJEA 5IW3A 1S9WA 3BKJH 4LQFH 4M43H 2EC8A 3NGBB 1QBBA 4C56B 3BZEB 4XNQA 2MFNA 2HFFB 5GRVL 4QRRA 3BE1H 2DQFA 5FK9A 4JG0H 5EO1A 5EU6E 2O5XH 3C6SB 4XXCA 2GCYB 2PTVA 4MA7L 4XCYB 4F3FA 4MQSB 2HVKB 4IMLB 4Y1AE 4YUEL 1KB5L 4XNXL 4IOIB 4AEEA 5JW5B 2Y36H 4NO0A 4QHLB 1CLCA 4WHDA 3FRUB 5D2NA 2M8XA 1IQWH 1F4XL 3D3VD 4OKDA 3I50L 4YEFA 1YECH 4KRMB 4TVSa 2D7OA 1KPVA 4E42B 4MA3B 3IJHB 3D85D 5LAXA 4J3XA 2V5YA 4GG6A 3ILQD 3N85L 3OKEA 3I9GL 1CXIA 1N5YL 5E99H 4WUUB 1RZ7L 2FEDD 1FVDB 1MFCH 1AR1D 4X8XA 4LCYA 4N8PA 2YXFA 2ZUSA 4PP1D 1PSKH 5EU5B 4LHJB 4QRRD 4RFEA 2H3NA 4HGMA 4Y4FA 2VERN 4A6YB 1VEOA 5C2UB 3K74B 2DIBA 2VLJE 3IDYC 4RGND 4OZ4B 5FM5M 3SHSA 3V79C 3GSQA 2R23B 4P9MH 3V4PH 3WIIL 1WBYB 4XP1L 3IAQA 3MV11 3W39A 12E8L 3KXFB 3QXTA 4PJAE 3C5ZD 1OCWH 2MPAL 3NACH 5GZNC 3ZKMC 5ALCL 5DJYA 2B4CL 4NFDA 4BSJA 3B3IA 4MJIB 3KPTA 3REWB 4HKBA 2NY0B 3U9UA 2JELL 3ZE1F 4MQ7B 1S5IH 3LS4L 1KEML 2OR7A 3ZKND 2DQHH 4HUWA 4TUOA 4NKDB 4P0DA 1UJTA 5DA4A 2Q8BL 5JHLH 2V2WB 35C8H 3KPRA 2ZOLA 1ZVYA 2GJ6E 4X99B 5AZEH 1C12A 3QJHA 3D48R 3LS5H 3GBML 2XN9A 1J7VR 1WWBX 4L29B 3CVHL 5T5FL 5IUSA 5FA4B 4JFOB 5I6XC 1W72H 3TBWB 1CE6B 2AJUL 5KSBE 2OQJA 1IGYA 4JPKH 1UCBH 1NBZA 2H2PD 2VQ1A 1RUQL 4M7ZC 4FG6C 3PDDA 3RL2A 5EZLA 5EBMB 4H1LB 4CBPA 2OJEB 2OMBA 1FJ1A 4IRJC 2OMNA 4UOW0 3DHMA 5A2IH 2LE9A 3UC0L 2X4TB 3JUYA 3HMWL 3SJVD 2PW2A 3GHEL 2FR4A 3FCTB 3VWKD 2WUBL 2UVEA 4QXGL 4I5BB 1AHWA 1JF6A 1J8HE 3VDCA 4OZFH 3MGOB 3ZT5A 2FHCA 4WFGE 2G60H 1U6AL 3VW3H 3DMMC 3MV9E 5CZVH 3RUGF 4KI5D 2XN9D 4Q9QH 4OAWB 1EA9C 5TGBB 3GMOB 3UTTB 3TBYB 1U58A 3VFGH 3VGHA 4XGZB 1EHLH 1GGYA 1HHKB 1LO2H 3TO4C 1NC4A 5CGTA 5TFSH 2UUDK 5LG1A 2NLJA 4PY7B 3V0AC 4LSQH 4IRZL 3C6LC 1HHJB 4JZJA 3BIKA 1CFBA 4PTUA 3UTSA 4NC1E 1KENH 3F7YB 5GGTA 1E4JA 4HDIB 5IBUG 4GFTB 5JIIA 4H26A 4LVEA 3EJYC 5DMGD 2ITCB 4WW1A 5JPMB 1J05B 4M4RA 3BKCH 4QXWA 1ADQL 3VXSE 3MLUH 3T0EE 2QTEA 2XTJC 2FATL 4YHIB 2NTFA 4HS6B 4Y5XA 2RGSA 3DVNB 4UT6H 1QBLH 5KAQG 2B5IB 3ARGA 4MXVE 4NCC1 4MJ2A 4P23A 1QKZH 1FZJA 3BZ4B 2DOCA 4PJGA 3UTOA 4EQ2A 3QO0B 3VXQB 1HQ4A 3SGDH 1HHGA 3L3HB 1WT5C 2A74B 5F93C 2R2BB 3MRKB 3MLTB 1IEAB 2MWCA 2VLLB 1QYGH 2W0PA 4Z76B 5L0QC 2NNAB 3G5VB 3VFWA 4LHQB 3MJ7A 3BN9D 3OQ3B 3UTSD 3LKNB 1OHQA 3MACH 1T2QL 4DTGH 4MSWB 4JJHA 5FXCH 1OB1A 1NLBL 3SE9L 1HQRA 3BUYB 4R97C 4HUVA 3KPNA 3WDIA 4Z7UA 4ZTOH 4R6UA 1CG9B 3MUGA 4DJMA 4R26L 4KTDL 3MX0A 5FGRA 3ALXA 3QSKB 5AAWA 3FONA 3UAJD 3BP5A 2GT9A 5F7DB 3ARGD 4HQQH 1MVUB 4KZDL 1IGML 1TZIA 2YA0A 4P23D 4X6CF 1A21A 4WIQA 2HAZA 1J1XH 4FFVD 3H9HB 3RY4A 3WNLA 1BZQK 3IJSB 3TO2B 3FOLA 4WV1C 1DDHB 2P47B 1F6AB 1FNLA 3NCYS 4S1SL 1EO8H 5GSVA 4ELMA 4OGZA 2ZOKB 5T1DL 4CVXB 1JJUA 5I66A 5TE7L 3IDXH 1F02I 1RUKH 3SDCA 3HMXA 4LCIH 2ZG2A 3FO9A 1PKQB 4ODVL 5EIIA 3NCMA 5E7FA 4ETQB 4GKSA 4TTDC 2WQ8A 1BVKA 2Y4SA 3RWDB 5DK3A 3G6JE 1KCRL 4BH7B 4WUUE 3D39A 3O45B 2E7BA 1Q9OA 2AABL 1P7KB 4AEHL 3CLEL 1G7LB 1YJDC 4Z9KB 1AR1C 3TYFA 1S9VB 3KPMB 3VE0A 4BKLB 1U2HA 2PKDA 3CCHB 1QQDB 2DQDL 2E9IA 4NRYB 4P46C 2X4UA 2YD3A 1DN0B 3PWUB 3CVHB 5TDPB 1FH5H 4DKFH 5BV7L 4UOW1 5DA0B 4OCXL 1QVOA 3MV7A 2NY4B 4OCNC 4BFGA 5E1AB 2ICWJ 5B8CB 2UWEB 1TDQA 3UPRB 3M1BA 3E0GA 1RU9L 1RK0B 3C5ZC 4X9IA 1U95A 2XQYK 1G7QA 1Q9LB 4LSPH 4O58L 4A6YH 5IVXB 3SDCD 3LOWA 5DRNA 4M7KL 3ET9F 5KSAD 3D2UD 5EUOA 5BRZA 3R4DA 5HDBF 3VFOB 1E6JH 1Y6NR 2Q3ZA 4H25A 3CIQA 4XVSL 4ONFH 3X3GH 5D6DC 4P49A 1CFQA 5KZCB 3CC5B 3JWDC 1BIIB 3CMGA 3GMQA 3WFEH 3TN0A 4V2CB 3OF6A 2J8UE 3O41A 3QH3B 3M8OL 2E27L 3O2VH 3MUY1 3QWOA 4PJCA 2A6KA 1YYML 2OM5A 1JPGA 4H8WL 4NQXA 1NGZA 3GSVA 1NGQH 4WW2F 5I19H 4J8RA 1XGTA 2BDNH 3MV7D 4M61A 3MRCA 5F88A 3RWCA 1FYTD 5HGDA 4LARL 2H2PC 3QRFM 2RCSH 3HA0A 5CJQL 1QBML 2YWZA 1ITCA 1MF2H 2QQLL 3LDBB 1WJ3A 2PYEE 3P0VH 4XPBH 1BZ7B 3SKMA 3U4EB 5BRZD 3G04B 1HCFX 4LF3B 5DUBA 4MNHA 1A5FL 1A47A 2Q8AH 4O2EA 5JW4Q 3H7BA 1O7VA 3C5JA 3D3VB 3VWKC 5F7LB 5GGVL 4M03A 2CDEA 1A6WL 3HC4H 3BEVA 5GGTL 3D85B 4NNPH 3S37L 1D5BB 1IGCL 1KTRL 2NY7H 3T0AA 3OF6D 1H3PL 2VLKE 5JNYA 3MRBB 4L9LC 1SJEB 5ID0A 2APWA 1JZ3A 1DP0A 4XCCH 5J89A 1PG7L 1VADA 5C09E 1WWAX 4HPYL 3A6BL 4XNQB 2I26N 4KI5C 3U4BH 1AH1A 1BWMA 5DVMA 1D6VL 2C5DC 2QHRH 2FIRT 2BY2A 4O4YL 2DQFB 5F3BB 5FK9B 5LXGH 4RGNB 2BERA 1NUDA 2P42B 5JOEA 5HPMA 1SBSH 4ISVA 5DMJB 1KJVA 5ITBH 5EC2A 1DBBL 4Q9CA 1CE1H 3EAKA 4Y5YA 4XHQA 5LJYH 4YWGL 4NO0B 2N4IA 3D87B 4FXGA 5D2NB 5IESH 4UIMA 5DMGC 3IB4A 4FTVE 5EH1A 2P8PA 1KPVB 5DS8A 1JYXA 1NFKA 3MOAH 1LO4H 1ZKAA 1S78D 3NCYP 1E4XH 5IROA 4F7TB 4YFDB 4L8DA 3OKEB 5I9QB 2EKSA 5FKPB 4M7JH 3UPAA 3L6FA 1MRCL 4GRWB 4P57A 3GGWB 4LCYB 5EIQA 1BECA 1ZLSL 1KULA 1IGIL 4RFEB 2H3NB 3SO3B 4Y4FB 1MJ7L 5SWZE 4XTRC 3PWNA 5HHNA 1EMTL 4NHCL 4JKMA 3U30C 2AEIT 1U3JA 2Z8SA 4WI6A 3GMMA 1BQHB 3W39B 5CEZL 1G84A 1FBIL 1N0LA 2VDKL 2X9YA 3QQ9C 3T2PA 3ZT7A 1LD9B 5DJYB 3U2SA 3KYOB 2NXYD 4HKBB 2JK5B 3HMXL 4LRNH 1HYSD 3U9UB 1J9CT 2DI8A 3ARRA 2X1WL 1Y0LA 1U8IB 4KK5C 3U1SL 2DAVA 3O9WA 4HUWB 4ZXBB 4H0GA 5A40E 4U7KA 4TUOB 4F80A 2NY2D 4LSDA 3U7WH 1PYWB 5BV7B 1DVFC 3KPRB 4KXZI 1BFOB 2XZAH 1ORQB 4NN7C 4AQ1B 1C12B 1M6OA 4OJFH 4GJTB 4M6MH 5TH2B 3QXVA 5DSCB 3B2UD 4M02A 4UAOB 4AJ0A 1SY6H 5IQ9A 1JGVL 2OQJB 1YY9C 1IGYB 2HRPH 3LY6A 2VQ1B 5GS1C 3TCLA 3NH7H 4X7SH 2PN5A 3RL2B 5EZLB 1PKQE 3BHBA 3LIZH 1FJ1B 4RAVA 4ZOAA 4PJXE 1ZWIA 3B6SA 3FN0H 4PJEF 2X9XA 2FBJH 2A1WH 4UV7H 3ELAT 3G9AB 3SDXA 2PW2B 4DGVH 3C60C 4AM0A 4IDJL 1M7IA 1JYVA 5T3XE 4NQCA 1YEHL 1NMAH 25C8H 4H0IA 5HVWA 4GAJH 4RFNB 4GAYA 3DJ9A 4FMFA 2HLFD 2F19L 2YPVH 4L3EA 3KWWA 3FB5A 5CD5D 2QQKH 1MCOH 4NQEB 1MJ8H 5CJXC 2RR3A 1DEEA 1QA9A 5DXWA 4WJ5A 1U58B 5T3XH 1A8JH 3P0GB 2J88H 2VDML 1JZ8A 2VABA 1NAMH 1T6VN 1Q1JH 4P9HL 4X6BB 3DURA 5K9OA 5T1LB 3MBXL 5IVXE 3ZSSA 1NC4B 1OP5K 3V6OA 5LVEA 3N06B 3DYPA 1QZ1A 2NLJB 5KSAC 1S7QA 2QJDA 2ZPKL 3BIKB 2PCPA 3DYOA 1CTNA 4PTUB 3UTSB 4GH7B 4K94H 5D7LA 2R69H 4NWTH 4LVNC 2P46B 4NQCD 4KKAC 4L3AA 4LLAA 1I8KB 3O0RH 2NTFB 4CUCA 4Y5XB 5C0FA 3V0VB 4GT7A 3SY0A 2A9NL 1BWWA 4HBCH 3ARGB 2ARWA 4L3ED 5CD3A 4W4NA 4NDMA 2WM0A 3NTCH 4KVNL 3O6KL 4XP9H 1CTOA 1FZJB 2AXHA 3I75A 2ERJC 4G42A 4YHOH 1BFTA 1T7VA 3TZVC 1HQ4B 1HHGB 1JPST 4JRXA 4JPVL 2NY6D 2VO5A 3DX7B 2P7TB 2WIMA 5E2UH 2F8VA 1H0DA 1KXVC 4L8BA 5I74C 1FNFA 3VFWB 1CLYH 3B9KB 4RGOH 4JKPH 4YC2C 5J1AA 2J4WL 4OZIF 4OQ1A 1CL7L 5I8EA 1MNUH 3MRFA 5B39A 3K4ZA 1JZ7A 1INDH 2W65A 3OV6A 1OB1B 3SGEH 3DX8A 4LLMA 1HQRB 4JFEA 3FQUB 4Z7UB 1A3QA 1A7OL 3MUGB 5GHWL 4S2SA 1JRHH 3CFCH 2UYLA 3SE8H 2BP3A 2EE3A 3FONB 2FLRT 3BP5B 2GT9B 1H15A 1Q8MA 2BVQB 1TZIB 3X11A 3NPSB 5K9KA 2PTTA 4OGYH 4UQ2A 1XF3A 2FNBA 3FOLB 5IGXH 4X9FA 5D96B 2F15A 5KS9A 4JRXD 4HV8A 5JDSA 1H5BC 4RFOL 4YDIL 1P84J 2DYPB 4GBXC 2A6DA 5JORB 3O8XA 5J6GA 5LBSL 5GSVB 1OTTC 4JRYA 4O5LH 4ELMB 1EJOL 5DD3H 5I66B 1IC1A 4WUKL 5HDQH 5IMKA 3SDCB 3RVTD 5BVPL 5DR5L 4OZHA 4JKLA 1U3HC 4EVNA 4FZEL 1RJYA 3FO9B 1UWXK 4RWYL 5EIIB 3SCMD 2QBWA 4GKSB 2OP4H 3HI5L 1KYOJ 4ZDHB 3FT2A 4JFED 1BVKB 5BW7A 4OKVB 4PGJA 4M8VA 5D93C 2YK1H 4QXTB 1NFDF 3D39B 3JV4A 1ZAGA 4Z0BL 1GIGH 1Z9MA 3INUL 4G3YL 1LK2A 1UJ3C 5EC1A 2XY1A 3DV4A 3TYFB 3VE0B 2VE6A 2X4UB 1F8TL 1UA6H 3REVB 3MV7B 2WLZA 5FUOL 3BP6B 5HYEA 3M1BB 1A7NH 3RZCA 4I3SH 1U95B 3FMGL 4LAQL 1UFUA 4U33A 5DRNB 2XXCB 4ZUSA 1TZHA 4OCMC 4K3DL 4KZEL 4H25B 4M62H 1CFQB 3MNZA 1CICC 2V7NA 3E3QC 2MMXA 3IDGA 4Z7WE 4ONGL 3TN0B 1FV1A 2NY2C 3O41B 3D6GA 1GXEA 5E00A 3N1GC 3KPRE 3LH2L 3QWOB 4PJCB 3HG1A 1A2YA 5DHXB 4F15C 2VL4A 4HC1H 2A6KB 7CGTA 5I1EL 1FAIH 3V2AR 1JPGB 3FO2A 2DI7A 2YD2A 4NQXB 1NGZB 4FXKA 1OW0C 3GSVB 4J8RB 5CSZA 4LCCA 2BNRE 4M61B 3MRCB 4XP5L 5F88B 4X80L 3T65A 3V8OA 1JPSH 1ZLVH 1XR9A 5HGDB 3OKMB 5C9KA 3RZCD 4U3CA 2FX7H 3EDFA 4IHOA 4NN5B 4KDTC 2VXTL 3WXWH 4PRBA 4YHYB 2PETA 4L3CA 1ACYL 1KIRB 2UZIL 4LSRH 1NUFA 4FFZH 4PRID 4FZ8H 1UC6A 4G7VL 4MNHB 5DUBB 4O2EB 3H7BB 5IG7A 3C5JB 4ODBD 1X5FA 2EKJA 2IH3A 3W11C 5MHSD 5E6IC 3ARUA 4Q2ZA 2CDEB 3BEVB 1JNLL 3V95A 4LCWA 4M5ZH 2FD6H 3UX9B 1U8NA 4W4OA 5JNYB 3E2HB 1QLFA 1X4XA 5ID0B 3HG1D 3R0MA 4LSVH 1VADB 2XIDA 1MCBA 4ZPVA 4NQEE 4U0RB 2D3VA 4KPHL 1E28A 4HJJH 2W38A 5I1IL 1RIHH 3LVEA 1UWGH 2FZ3A 4XBEL 3MA7A 5B39G 3MC0A 3BKML 1Q0YH 2DQGL 5CMAA 2LABA 1J0ZA 5HPMB 1S7WA 3VDBA 4ISVB 4UIKL 1I7UA 5EC2B 2IFFL 4Y5YB 3GJEA 1S8DB 4ZFGH 3QHZH 5BJTA 4FXGB 4UIMB 3OAUL 3T77A 3L5IA 4XAKD 4RIRA 2W9DL 2AEPL 2P8PB 2H6PA 4N0YH 4LCWD 2HP4A 5J3HC 4ZMAT 1XAUA 4UMGA 5FGCE 2EKSB 1G9NC 5HHQA 3L6FB 3M45A 3V6FA 1V7NL 1WSST 3WFBH 4AEFA 4DGIH 3NN8A 2VXVH 5HYJA 2B39A 3PWNB 5HHNB 4F9LA 3T4AA 1CZ8H 1KJMA 4BJLA 4CL7A 3GSUA 1RUAH 2BVYA 3GMMB 1FP5A 5C70A 2EDQA 5I17A 3HNVL 3L95B 2HJFA 4OFIA 5EU3A 4LFHD 3FRPG 5C86A 3ZTJG 3BQUA 3R06A 5CSBA 3U2SB 3UXFA 1KJ2H 2CIIA 2FECI 1SMOA 4S11A 1TJHL 5D6CB 1Y0LB 4TULL 2IBZX 5BQ7A 3O9WB 3HN3A 1I1AA 3THML 4ZG1A 1KELL 2YEZA 2GY5A 1AJ7H 4R0LA 1QSVA 5TQ2H 4YHZL 3L9RA 4G9FE 2X09A 4UOJA 2EH8H 5D7SH 1UH2A 1JPTH 2QSCH 4XI5C 3VRIA 1M6OB 4JPIA 2AGJL 2AJVH 3QG7H 4JY4A 3EHBD 3GM8A 1JTOA 2X1PA 3BO8A 3MTRA 5BVJA 4M48L 1UH4A 2QQNL 3O4OB 2VC2L 3BKYL 2X4OB 3D5OF 3BYYA 5L8JB 1ZLWH 3KPOA 3TCLB 3WKNA 4TOYH 1YQ2A 5T1MA 3BHBB 2P1YA 3QUMA 2HTKD 3AS2A 2D7MA 3SCMC 2Y72A 4YDVA 1MCJA 1D5IH 5D71H 1S7SA 4WO4C 1ZWIB 3B6SB 4X8JA 5A2KH 2W0FA 4HLZH 1MIML 3L3JA 4AM0B 2LVCA 5C6PB 1YYLL 4NQCB 4GAYB 2JCCA 3L1OH 4OLZL 4M6OH 5E94A 1CR9L 5T3ZD 5EORL 2RIKA 2D7PA 3CX2A 4L3EB 5C0GA 3PV7A 4JN1L 1LDPH 3KWWB 3FB5B 4KQ4L 4I18A 2IADA 3RI5K 2O26U 1IC7L 2VWEE 5CP3A 2ZSVA 4QTIH 3MNWA 1DEEB 1QA9B 3DI3B 3H42H 1C16A 3AB0B 1XT5A 4QOKD 4WJ5B 5CP7A 5C0AB 3SKOA 5DLML 2VABB 3EO0B 4Q58C 3DURB 1C5BL 2C9AA 4D3CL 4NRXA 5A43C 3H3BC 3PP3H 1S7QB 4G43B 4LGPB 3GSXA 4KQ3H 2PCPB 2O61B 5I71B 4PY8I 5D7LB 2V5RA 2V6HA 3BAEH 1T22B 2DMKA 2BOCA 3BPLB 2DS4A 5ICYA 1QG3A 2WSKA 2R9HC 4K2UL 1V7ML 1MY7A 3T2QA 1A22B 2XKUA 4Y16D 5C0FB 3SY0B 3OKYA 1T0MA 2FJGA 1G9MH 5CD3B 4E0RA 2ZUQC 4B41A 1A6VH 3HPJB 4NDMB 4LFHG 3MLYL 3HHRB 4G9DA 1X44A 3I75B 2Z93A 3EYSL 5DC4B 3DLQR 1MSPA 4J3OC 4ZYKA 4AMKH 4K71B 4FFYH 3RA7H 5ABDE 1F4HA 2DTMH 3RWJA 5DHVB 5HHMB 1MFAL 2CDGB 4ORZC 5D1ZC 3RDTA 4E41E 3I02A 3DX6A 1MLCA 2IALA 5ACLA 2WAHA 1E6OL 1OPGH 1UEYA 4HFWB 4P2RB 5EIVA 3VXRA 5J1AB 4JM4L 4KAQH 4BQCA 3H2WA 1N2RB 1TCRA 4M5YH 5GGQL 5I8EB 3MRFB 3ULUE 4WTWA 2HKHL 2W65B 1CFNA 4FQQA 3DX8B 4LLMB 2LTQB 4A2MA 2IPTH 1A7RH 5D7JC 3SKUD 1MQKL 3P0YH 4S2SB 4WGVB 2UYLB 1RJCA 5CCKL 1GGIH 1H15B 1RUPH 1P5VA 3CMOH 1K5NA 1FZKA 2EDRA 4NFCA 4QRPA 4ZOCA 3QEGL 3GNML 2ZCKH 3X11B 4HT1H 3ULUH 2IBGA 1I9RL 2HYMA 2PTTB 2LVEA 1GH7A 1GC1C 4UQ2B 1EAJA 1NANH 4TUJA 5KS9B 4HV8B 5JDSB 2HJKA 1IL1A 1F90H 3GB7A 2JJSA 2A6DB 3BOVA 3O8XB 4YO0B 2BY0A 3FT4A 4JRYB 2KPNA 2AI0L 3PGFL 2H32A 3RDTD 4G6MH 1XZ0A 2DL9A 1G7PA 1BBDH 1N59A 1KG0A 5IMKB 3R8BB 4OZHB 4P3DA 4X7CC 3QYCA 4EVNB 1RJYB 1I1YA 2I9TA 4YZFE 3VI3E 4WWKA 3E8UH 1EXUA 3FT2B 2FL5B 3H3PL 2R4RH 1G1YA 3L3OA 4KFZC 1IGFH 2BNUB 1AP2A 3JV4B 1LK2B 2X4PA 4QRPD 1D7FA 2MCPL 3DV4B 4YHKL 4C55A 1FCCA 1T04B 2Z8WC 3VGEA 2VE6B 3GSNA 3I6LD 4KHXL 3AY4A 3FFCA 5F72S 4Z7VB 5DUPL 1JGDB 3QQ4A 3G6AA 3IKCB 1ZTXH 3MLXL 2EE6A 4NNYA 6CGTA 4PJ8C 3DNKA 5BS0D 5EZIH 1AC6A 1DUZA 2HFEA 3LMJL 3CZFA 1YEIL 4GAGL 5GISH 2GK0A 4ZUSB 4D8PA 3QDJA 1TZHB 3P9LA 5SV4A 2I5YH 3MRHA 4XNYL 4WWKD 3QUML 2V7NB 1IT9H 5KVFL 4S1DD 1NEZA 2C3WA 3IDGB 3TBVA 3FO1A 2R39A 5CGYD 1FV1B 2WBJC 2CLVA 5E00B 4IS6B 2XWTA 1A2YB 3HG1B 4YXLL 4PJ7F 5T1KA 3UJJL 1RD6A 1AGFA 3QHFL 5FV1L 2PF6A 3LSOA 4TPRL 3MCG1 2A83A 3FO2B 1KBGH 4R3SA 4FXKB 3GM0A 5GGRA 4N9GA 5CSZB 5IR1A 2IAMC 3EHBC 3C09C 1X5AA 3MJ9H 4HZLB 4HF5L 1SHMA 3K80A 2OJZL 2R29L 1XR9B 3F12A 5C6TH 3OL2A 2AQ3A 4PJDA 4IHOB 5I1GL 4M8QA 4UILL 2EZ0D 3HC3L 3K2UL 4L3CB 4NUJA 3QDJD 2EDFA 4QRUA 5GSRA 4YGVA 5FKAA 4K7PH 2F74A 3S35L 5HJ3A 5IFHH 5IJKA 5IG7B 2IH3B 3V5KA 3RX7A 1BLNB 1WTLA 2EO1A 3GBNL 4Q2ZB 4NO2A 1FL3B 4MWFA 4LCWB 3DBXA 3IDMB 1U8NB 4U6XA 3QISA 1TITA 5I15H 1QLFB 3LKOA 5T1KD 4KTEL 5LGJA 4ZPVB 4I8DA 3W0WE 3IDYB 2GUOB 4UDTB 1E28B 4G7YL 5FDYA 3TWCL 3FJTA 5C0AE 1KEGH 1NCAH 4HKZA 1R3HB 3WNMA 1M71A 1CXFA 5HXMA 3BYTA 2FZ3B 1YEKL 3P9MB 5SWSA 1QACA 2FHBA 4F58L 3QCVL 5CMAB 5F89B 4TRPH 1MCDA 4RBPK 3QPQD 4ODSH 1L7IL 4OZGF 1UCTA 1I7UB 2DICA 4OI8A 3P4LA 4MLSA 4JM2F 3GJEB 3MCLL 5D7LE 1N6VA 3LHPH 1E4KC 1K4CB 2IPKA 5AG8A 2D31B 4TSAH 1N6UA 3B5TA 3BDBA 1F3DJ 5FO9A 2H6PB 32C2A 4ZO8A 4MNGE 4YK4C 4Y16C 3VGBA 4N90E 4PPTA 1HIMH 3NIDE 3SKJH 4JR9H 3ZLQC 4ZS6D 4NKIL 4DQOH 5HHQB 3FB7A 2FBOJ 5H2BA 3VG9C 3ZDZF 1RMFH 3WHE0 4P5MA 3NN8B 5J8OA 5DFVD 1NFIA 3QFDA 5HYJB 1LP9E 3CDFA 3MYZA 4W6XB 3QAZC 2K7PA 3NA9H 5E2WH 5SWSD 4CW1A 1KJMB 1IFHH 2HH0H 4M7ZB 5HHME 1RZIA 3GSUB 2HWZH 4DCQA 1OD7A 1NGPH 4YXKL 1G6RH 4AG4H 4P2RE 2HJFB 5LQBL 4MVBC 5EU3B 3PJSB 2MKWA 3BQUB 2N7BA 2CLRA 3R06B 1QTYT 5FGSA 3TT1H 3JV0A 4N0CC 5DHVH 4NZRL 2CIIB 8FABA 1AO7D 3QFJA 4TNVF 4OLVL 4WI5A 2VLRA 5BQ7B 3GDBA 1I1AB 1U8LA 2FEEL 4ELKB 5JOPE 2YEZB 3NCBB 3IVKA 2CPCA 4R0LB 4UBDC 3L9RB 5D7IF 5JW4N 4FQXD 3TPUA 1FSKC 3VGAC 4NOBA 3MLPA 3C87A 4GRLA 5E4EC 5KS9E 4KTYA 4XHJD 3VRIB 1FGNH 4DAGL 3TO4B 4IBLT 4JPIB 3VFNA 3GSNL 3QCTH 2AJSL 4JY4B 3BO8B 4JRYE 4Y4KC 2EDKA 3S96A 3HC0B 1NEZG 3LPGA 1UYWL 1FZOA 1WZKA 3BD3A 3KPOB 4AL8H 3ECBA 5T1MB 1WEJH 1H8OA 3KVQA 3QUMB 5C07E 4LVHC 4AK1A 1S7SB 3QFJD 3CX5K 4X8JB 2K3TA 5FDWA 4EDWL 4R4NC 3L3JB 4LLWA 2VLRD 2YPLE 3HE6C 3BGMA 4R7NA 5M7QA 1J0JA 4KHTL 1H3VA 4MJ6A 5T5NF 5DZOA 2JCCB 2EYSA 4I13B 3UJTL 3HLAA 2VKWA 3TZVA 4Z7VE 5C0GB 2G9HA 4LDLB 1XGYL 3TNMA 1IC4L 1DQLL 4P59L 3S7GA 4I18B 1AD0B 4HH9A 4XCFH 1RZ8B 2IADB 3QDGB 43CAB 2ZSVB 4PB9H 1C16B 5CP7B 4PGEA 3SOBH 1HCVA 3SKOB 1M7DA 3WXVL 3WLBA 4U1IA 3DUHA 3DUSA 3QUXC 1FRGH 3CK0H 3GKWH 1YN7A 5D7KE 1OAXH 3SGJC 5D1QA 1A14H 1T3FA 5F7NC 3PNWA 3F8UB 5HYSG 2BXZA 5ETUA 4R97B 1RIUL 5EOCL 1K85A 3DRTB 3U9PH 3IF1A 2BOCB 4S1DC 4LSTH 4DUXA 2AXJA 3HR5A 2HMIC 5ICYB 3KJ6L 3VGGA 1CDBA 1T83A 1QFUL 2F9BT 1ROWA 1UXWA 2DKMA 4N0RA 4TQEH 3HNSH 4OCWH 1I7ZA 1LK3L 5I76A 2EXWC 4HWEL 5K9JH 5C71A 3AXLA 5INCA 3AAZB 3BT2H 4BUGA 3HAEG 3Q6GH 4HUKB 1RVFH 3OKDA 3WSQL 4G9DB 4TSCH 4ZNEA 2Z93B 1CXLA 1P53A 1V3MA 5F1NB 2DMCA 4MD4A 5EU7C 2NY5L 3PV6A 5DUMH 2DLEA 2YMXH 5D2LA 5HGAB 3TVMC 4POZD 4S1RL 5D1QD 4EI6A 3DX6B 1MLCB 2IALB 1ZA3A 3MROB 3PIQA 3ES6A 4JY5L 3ZKSD 1A02N 3ROOB 1P4IL 1S3KH 2CRYA 4QCIB 1TXKA 1NPUA 3VXRB 3I6KB 4W6WB 3WHE1 5IB4A 1X5YA 1WISA 5C7XL 4LMQI 4FQQB 4ZUTA 4NZUL 5JR1H 1UJ3A 3QUYC 2R0LH 4KJQC 1B88A 3Q48A 4FQIL 3SPVA 1JP5A 3RY6C 4P46B 4JQXA 4PB0H 4XVUD 4Z6AT 2WUCH 3VDAA 1LILA 1K5NB 1JMZA 3HUJA 5HGBB 2R15A 2IFGA 3FT3A 3GK8H 3N9GL 1PBYA 4MNQD 4LVOC 1HZHH 2FLBT 2EIBA 3JBG7 3Q3GA 4APQA 2HA1A 4JFFA 1YPZA 3TBTA 3NIGF 1QFWL 2NPLX 2HJKB 1IL1B 5TQ0H 3QPQC 4WTXA 4MB5A 2XI9A 2H32B 1WAAF 1XZ0B 4O02H 1S7TA 4NSKB 1G7PB 1N59B 1KG0B 4LSSH 1YC7A 1CICA 1PEZA 4PJ9D 1NLDL 2XZCH 5FM8A 5CFHA 4TUKH 1OP3H 1EJ6A 5CZXC 1I1YB 2I9TB 1I7TA 4BZ1H 3P3YA 3PHQA 1MWAA 1U42A 1HKLH 3BSZL 4MA1B 3VXOB 5CIPH 1IBGH 5JPNA 1AP2B 4BM7A 5CKAA 1OW0A 4L4TE 4YX2H 2X4PB 1MFDH 3MLVH 1CXEA 4I9WE 3GSNB 3W81A 5HYJE 5DFVC 1RFDH 3FFCB 4IJ3C 3MXWL 3MA9L 2DTSA 3QPXH 4APQD 3QQ4B 4JFFD 2C7UA 1BGXH 2XZQL 4KDTA 4MS8C 1UZ6E 4NNYB 5BCAA 4JHWL 3R1GH 2GEEA 3VGDA 5FECA 1DUZB 3MFGB 3BP4A 2EDJA 1KB5H 3WKML 3EKCA 4WFHE 2CGRL 4NO3A 3MGAA 1UM4L 2GK0B 4JKKA 5HD8C 4D8PB 5IB5A 1SYSA 3P9LB 3MRHB 4WWID 3DRQB 4XCEA 5IJVA 1YNTA 3QDMA 1Z6JT 4UDUA 4X6DA 3FO1B 2DQIL 4WDIA 2XYCA 4MA8H 2CLVB 1QBAA 3H6JA 4FQXC 4QLRA 3VXUA 4UT7H 3ME0A 2XWTB 5DD5H 5K59F 1ETZB 1AGFB 4OCYL 3LN4A 3LSOB 1VHPA 4R3SB 4GOSA 5GZOD 4N9GB 2RAMA 1H3TA 1AY1L 1WFNA 5IR1B 2AJXH 2Z9TA 4JGJA 5DYOA 5D5MB 5JUEH 2FRGP 4DFHA 1JYWA 1WTGT 1I75A 2VDOH 4PJDB 3DXAA 4EIZC 1RJLA 1U9KA 4M8QB 4ZAKC 4Y4HA 3IS1X 1MHCA 5H37G 4NUJB 2UWEF 3MLWL 1FNGA 2XTJE 3KYMA 4UB0L 4YGVB 5GSRB 5CBEB 3OKNB 2F74B 3Q5YA 4IRSC 5HJ3B 3EGSB 2RFXB 1DSFL 4N8VA 2P5EA 4NO2B 2CMRH 5F9AC 4MWFB 4Z77A 3DBXB 5I1JL 3HZKA 2JCCE 4UNUA 4U6XB 3PQYD 5DQDL 2QSTA 2X70A 3LKOB 1WITA 5E24E 2HT4C 4MAUL 5LGJB 1F45A 5B22A 3K1DA 3QDGE 1OAYH 2KBGA 1R3LA 2WBWB 1IEHA 3QB7C 4HKZB 4KK8D 4S10A 4WCYL 1M71B 5SWSB 5LKNA 1K8IB 5DEGA 1JHLL 3U0WH 4ONHA 2XY2A 4NKOA 2YUVA 3JSSA 4WW2C 4Q9BA 4Y4HD 4X9BA 3QUKA 3DETD 5IW6A 1N7MH 2XKSA 3HZYA 3PG2A 2XICA 3HMWH 5JTWA 4PS4L 2A6JA 4JFDA 5BZDA 4FFWC 3UZEA 2IPKB 3QXUA 4DFIA 1W0WB 2CUHA 2VH5L 2DLTA 1T1YA 4PJFE 1HXMB 4QXGH 3I3DA 3A6OA 2P5ED 4CVZA 32C2B 2AK1L 3VFVA 1DVFB 1JPFA 4UNVA 1K6QL 5DJ0A 4YXHH 4HBQA 2R0ZL 2XKNA 4NN7B 5AAMA 5BZWA 1U6AH 3FB7B 3CLFL 2EEAA 1TQBC 3P4OB 1C1EH 2AXFB 5H2BB 5DRZA 2W91A 1QSEA 2Y07L 1DJSA 3MR9A 1NFIB 3QFDB 1CD0A 2DDQL 4CW1B 1TIUA 1MOEA 1N64H 1OOAA 4XMKH 1RZIB 5C6WH 1YEEH 1F11B 2O5ZL 4KROC 4NBXB 3V9FA 4S1QL 3T0BA 1D9KD 1L7TH 1KCVL 1RZFL 2CIKA 3HI6L 1CFSA 4WO4A 3K46A 4JQVC 5F96H 3BPOB 3QIBA 3MGTA 1XCQB 3L7EA 1MCQA 2CLRB 3C60B 4JFDD 4Q6IC 3NCJH 1F3DH 3QFJB 3MRPA 1YN6A 1ED3A 3GI9H 1M05B 5AWNH 2BRRH 1II4E 2Y06H 5EBWA 3B5GA 2VDRH 3V4UH 3VRLE 1MWAL 1Q72H 1RZJL 3ZDXE 3TPUB 1IAKA 1ZGLM 1YJDH 1QSED 2A0LD 5C0CA 3QWRD 4MJ5A 4GRLB 3DVGA 4GG6F 1UWEH 1X6NA 2P45B 3VFNB 3L5JA 2DKSA 5F9WC 5EO0A 5E9DA 4GRWF 3MPCA 4L5FH 3R8QA 3VFPB 4X6FA 3WO4C 5BO1L 3ZDYE 2R0KL 1FZOB 1NMBL 1GGBH 1CLZH 1WCQA 4XC3H 3ECBB 1FORL 5JXAH 3QIBD 4FQCL 1JTPA 4PJ9C 4P2YA 4LVNB 4OF8A 4ZPTA 1T6WA 1T7XA 3QNXB 1U2CA 2D7QA 4PLOB 5L6YL 2X42A 3JXAA 5CINH 3DOSA 1GYAA 3OGOE 1A7PL 4PYGA 2VDPL 4LLWB 1IQDA 4WGWB 2ED7A 3JWDH 1KJ3L 3MLZH 3EO9H 4MJ6B 4I77H 2EYSB 5F44A 3SQOH 4WY7H 2ERJB 3FFCE 3HLAB 1MCLA 2ZP0T 3TZVB 1CBVH 3U79A 3F58L 5C0IA 2E5EA 1R5IA 4PJIA 3TNMB 5I1KH 3MLSL 4NJAL 3EOBA 4OD2A 4TVPD 3ROLB 3KHOA 4I2XA 4XVTH 5E9DD 1M7DB 3WLBB 3VXMA 1DR9A 3EYVA 4D9RD 3DUSB 5IVNA 4BZYA 2YD8A 4YC2B 1GHFL 2BHYA 3C2AL 1YN7B 3DSNA 3SJVE 4BQ6A 3FAWA 4XPTL 5E5RB 5AZ2L 2H9GB 3BPNB 5D1QB 4ORGA 4HAGA 2DWDB 4JAMA 3GUTA 5D7JA 3MODH 3HTLX 3QEQA 3ZTNL 2AEQH 3IF1B 1RUMH 1T03L 5F7KC 3HR5B 4LBEA 3WN5A 5MENA 3FQTA 4KI5E 4JFZL 1WC7A 1UXWB 2MHAA 4G6JL 2VISA 2YKLH 1G9NL 1EUTA 4KKBC 3TH4T 4EIGB 4D9QD 5L2KA 3S34L 1TZGL 4PBVC 1DQDH 5L7XL 2F54A 3V5DA 3ULVD 5FOBA 3AXLB 5INCB 3GHBH 4GBXB 3OKDB 1CDYA 1TNNA 1OTSD 4QY8A 5D5ME 5HDOA 1T4KA 4ETYA 5B3JE 5C0BA 3VXMD 1MRFH 4K8RC 4OB5L 4XMPL 2HVJB 3PV6B 1OF2A 4HUMB 1MCPH 5D2LB 4KH2A 1YC8A 4KV5F 4XC1H 4U1JA 4EI6B 2W07A 4U7MA 1ZA3B 3ES6B 3SDDD 4EBQH 4MXWL 3EIFA 5DGRA 4XVSH 4JO4L 3WV0A 4JHAH 4JHBA 4YDKL 3VI4F 3QEQD 1IVLA 4NP4L 3K8KA 5IB4B 5JA9A 4FQLH 3DV6A 5F7EH 3ARFA 4ZUTB 1UJ3B 5MEND 3K4AA 5I30H 4L8SA 3SPVB 3V0WL 5MEOA 4YIQA 3NAAL 4X4MA 3S36H 2D4DA 3HPLA 4QHNA 5DGQA 3TH3T 2F54D 3HUJB 3MNVB 4CJ0A 4HFUL 3FT3B 3P4MB 3NFSH 4NRZA 1DBJH 1FFPA 4KK8C 1JV5A 2DQJL 2IQ9H 3Q3GB 1Y6KR 4JFQA 1YPZB 3TBTB 5E2VL 1OGAA 3GSOA 5IHUH 2QHLA 3I3BA 3RBSA 5EU4A 4NT6B 3G5ZA 2E6PA 1JNNH 3U7YL 5BOPA 4PJGF 3E6HA 1DZBA 3KPSB 4NUGH 1S7TB 1JGEA 4CNIA 4PV8A 3F6LA 1VACA 1CICB 1QEWA 3VA6A 1SYVA 1OM3L 2CK2A 4J6RH 5LWYL 1PY9A 1I7TB 3X3FL 1EZVY 4JQIL 2CJUL 3PHQB 4YLQT 5ILTL 4F15B 3OZ9H 5IFJA 1HH9B 3O6ML 4RSVA 4C83A 5JPNB 2KKQA 4XWGH 4Z7UF 4J4PA 3AS3A 2M2DA 2I60H 2NXZD 4LHUA 1YMMB 2C7UB 5E1HB 1FN4A 3DX9B 5D72H 1WZMA 2ADFL 3QNZA 3QULA 4XNZC 4YHLL 1P4BL 3LRHA 5I8KL 3ZHKA 1I3UA 1D9KC 3BP4B 4DW2H 4YWGH 4J2XA 3TBSB 4K3HA 5DJZA 1FE8H 2XFXB 4PV9A 1E27A 1QRNE 1S7VA 4UUJA 4N5UA 1SYSB 3DSFH 2QV2A 4ELMF 3D0VA 3T09A 5IJVB 1CGTA 2B2XL 3QDMB 3RBGA 4UDUB 4FQ1H 4X6DB 3PWVB 3HZMA 4PJBA 5FFLA 4EEEA 4H0HB 1GRWA 3VXUB 1BOGA 2R56L 3O6FC 2OL3H 2XWJA 1G7MA 3LN4B 4DWHA 4N9OB 4FHBD 4J4PD 4QXUL 4YFEA 3IFOB 3MXVL 2H41A 1F4WH 4DVRH 3GIVA 3ULVL 1Z9LA 3U46A 2VIRB 5DYOB 1IARB 1YUHA 1E4KA 3OWEA 3DXAB 4HX1B 5FYLL 4G8FA 1DBML 3LCYA 2BX5A 1FGVH 5D1XD 1MHCB 5DZLA 5HSFA 1FNGB 3C08H 3KYMB 4YDLC 1INEH 2FX9L 3P30L 3GSWA 3QXDA 5EZOH 5KBNC 1KCSL 3RIFF 1HILA 2WBKA 1G7HA 4N8VB 3BD5A 1LO3H 3ZKXC 3HE7A 3ISWA 1JZ6A 3SGKC 2HJLA 4PGCA 4XPGL 5EUOF 4Z7OF 3HZKB 4P48A 4F9PA 3EOTL 1JK8B 1GGTA 1YNLL 2X70B 4NQVB 5E56A 3VWJD 2NY1D 3F62A 4NZJA 2A73A 1FLTX 1NCUA 5EU6A 3PXJA 1UM5L 1R3LB 1DLFH 2R1WA 1ZA6A 1SEBA 4KKLD 4LLYA 1NGYA 4PJCF 1JGUL 4U1NB 4Y1AA 3CD4A 5DEGB 5DO2D 4ONHB 3WFCL 1P69B 5C0RH 4YE4H 4KJWD 3QUKB 1P7HL 4HS8H 15C8L 3IFNL 3HZYB 5EOQH 5F7UA 4IMKC 1KLGA 2DBLH 2GTZA 4LPTA 2B0SL 3GO1H 4P5TA 4JGMA 1T1YB 1AXTL 4R96A 4KY1H 3HE7D 1CLOL 4CVZB 3PP4L 1YEGH 3VFVB 4LLQA 4WU7A 2QADB 4EI5C 1NCDL 5IEHA 4TSBL 1Y18A 5E8NA 5TE6L 5DJ0B 2OXHA 4I0PD 4DOHB 2XKNB 3B9EA 5BZWB 2VLJA 1F58L 5CLTA 3IFPA 4KMTL 5DRZB 3RKDC 1OTSC 1QSEB 3IDIA 4PJAA 4Y4KA 5INDB 3A67H 1DFBH 5FAAA 1DQML 5GJSL 3BDYH 2ESVE 1O0VA 2B1AL 2VNCA 4HIIA 1CQKA 3RTQA 2ZPKH 4WI3A 3S5LA 3SDDC 5HI5D 3UYRL 4W81A 1KT2B 4WO4B 1N8ZA 3FL7A 2X9WA 4PGBA 3ZT6A 3KYKL 3MGTB 1GPOL 2OR9L 3L7EB 4Z7QE 4JB9L 3HE6A 4YR6A 1BAFL 4V1DE 2DJSA 1W72A 3MRPB 4WI4A 1ED3B 3LPFA 3BX7C 4LOUD 1X5IA 3RGVC 4CDGC 2GJ6A 2VDNL 3ZYZA 2FJFA 5GGSY 4Z8FL 4G6AC 2IF7A 3KYAA 1OARL 2HFGH 2NQCA 3RP1A 1NANI 2VLJD 1T1WA 4S0SD 3IRZA 5HGGS 3BRGC 3MOBH 5IT2L 5C0CB 5KSBA 4MJ5B 1C5DA 1YPZE 3DVGB 4DZBA 2BVOA 4M6NL 5EO0B 4PRDA 1D5MA 5E9DB 3LQAC 3ARBA 4ZUUB 4X6FB 2AV1B 2Z31A 4N0UE 1F3RB 2E6JA 1GGUA 3KPSE 1MHPL 3RTQD 4QHMA 4OZFA 4K9EC 1KV3A 1CGYA 3E3QE 3TA3D 2ZCLH 1CL7I 2CD0A 3UO1L 4ZPTB 1A6TA 1P5UA 2OI9C 3O3DA 5CWSA 4EUPH 1E0OB 4P3CL 3WUWG 3Q2CA 4N1EA 1WZ1H 5D8JL 3TNNA 2O5YL 2EEDA 1DL7H 2W9EL 1J8HA 1W0VA 1TCMA 5H35B 3TJHC 4D0BA 3ZSTA 3T1WA 4P2OA 3VXPA 2ZUQB 2WLYA 3MV9A 2BOBA 1TFHA 1T1ZA 1I1RA 1XF4A 3LKSB 4O00A 4GMTH 3RWEA 1ZOXA 3FKUS 3MRDA 1YMME 5C0IB 1R5IB 1L0XA 4PJIB 1NBVH 1A7QH 2Q86A 2IGFL 3MV8A 5DD1L 3EOBB 4JKWA 2MOVA 4LU5H 4I2XB 1I4FA 1MRDH 4ZODA 4LNVA 3PE9A 1A3LL 1OT2A 2Z31D 5GJTH 4ODTH 3EYVB 5FGBA 5J1SC 3NFNA 2YC1A 5F8RC 5A3IC 2BVEA 3BKJL 3MBEA 4LQFL 4M43L 4MLIA 3VXSA 2YXMA 4JAMB 3RWIA 3T0EA 1BVLA 5D7JB 5F71A 3QDME 3QEQB 4Z0XA 2A77H 2R1YA 2X40A 3BE1L 5HI3D 3DVFA 4LBEB 3HB3D 4GXUM 4JG0L 1JE6A 3WN5B 2GKIA 4WFGD 2JJTA 4P2OD 1CFTB 4RA0C 1WC7B 2O5XL 3MV9D 3V5HA 1OP5H 2MHAB 1MLBA 5L2KB 2IJ0C 1Z0MA 1F8TH 3SDXF 1PVHA 2F54B 3V5DB 3P11H 4G8GB 4MDIA 5GRJH 5FOBB 1ZXQA 2Y36L 2Y25A 3RVUD 4MAYC 3QXAA 4G8EA 5FM4A 1IQWL 5FUZH 4PYHA 4IDLA 5KANI 4DK3A 5DHYA 1T4KB 1YECL 2DM3A 5TPWH 5C0BB 3SDAA 4BK5A 3K2MC 2NZ9C 3GKZA 3DXAE 1AD9A 1OF2B 2AXGA 1VGKA 3RWGA 4PG2A 3GFUA 3IXAA 3QZWG 4U1JB 1MFEH 5E99L 5MEQA 3MBED 2VLME 1MFCL 1G9MC 3VXSD 3T0ED 5IWLC 1YEFH 2ATPA 1VB9A 1PSKL 1DBAH 5CSGA 2QL1A 1MI5A 3DV6B 3BZEA 2H45A 1RHHB 3ARFB 2AK4B 3BP7B 4P9ML 4L8SB 5KJRH 2DKUA 3V4PL 1JVKA 2XT1B 1WCBA 3PL6C 4JM2D 5MEOB 4YIQB 3VWJC 2N7AA 1U3YA 1OCWL 3C6SA 3NACL 3EYQC 4P4KC 1KN4H 4EKXA 5ICZA 4PJ8B 3KR3H 1JV5B 2HN7A 3BISA 4G6KH 4IMLA 4X6CA 5HHOA 2DM2A 4JFQB 1NDGA 2XA8H 1OGAB 3SDAD 2NTSP 4U6TA 3IDUA 1NDMB 1S5IL 3RNKA 5I16A 1YQVH 5EU4B 2DQHL 1G9EA 1HHHB 3G5ZB 3E6HB 2YRPA 5JHLL 4CNIB 4PV8B 1VACB 2J1KA 35C8L 1QEWB 3G6JA 5C0EA 2OX5A 5AZEL 5CZKA 4WUUA 5ISZB 5I1CH 5ESQB 1FVDA 3G5XA 3LS5L 4HWBH 2EE9A 3T3ME 3O6LH 4A6YA 5KVDH 5IFJB 1YDPB 1W72L 4I0PC 2QEJA 4OLXH 4OZ4A 4C83B 4JPKL 5DFWH 3K0WA 3FO0H 3C09B 4XXDA 4HUXA 1OP9A 4Z78A 3GIZH 5HHXH 1GAFH 3BMVA 4LKCB 1UWXH 2C4FT 3ORJA 4LHUB 2APXA 3EFFB 1FN4B 5E03A 3QULB 2AJYH 3AMLA 4OM0H 5C8JA 2VXUH 5IIEA 3BVNA 5J11C 5DJZB 4PV9B 1E27B 1J1PH 5KS9F 1S7VB 5F6IB 5IP4A 4WUUD 1KCUH 2F8OA 2FO1A 2G60L 4TNVK 3VW3L 2J8UA 3D0VB 4OM1H 5CZVL 2D03H 2IQAB 4Q9QL 4MHHI 1X5ZA 4LOUC 3P9WB 3VFGL 1KTKE 4OZHF 1EHLL 1KOAA 3HZMB 4YAQB 5EN2A 1LO2L 1ES0A 4YBLC 1P7QA 4H20L 1IAMA 5TFSL 1BOGB 1MREH 1NUNB 5C0CE 4LSQL 1QLRB 1G7MB 5GGUA 4PJ5E 2NR6D 1G0DA 1WV7T 2OJEA 3GIVB 3HR6A 5DJAA 4MJID 2PYEA 3TFKD 4HK3J 4HGKC 3BKCL 3JWOC 1U92A 2NY0D 4OUUA 1YUHB 3MLUL 3TA3C 2ZKHH 4UT6L 4AY0A 1QBLL 1VFOA 1J11A 1QKZL 2VLKA 1JFQH 2XOTA 3GSWB 3QXDB 1N4XH 3MGOA 4F7PA 3OAZH 2PW1B 1HILB 5C09A 1G7HB 2NCMA 3HE7B 2HJLB 4OAWA 5TGBA 4EQ3A 3QEHA 2YSSA 4BZ2H 1GJIA 2D0HA 2ZSWA 4XGZA 1MHHB 1QYGL 2PXYC 2A73B 4M93C 2BHUA 4KVCH 5EU6B 7FABH 4PUBH 5FYJE 4ODWA 3OPZL 1WLHA 3LD8C 1ZA6B 1SEBB 3MACL 3I3EA 4LLYB 4HXBH 3ARDC 4FP8H 1NGYB 3CXDH 1EHNA 3G9VA 4Y1AB 1RZKC 2JJWA 3WUZA 2JKXA 1OGTA 2DM4A 4ZTOL 1OQOA 2ITCA 4FTVA 1R3IH 3WBDA 5FYJH 1D6EA 4HQQL 4YHIA 3X12A 2KZ1B 2VLKD 4KK9C 1J1XL 1KLGB 3ESUF 5F70A 3MFFA 4P5TB 3HB3C 1MCIA 5C09D 4R96B 5CEYA 4WHYG 4L8CA 4KRPB 3OR7A 2YUXA 4OF5A 3UTTD 5C3TA 1FSKB 2PUQT 1BPVA 1EO8L 4WU7B 5KOVC 5FA3A 3VGAB 1Y18B 4PJHE 5D70H 4J3VA 5SWZA 4LPWA 2A74A 4G8GE 5E4EB 2VLJB 3IDXL 1RUKL 1ZANH 3RVUC 1IEAA 4WI2A 3IFPB 4LCIL 2RJMA 4GG8A 3IDIB 4PJAB 4Y4KB 5FF6B 5C0BE 4I0KA 1T89C 1NGWA 4OGXH 4ENED 1ZHKB 5AD0A 1GC1H 3SBWA 1REIA 3DROB 4HIIB 3CUPA 3RTQB 4FTVD 2IANA 3S5LB 4LVHB 4B53A 2X4NA 1N8ZB 5ALBH 1NCNA 1XF2A 1R0AH 4XPHH 2XRAH 3ZE0E 3CFIC 1MVUA 1FH5L 3HE6B 4YR6B 4DKFL 5ELIA 3T2NH 1W72B 3NCEB 2AK4E 1SY6A 4J3TA 3H9HA 2GY7B 1P9MC 2L4OA 1X5GA 4JM2C 2GJ6B 3TO2A 2FJFB 4X4ME 3IGAB 5T5NG 3SEPA 5SWZD 1JBJA 1X5LA 4F37K 1C08A 2YD1A 4XP4H 2IBBA 4LSPL 4A6YL 1WFTA 2A9MH 4X7TA 2ZOKA 5F6HJ 4C4KO 2J6EH 5C3LD 1E6JL 1UKSA 1G7IA 3C2SA 1OGAE 2P5WB 5GRVK 3X3GL 4ONFL 2ZG3A 2ZJSH 4OI7A 4LASH 1EGJH 1HNGA 3CX5J 4PRDB 1AXIB 1XEDA 3ARBB 4K3JH 4CRPA 3WFEL 5HBBA 4DEPB 4KKCC 4YHMH 1KIUA 4PJXA 4OQTH 4QHMB 3S97C 4OZFB 5DC9B 1B9ZA 2DQUH 3RWDA 4PLNC 3O2VL 4BH7A 4EN3A 5ISZE 4X9GA 1P6FA 4OSUH 1CVSC 43C9A 2BY3A 3O3DB 4H88H 5FYKE 1NCWH 1NGQL 5I19L 1NAMA 1S9VA 3TNNB 1VKXB 3WE6A 3CCHA 2BDNL 4NRYA 1HH6B 4H1LG 1J8HB 5TDPA 3PWPE 4Y7MA 4D0BB 4HHAB 4P2OB 1RV6X 3VXPB 3W2DH 2BOBB 2RCSL 3GNMH 4PLKC 5T33H 5B8CA 3BDXA 2XQBH 5GIRA 1MF2L 1XF4B 3QRGH 2IPUK 2BJMH 1R3JB 1RK0A 4PG9A 5FYKH 3KHQA 3P0VL 4XPBL 3RWEB 4M9OA 1MCSA 3MRDB 5EDXA 1OTUC 5IVXA 3U6RB 1VA9A 2Q86B 2Q8AL 3MV8B 1RULH 3VFOA 1I4FB 2A38A 1L6ZA 4F8QA 5IBLD 2K7QA 4NNPL 4W68A 2NY7L 3MRNA 3NFNB 2YC1B 5MP6H 4Y19A 1JWUA 4XCCL 2DWEB 1D5XA 1Z3GH 3QH3A 5T3XD 3QIUC 3VXSB 3RWIB 2FIKA 3U4BL 3ZZ1A 1KACB 4U2YA 5T3ZE 2E7LA 2QHRL 2R1YB 2WWMD 4M1CC 2QR0B 3KYNA 5LXGL 4U0QB 1QFOA 1TVBB 3VFSA 4B5EA 2XG4A 2NY4D 3ARZA 3WJJC 1SBSL 2EO9A 4QOKE 3CU7A 5DDHA 1MLBB 5ITBL 1HHIA 3WNOA 5K9QG 1CE1L 4JVWA 3BWAB 1IAIH 1U36A 5T3ZH 4MDIB 2NR6C 4ZS7H 4G8EB 5IESL 3RJDA 2IMMA 5B38A 3G04A 2JCCF 5DHYB 1FO0H 2NY0C 4UTBH 3IU4H 2KZWA 4ZO6A 4GRMB 4X5LA 3MOAL 1LO4L 2OTUA 1AD9B 5CS7A 4Y89A 1E4XL 2AXGB 3RWGB 4M3JA 2AV7B 5KZCD 1EH9A 3IXAB 1Z9OA 4FXLA 4M7JL 3V4VH 1D5BA 2DF3A 2ATPB 5GRUH 5DC0A 2Q20A 2VAJA 1MI5B 3BZFA 3SE4C 1A64A 3QI9A 4QGTA 1WCBB 4QF1A 5F3BA 2P4AB 4IJ3B 2X6MA 3H9ZA 2IPUG 4LGRB 1P4LA 5ICZB 4LDEB 4RMTA 2HN7B 4HIJA 4X6CB 5HHOB 3TIDA 1MVFA 1NDGB 3QUZA 4LRNL 4NYLA 3VXTB 1DANU 3NABH 1T21B 3RNKB 5I16B 3T3PF 4NCDA 2X4SA 2Q6WA 1WBXA 1I9JH 3U7WL 2DJUA 5KSUA 4F7TA 2ED9A 1S9YA 3QIWA 1T20B 3G6JB 5C0EB 5FKPA 1CGUA 2XZAL 4JLRB 1I1CA 3PWLA 3G5XB 4HJ0D 4OJFL 3GGWA 4L4VE 4MMZC 4M6ML 2HT3C 4DN4H 1Z5LA 2KUTA 1B6UA 4UZGA 4WENB 1VEPA 1LO0H 4U3HA 1LWRA 1UADC 1FNEA 4NN6B 1SY6L 3HFMH 4HUUA 2J3SA 1NUGA 3RVVD 3WEXA 2HRPL 2E9BA 3NH7L 1J88A 4X7SL 1BQHA 3KLAA 4XXDB 4HUXB 4YJZL 5JLZA 3LIZL 4Z78B 1INQB 1RI8A 3V7AG 3FN0L 2FBJL 2A1WL 4NO0D 1LD9A 4UV7L 4DGVL 3RGHA 4R90H 4ZAKB 5GS0D 3KYOA 5DURB 3K7UA 3RHWF 3BMWA 2JK5A 5TE4H 25C8L 1NMAL 2JJVA 4HC1A 4GAJL 5C8JB 1A6ZA 5IIEB 3BVNB 5KVGH 1U8IA 4IRSB 1CFVH 1F4AA 4ZXBA 1JCKA 2B5IC 2YPVL 2ICWA 4Z7WA 1F6FB 2QQKL 2ZUWA 1PYWA 2J8UB 4N8CH 3EZ8A 1MCOL 1MJ8L 1VFBB 4JDZB 5T3XL 3I6LE 1BFOA 4G8IB 1JNJA 1ORQA 2J88L 4Y4FD 3ZE1E 1NAML 1Q1JL 4LRIC 4Y5VA 1QFWM 2FO4B 5EN2B 5TH2A 3RJQB 1ES0B 4XB7A 1P7QB 2VXQH 4FQJH 5DSCA 3TPKA 1AI1H 1FVCB 2CKBB 2BNRA 3N50A 1ZS8A 2VQTA 5BS0E 3M17A 4F57H 2P5WE 1BEYH 1KB9K 5GGUB 4PR5B 5JXEA 2NY3C 4K94L 2R69L 4NWTL 5DJAB 4WW2B 2ATKA 2PYEB 1OAKH 3O3AB 1U92B 4OUUB 5E08H 3O0RL 1I3GH 4NIKB 5HHPA 3UDWA 4IMKA 3SE3C 1FFOA 5J57B 4ZXBD 1AFVH 4HBCL 4YBHA 5AUMB 1ZEAH 2DM7A 3BEWB 2JB5H 3NTCL 3WO3B 3KG5A 2YD6A 2VLKB 5EA0H 4POUB 4XP9L 3TGXA 3KPRD 4HW6A 4EI5A 4F7PB 3FN3A 2GITB 4YHOL 3S4SA 2FEEI 5C09B 4P2CG 1FCGA 4NQEA 4PBWD 4R4FH 1TQBB 2X1QA 4FA8A 3QEHB 2YSSB 5E2UL 5HI4D 2BNRD 1XIWC 2ZSWB 4NM8H 4X6BA 5T1LA 2RB8A 1MJJA 2B4CC 5E2TH 1CLYL 3IJYB 5EU7E 2VZTA 1TTGA 4JKPL 4RGOL 3MV8E 2DD8H 4ODWB 5JXED 1ACZA 2ARJA 1PG7W 1MNUL 3O81A 3RUGE 1X9QA 5L9DH 1INDL 3LV3B 4RQQA 5IBLC 3IU3A 3ZE2F 4Q97A 1CWVA 1OGTB 2FCBA 5DI8B 2EC9T 4Y8AA 5F7FA 3MJ8B 5M94B 5JW4R 1JRHL 3CFCL 3LKRB 3SE8L 3WS6A 4FTVB 4Q6IB 1D6EB 4R2GD 4K3EH 4HGWA 1I8KA 3CDCA 2EDTA 3G08A 4Y2DA 3X12B 3V0VA 1OSZB 3RVXC 4OGYL 4PJDF 3MFFB 2DLFH 3RU8H 5IGXL 1W8NA 4MQXD 9CGTA 4KHTH 5CEYB 4F7CB 4L8CB 4NQED 2NY4C 3OR7B 5FA3B 4O5LL 4RBPH 5SWZB 4UQ3B 5DD3L 3DX7A 2C3VA 2P7TA 4GQ9H 5T1LD 3VCLA 5HDQL 1KJ2A 1NC4D 1KFAH 4EDXA 4GG8B 3WO4B 4YHPA 3B9KA 4YDJB 1NGWB 2OP4L 4DK6A 5AD0B 1BD2B 2YK1L 1NMCB 1WVZA 2WIIA 4CU6A 4I3RH 4OFYA 1MAMH 2GSGA 5IVZB 3VGFA 3CUPB 3TYGH 2IANB 3FQUA 1GIGL 5GS0L 2X4NB 3WDJA 5IHZB 3WMSA 1EPFA 1XF2B 2UV3A 1BQHG 4FQPA 2A6IB 5C0JB 3PUCA 2BVQA 1MI5E 3EYUH 1UA6L 3EO1B 1HINH 1MJUH 4G9FA 4Y2OA 4DN3H 1FL5A 1OAUH 4HIXH 1A7NL 1A6UH 1J8KA 1J0IA 1DTUA 2WWKT 4I3SL 1C08B 4HD9A 4RAUB 2DYPA 5JORA 2FB4H 1Q0XH 1K8DB 5IFAH 4X7TB 4X6CE 2Y1VA 5HHOE 3LEYH 4R8WH 3OB0H 3B9KD 1G7IB 3MRQB 4M62L 2NY5H 5DVNA 5DQJA 3AS1A 1A3RH 1J0YA 3B43A 1EFXA 1NBYA 1LO5A 5LCVH 4OFYD 4N1HB 4PJXB 5F1SA 4HMCA 1JYNA 4ZDHA 1R5WA 1YEDA 4OKVA 4ZSOB 3ILQC 2ILLA 4QXTA 4OBRA 4EN3B 1LE9A 4HC1L 3WS3B 1IJ9A 3WFDH 1FAIL 3HAEH 43C9B 2FEDC 3LB6D 1NAMB 3WE6B 3EJZD 4PP1C 5AYUH 3DIFB 3DTXA 1F00I 1JPSL 4XP6H 4RGNC 4ODHH 5CEZD 1RURH 1DBKH 3REVA 4X4ZA 1VFUA 2FX7L 2DYPD 3BP6A 4XXCC 3O2DA 5GIRB 3WXWL 4YQXH 1ZHNB 2VXSH 4PG9B 3UBXB 3H9SB 4BFEA 4LSRL 1QFWI 1FNSH 4FFZL 3VFTB 4FZ8L 1CDCA 2FJHA 5GGVY 3F7PC 1T5XA 3O4LB 5HVGB 5D2NC 3UJIH 2Q3AA 4ALAL 1EFXD 1JHKH 3WNKA 3ZMRA 3ZL4H 4M5ZL 2FD6L 1N26A 3MO1A 3MRNB 3ZKNC 2VTFA 5L8KB 4Y19B 5I9QC 4E9LA 1JWUB 3D39D 4LSVL 1JWMB 1D5XB 1T66D 3F65A 2FIKB 5HDBE 4HJJL 3TM6A 2F5BH 2DRUA 1TJIH 4Y4FC 1RIHL 1UWGL 3KYNB 4LK4A 5MI0B 1BFVH 3VFSB 1R3KA 1TJGH 1Q0YL 4WFEE 4P4KA 4UU9A 5DDHB 1NAKH 1HHIB 2AAVA 4RGMB 3OKMA 3LEXB 3MRMA 4IIQC 3S88H 4ZFGL 1SEQL 4J23A 3QHZL 2I24N 5ANME 4E41A 1KIRA 1MFBH 1MH5A 2CKBH 5B38B 4IOFD 4N0YL 2OTUB 4WFFE 2BVPB 1F3JA 1HEZA 4D9LH 5FEBA 2E7CA 3TN0D 1HOCB 3NFPB 5MERB 4DGYH 2XZZA 3MLRH 3EBAA 3U82B 3WFBL 1FFRA 4DGIL 2UVFA 3RIFK 2VXVL 3ARPA 5E6ZA 5TDOB 3MSPA 3BZFB 2X1OA 5GPRA 1CZ8L 3QI9B 5HI4C 1RUAL 3FOMA 4QF1B 1ND0A 3VRJA 4UAOC 1NL0H 2XG5A 3LAFA 4NM4H 2H1PH 3VFUB 1P4LB 3AUVA 1B0WA 1KJ2L 4E41D 4XNZB 4HIJB 1S8DA 3FQXA 1HSAA 4PRAA 3TIDB 1B2WH 5TDNB 3QUZB 4NYLB 3J7HA 1KLUA 1ZT7A 4OT1H 4WRLA 5SX5K 3QO1A 3BD4A 3CDGA 1PLGH 5IHLB 5A1AA 4HCRH 2X4SB 4LL9A 4MCYA 2Q6WB 4ZD3H 1WBXB 4RFNC 1AJ7L 2WV3A 1AHWC 5TQ2L 1FZMB 4H8WC 1UZ8A 5KSUB 1NCCH 1S9YB 3QIWB 2EH8L 5D7SL 1JHTB 1AXSA 2ARJQ 1JPTL 2QSCL 3PWLB 5D2LF 3AMKA 1NCBH 4MQXC 1CD9B 5CILH 3V6ZA 2AJVL 4MNQE 3QG7L 3TP4A 1Z5LB 2ICEA 3TV3H 4QWWD 5F3HA 2AQ1A 4X5XA 1FNEB 1J5OH 4HUUB 2D0FA 3RWHB 5MEPA 3WEXB 1PZ5A 4TOYL 5H37H 3D1MC 3WD5H 3KLAB 3PGCA 4Q9RH 4JVUA 5JLZB 1NSNH 4C57C 1BFSA 3G5YA 4JZJC 4OGAD 3L95A 5D71L 1D5IL 3BN9C 3VH8B 1QFPA 4XBGA 1BD2E 4EXPX 3HUJF 5C2BH 5EFIB 2IANE 4MMXC 1A6ZB 3JTSA 1V3LA 5D6CA 1MELA 1CCZA 3L1OL 1YPZF 4M6OL 3CFBA 3UAJC 2ICWB 3ARGC 3MJ9A 1K3ZA 4Z7WB 1C7SA 1LDPL 3VU2A 4YHNA 3ZKXB 2EYRB 4P23C 4WNQA 4LLVA 4AQOA 2EH7H 4FFVC 4QTIL 4KXZH 3H42L 3P73B 3IFLH 4MDJA 1JTTA 4ONOA 4XPAH 4Y5VB 5DJDB 4YBQD 2BNRB 5ACZA 1ZS8B 2MNUA 3M17B 1GGCH 4ZFFA 1UXSA 5I8OH 1B4RA 4JO2H 4KQ3L 2X4OA 3CSGA 3O2DL 3QR2A 2CUIA 5E4IA 2MQCA 3NCFB 1T80A 3STZA 3BAEL 2ATKB 2R4SH 4OCRH 4BUHA 1QLEL 3PHOA 4ZSOE 4PY8J 5HHPB 3W9DB 1FFOB 3L5HA 2EXYD 3O9WD 4R2GB 1G9ML 4MQTB 1KUMA 1A6VL 4HJGB 5EWIH 3LZFH 5F1KC 1I9EA 4L9DA 3NPSC 4R4BA 3BZDA 4EI5B 5I75B 5DQ9B 2NYYD 1CYGA 3S4SB 5D96C 4AMKL 4JO1H 4FFYL 3RA7L 3W0WA 1KIPA 2DTML 3VA2C 5C0AA 1A0QH 3EO0A 3H9SE 1IKNA 4M7LT 3WIHH 1N0XH 2J8OA 1MJJB 1OPGL 4X6DF 3SDCC 2I25N 1TPXB 3O4LE 4KAQL 4K23H 1EX0A 2J2ZA 4G43A 2ARJB 4HIEA 4M5YL 1DN2A 1G7JA 5JA8B 2BSRB 2R8SH 1D5ZA 2ICCA 4RQQB 2O61A 3NMEA 2IPTL 4QRSB 1FHGA 3IU3B 4HPOH 1T22A 1M1SA 4Y19E 5HDLA 3P0YL 2B1HH 4K8RH 1GGIL 3H0TB 1RUPL 3CMOL 4HGWB 3MUJA 3PQYE 4WU5A 3G08B 4Y2DB 2ZCKL 4MNGA 4HT1L 1MCWM 3ULUL 5FGCB 5CJOH 5DVOA 3RGVB 4ZO7A 2JIXA 2C3XA 2C4FU 4XBPB 8CGTA 3HPJA 1FVEA 4HG4K 4OD3H 3W0WD 1F90L 3WJLA 1G6RA 3H3KA 1WUNT 5C0AD 4KJPD 1LP9A 4G6ML 2FX8H 3H7LA 2C3VB 2X2YA 3VCLB 1KJ2B 2Y9RT 5DHVA 1BBDL 1I3RA 3O2WH 2CDGA 5DD0H 4EDXB 3PDOB 4O2CA 1HXYB 1I8LA 2E3VA 4YHPB 4OF0A 2VR5A 4HFWA 4P2RA 5J13C 2V7HB 3E8UL 5D7LD 4OTXH 2VJXA 1N2RA 3AVEA 2R4RL 2DJ4A 2P8LA 2WIIB 2VQUA 2GSGB 3QNYA 1VPOH 1XFPA 3QDAA 5F9OL 1IGFL 2XXMB 3UZQA 5KG9A 1BMGA 1KXQE 5F7HA 3AFLA 2PO6A 1J18A 4N90D 2Z35A 4OZIE 4XMLH 2JIXD 1IM9A 1NBQA 4ACPA 3LN5A 4P9HC 3G6DH 4G9FB 1ZTXL 1FL5B 1CK0H 1CD1A 4WVRA 5DEZA 5EZIL 1V05A 4O9HH 3AREA 1IC5H 4QNPF 4NN5C 1ZV5A 4YO0A 1FFQA 5GISL 5HHMD 4YHYC 2HLAB 5HVHC 1K4DA 2I5YL 3ZYJA 3GI8H 4P2RD 5DQJB 2YA1A 1MCKA 1IT9L 3ETBF 1EFXB 1NBYB 1LO5B 5C07A 2OR8A 3ZO0A 1S78C 5KANG 4YNYA 2FL5A 1R5WB 1YEDB 4XAWH 1LE9B 2PYFA 3UTZB 2PO6D 1VGEH 1F2XK 2BNUA 2YPLA 2YUWA 4OLWH 1EO7A 5JOPD 4JG1H 1JIBA 1T04A 4ODXB 4P2QA 4HK3N 3MJ9L 4F8TA 2OK0H 3DTXB 3JV5A 5E8EA 4Z7VA 1JGDA 4XPFH 3IKCA 2YS4A 5C6TL 3S8WA 4XX1E 4NZTH 3ARED 1NFDE 4MAYB 3O8XD 3IAGC 4JRYD 1CF8H 4M7LH 5I8CA 4Y5YC 3RRQA 2NW2A 1I7RA 2ORBH 4PLJD 5CUSH 2FHFA 2FJHB 4K7PL 4X98A 4BK4A 3ARXA 1T5XB 5IFHL 1XCTA 3UYPA 3KLHD 2NXYC 5C07D 1HYSC 1HDMA 3L3KA 5I73C 1YNKH 1FIGH 3MO1B 5IROC 5I15L 3GBLA 2DL2A 2LAAA 5E8OA 2J5LC 1C8PA 2YPLD 4IS6A 2IH1B 1TETL 2OTWA 5GGSB 5IMLA 3PL6B 4AEIH 1NCAL 4CVUA 1KEGL 3MUZ1 3MJ6A 5KW9H 1V8HA 5KOMC 1R3KB 4OFVA 3B2UC 4G5ZH 3OAZK 4HZLA 4P4KB 1KN2H 4TRPL 4LPXA 4ZO9A 4JFHE 2CO7B 4UU9B 4ODSL 3GMPA 1Z9SA 4D9RE 3CFKA 3X14B 3MRMB 3LHPL 2ZCHH 1LEIA 1S5HA 1NQBA 1F13A 1DQQA 5DD6A 4E41B 1UGNA 1MH5B 4TSAL 4TVPH 3F7QA 4RZCA 3OHXA 1OSPH 3ULVF 1P1ZA 4PJIF 5SX4I 1BLNA 3UTQA 1F3JB 1HEZB 1HIML 3O9WC 3SKJL 4JR9L 1FL3A 1OAZH 3BJ91 4Y8DC 4JPWH 4QO1A 1CVRA 3IDMA 4DQOL 4OLEA 2HLFC 3NIFF 1RMFL 1UH3A 3GMLA 4D9QE 4HULB 2XACC 4P4RA 5CD5C 5JHDA 4BH8A 2GUOA 4UDTA 3NA9L 4HMEA 1B4JL 4PREB 3L5WA 5E2WL 4C4KT 1IFHL 2HH0L 2OBGA 3K4DA 2HWZL 1R3HA 1KGCE 3FOMB 3P9MA 1ND0B 4MHHG 3VRJB 1NGPL 4KRNA 2VZUA 1G6RL 4AG4L 5F89A 4HEPG 4KDVA 2QKIA 4W6YB 5LGKA 1I9IH 3B2VH 1ITBB 1MPAH 3TT1L 1C5CH 1E4WL 3FQXB 1HSAB 4PRAB 4WI8A 5CIPA 1RK1A 4DKDC 3BN3B 1JNHA 3RPIB 1K4CA 1KLUB 4YFLF 2D31A 1ZT7B 3QO1B 3CDGB 4PIRF 3CFEA 5F7MC 4MCYB 3X13A 4NKMA 5C0ND 1UZ8B 4HIHA 2VITA 5AG9A 3WL9B 1WICA 5D9SA 5JZ7D 1AE6H 4U1GB 1AXSB 2NX5A 1F5WA 4WHCA 3P4NA 1FGNL 1X4ZA 4L4TA 2DQTH 4OIIH 3QCTL 3V6ZB 2ICEB 4PD4J 5E2JA 5F3HB 5JO5A 2JB6B 4X5XB 5DFTA 2NY6C 1F2QA 5MEPB 5FO8A 3V6OC 1PZ5B 3I2CH 3ZKMD 4AL8L 4ZOBA 3D18A 2VZVA 1WEJL 4YFLI 3PGCB 4IRJA 2AKRA 3G5YB 4KUZH 3PJSA 3WLWD 4XBGB 2R2EA 3BPLC 5EO9A 1QFHA 4XZUA 1A9BB 3LQAH 3JTSB 3V52H 3IFNH 4OV5A 2F5AL 4RRPA 5FIEA 3CFBB 5C0DA 4K9EH 4ELKA 1JZ5A 2YBRA 3QDHA 3CXHK 3DMMA 4YHNB 2XTLA 4WNQB 4LLVB 5B4MD 4J1UA 4JGUA 4XCFL 2LV4A 4L4TD 1BVZA 3NBNA 4I9WD 4PB9L 1XIWA 1SVZA 4OLYH 4MDJB 3SOBL 4AT6A 3QEUA 2PXYB 5HYJD 5E6YA 3TO4A 4K71C 3IXTA 5IF0A 1FRGL 3CK0L 4XNUH 5EZJA 4FG6D 4X9HA 4LPUA 1OAXL 4JJ5A 4NGHH 1BJ1J 3HC0A 5ACZB 1O5DT 1A14L 3C6LA 3KJ4B 4ZFFB 1UXSB 3CFJA 5LGHH 5FCUH 3RVTC 4PJ7B 4PP2B 4TN9A 1WFUA 2UZXB 3U9PL 3STZB 3BQUD 2EIEA 1UACH 2R1XA 4Z95H 4LSTL 2XPGA 2W60A 2LTQC 1BZ9A 3PHOB 1J86A 1QPXA 2FYYB 1T7WA 3TT3H 1NKOA 4U4BA 3DO7A 3ABZA 4TQEL 3HNSL 4OCWL 4CAGA 1I1AD 1VERA 1ULVA 5C1MB 2DQCH 2FGWH 3QCUH 3DMMD 5K9JL 3BT2L 3Q6GL 1RVFL 4RDQF 4Q0XH 2VZ3A 3NZHH 4TSCL 5IW1A 4R4BB 1YY8A 1WT5A 1WIUA 1AD0A 2D7TH 3W0WB 3TO4D 1RZ8A 1KIPB 1IGJB 3QDGA 43CAA 4CU7A 5DUML 3KPLB 2YMXL 3O8XC 4JZNA 3U36A 1BF8A 4U2ZA 3RQ3A 2ZG1A 1VEMA 4RISH 1FG2A 1S3KL 5HYIA 1OY3B 4CMHB 1JI2A 4PJBF 5CJBA 4LSUH 1FIEA 2E8YA 5IHBA 4NC2B 4HIEB 1G7JB 3EJYD 4G80A 1D5ZB 5JR1L 4DKEH 3DRTA 1PGRB 2R0LL 3LKQA 4MZ3A 4M1DH 5I1DB 1U91B 4PB0L 3FAXA 4PJFA 3TCXA 2WUCL 5C08B 4OIAA 4JFYA 1S7XB 4WU5B 3GK8L 4MNGB 5ADOH 1HZHL 1EHAA 4RWHA 4HWNA 2JIXB 4WV1A 2VDQH 1FVEB 4UINH 3AAZA 4GSDH 1LHZA 4NJ9H 4C54A 1ZSDA 3QDGD 5TQ0L 1G6RB 1CDIA 5HGHA 1LP9B 5F1NA 3RZCC 4EZMA 1MAKA 4GXVH 2PR4H 4JDTH 4O02L 3L3DB 3TIEA 1I3RB 4LSSL 5HGAA 1VDGA 4O2CB 2XZCL 3MROA 3EDEA 4TUKL 3ROOA 2AVGA 4QCIA 1QSFB 2EDDA 3WFZA 3OAYH 2OZ4H 4BZ1L 2KQMA 3PABA 3I6KA 4QTHA 5JQ6H 1UQSA 1HKLL 1EDQA 2C4XA 2P8LB 2OXGA 3QNYB 1IBGL 3QG6A 3D69B 1Z0NA 3LKPB 4FQ2H 4YX2L 5KG9B 1IZJA 1MFDL 3MLVL 4P46A 2PO6B 5FUCC 3GRWH 1RFDL 2GJJA 1U8PA 2GK2A 2Z35B 2X4QA 1IM9B 3QPXL 3ZKQD 5HGBA 1UENA 3T2OA 1KCLA 3LN5B 1BGXL 1AQKH 2D7NA 4LCCC 1GOFA 4NQDB 2BFVH 1EEYA 4QHUA 1CD1B 3C5ZA 3R1GL 1W0YT 3AREB 5DEFA 5DT1H 4RRPG 2VN7A 3VG0H 4MGXA 3CPLB 1FDLH 4MCZA 1K4DB 5D7IB 1IKFH 1BQLH 4NSKA 3CVIH 5D6DA 4TTDD 4Z5RB 3VXRD 1SM3H 4NQUA 5TF1H 1OVZA 3A6CH 3TJEH 2AP2A 1QUNA 3M07A 5C07B 3L5XH 3GMNA 1CGSH 1N6QH 5GS2H 4PJAF 4MA8L 3QIUB 2EYTA 5KVEH 4YNYB 5C0NC 4W4OC 4UT7L 1SJHA 5DD5L 3VXOA 3FQNA 2PYFB 1K2DA 4P46D 4TNWF 5JZ7C 3OMZA 2YPLB 1MCRA 4GMSH 2AJXL 4HKJB 2GTWB 4P2QB 1AGEA 1L4IA 4LEXH 1KTLA 5JUEL 1Q9KA 2IG2H 5E8EB 1CN4A 2GQHA 2HG5B 2HKFH 2EDXA 4IIQA 2EC9U 1EVTC 3EZJB 1WIPA 4HLJA 2VDOL 4X6EB 4UV4H 1UB6A 1UB5B 3BGFB 2DLGA 5I8CB 2CK0H 1G0YR 3LEVL 4M1GH 1FPTH 2NW2B 1I7RB 1GSMA 1DLHA 2CKNA 3WLWC 3SJVA 1GCFA 4X98B 1X5XA 2AJ3B 3BH9A 1H8NA 3VWKA 1HI6A 1XCTB 2ADIA 4JCMA 3RHWK 3FTGB 2CMRL 3DRQA 3FFDB 1HDMB 3L3KB 1A1OA 4L9LA 5KSBF 1DUYB 3JWOH 4H5SA 4HSQA 5E8OB 5IV2B 2C1PB 3HI1A 5ID1A 5B4MC 4HEME 1OAYL 4ZUVA 2OTWB 3HNTH 2BY1A 1ETZA 2UY7A 5DWUH 5FHAH 5IMLB 3CH1A 3FFCD 2CQVA 1BM3H 4F9LC 3U0WL 1MIEH 2F53B 4JO3H 5D5MA 5L2JB 3WNPA 1AQDA 3DUUA 1IGTA 3GMPB 4PRHE 3BH8A 3CFKB 4PJ7E 1N7ML 3BIBX 1M4KA 4V2BA 3BQUC 1LEIB 1S5HB 4WEBH 1DQQB 2HTKC 5DD6B 1K9TA 1Y6MR 1IMHC 4RZCB 5CBEA 3OKNA 3IS0X 3OHXB 3EGSA 1P1ZB 2RFXA 1RZKH 3CSYA 3D9AH 3UTQB 4YXHL 4KI1A 1I1AC 2R0WH 3OR6B 4R0LC 4OI9A 1C1EL 3BFOA 3GMLB 1J0KA 4P4RB 1RIVH 2MSPA 1XH3B 5JHDB 3NPZB 4BH8B 3L5WB 4J7RA 1N64L 1HWGB 4H20H 4XMKL 5DMIH 4OD1L 1YEEL 1QR1B 1K8IA 1KC5H 4X4YB 1L7TL 3HKFA 5F96L 4MXVF 3T0DA 3VJ6A 1OAQH 2VOTA 5KTEH 1YEJH 2QKIB 4ZTPH 2AQ2A 2ITDA 1UM6H 2BVUA 3NCJL 2XV6B 1A1NB 5CIPB 1RK1B 2W92A 3GI9L 1JNHB 2DQEH 4AIXA 4IEFB 1NC2B 5AWNL 3CNKA 1W0WA 2BRRL 2Y06L 1HXMA 4LPVA 2ZWLT 5C08E 3CFEB 4FABH 3V4UL 2VDRL 1XF1A 3X13B 4OBSA 4OZGE 5KN5B 1CU4H 4NKMB 1DVFA 1Q72L 5HHVH 4HIHB 2VITB 5D9SB 4UTAH 4PRNB 1YJDL 2BNQB 1F4YH 5BMFH 3SGDI 2NX5B 4XTRD 3Q6FA 3P4OA 1ZGLA 1UWEL 3OXSA 3P4NB 2AXFA 4I18C 4L4TB 4OFPA 2F58H 4P3WA 1KB5B 4L5FL 5I6XB 5JO5B 4UT9H 5F1OB 5GS1A 1TTFA 2K9UA 2BCKA 5FO8B 1GGBL 2NY3B 3OPZH 1CLZL 3QQ9D 4XC3L 5JXAL 1F11A 2V9RA 3D18B 4IRJB 2AKRB 3GJFH 3ZDZE 5J6HA 1QSFE 2FGZA 4RA3A 5EPMA 5IQ7H 1XCQA 5CINL 3U0TB 1QRNA 3C60A 4I48A 3OB0K 1RAMA 5L88H 2R2EB 5EO9B 4KK5D 4XZUB 2QSQA 3O3UN 3C8HA 2EE2A 4C56E 4JFPA 3JWDL 5ICXA 2OL3A 2EECA 3MLZL 4OV5B 3EO9L 1M05A 4I77L 1DVFD 1MEXH 3BIAX 4QHKJ 3SQOL 1T7ZA 4WY7L 1U8QA 3ZYIA 5C0DB 2F8XC 1CBVL 1U8HA 2YBRB 3DMMB 2N56A 5I1KL 1KB9J 5CJXA 4J1UB 1NJ9A 4NQDE 5GGRY 3SDYH 4ZNCD 1H3GA 4XVTL 1XIWB 4AT6B 3QEUB 1L9NA 3G6JF 1YY9D 3IXTB 5ESAA 5IF0B 5I18H 5EZJB 3PWJB 4JJ5B 5C9JB 3VFPA 5KSAA 3D2UA 3RDTC 5D7IE 1OWRM 3C6LB 3CFJB 4U6VH 2YN3A 4NC0B 5E8DH 3MODL 4K3GA 2AEQL 1MUJB 1QRND 1RUML 2R1XB 3C60D 3QNXA 4WHYH 2XPGB 2HFTA 2GI7A 2VDLH 4G6FB 4ZQKA 2W60B 2XTJB 5DJ6A 1BZ9B 5F1IA 3IDNB 5CEXA 4PRPB 2YKLL 3DO7B 1DQDL 2AEWA 1UG9A 2EDEA 5J0BA 5FHBH 1GOGA 3N0PB 4P2QE 2YD5A 3GHBL 3BJLA 3KXFE 3ARQA 5F6HI 4NWUH 5IW1B 1YY8B 1FYTA 4GRLD 4HXAH 1MCFA 1MRFL 4NNXA 3MCKA 2JJSC 3ROLA 1MCPL 3EFDH 4U1MA 1BJ1H 4JZNB 3U36B 2J8UF 3SKNB 4M4PA 2YZ8A 4MJIE 5L0QB 4XC1L 3VMPA 4EBQL 1FG2B 1OLZA 2C26A 4C58B 1CD8A 4LLUA 2V17H 4JHAL 2H9GA 3F5WA 4KU1A 3C9NB 3EW3B 1AGBB 3FHAA 4FQLL 1JGLH 2DLHA 2DWDA 2GFBA 5E5UB 4G80B 5F7EL 4FNLH 4KKAD 5IBTH 4WWKC 5JIPA 1BOYA 5I30L 3UROR 3LKQB 5J9PB 4JDVA 2EDWA 4MA1C 1F6LL 5CGYC 3S36L 4PJFB 2VL5A 4LNRB 3AROA 4JFYB 3NFSL 4XVJH 1DBJL 5HVFB 5I0DA 3TZVD 3AY4C 2IQ9L 4QRTA 4WV1B 3L3IB 1H5BA 2F53E 5IHUL 1ZSDB 4GBXA 1QO3A 3L7FB 3RAJL 4LPYA 2APTA 5HGHB 1JNNL 5KSVA 4LIQE 2HVJA 4NUGL 4Q74A 4OLUH 3TIEB 4LMQE 1K3IA 2ESVA 1U3HA 2EZ0C 1T2JA 1V3JA 4J6RL 5CAYB 3P77B 4H1LH 3V6BR 3PABB 3RZWA 4QTHB 1HNFA 1UQSB 5DJ2A 4AENA 3OZ9L 4LIQH 2P49B 4UI2A 1S9WB 3QG6B 4V1DA 3UTTE 5IBUB 4QRRB 5JMRA 3KGRA 4XWGL 4MYWB 4OCSH 5JHDE 1FLRH 3CH8A 1U8PB 2X4QB 2I60L 1TENA 3T8XA 5EO1B 3MNVA 4PGDA 5I1HH 5JMOC 3P4MA 4HS3A 4GBXD 5D72L 4WI9A 1OTTD 1EEYB 4QHUB 2XQYG 3C5ZB 4F3FB 2KH2B 4DW2L