2I60H

Crystal structure of [phe23]m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
228
structure length
221
Chain Sequence
b'VQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXTERIOR MEMBRANE GLYCOPROTEIN(GP120)
publication title Combinatorial optimization of a CD4-mimetic miniprotein and cocrystal structures with HIV-1 gp120 envelope glycoprotein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 40
structure length 221
sequence length 228
chains with identical sequence R
ec nomenclature
pdb deposition date 2006-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i60H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i60H01
5EORH 1F58H 3ULUD 5IFHL 4POUB 5IOPB 4G42A 2K1MA 3HPLB 1R3IL 3EIFA 4WIQA 2QSCH 5BRZB 5DJ0A 2B2XH 4X6DA 4PV8A 1A4JB 4IRSD 4O58H 1BIIA 1T66D 4KXZI 1RJZA 3HN3A 1JHTB 1QBMH 2XTJE 3HZVA 1F45A 1HIMH 1R3JA 1XGUA 5KVDH 2VAJA 3LQAH 2W65B 4LQFL 5SWZB 3H8NA 2FO1A 4X0KA 1KFAL 5JIHA 3SKMA 4YXKL 4PP2B 4MB3A 3VD3A 3EYOA 4ZDHA 4GRWF 2XN9B 3A6BH 1RUPL 2G5BA 4U1IB 1XR8B 1K5NB 5LWYL 4W4NA 1JGEB 4TUOA 4HIXL 1JYWA 2VH5L 1ZMYA 2ED8A 4NPYA 3MROB 4HV8A 3QDJD 3JV0A 3I3DA 4M7JH 1ZHBB 2NY4B 5CAYB 3QWQB 1TETH 4MYWB 4HKXA 2C9AA 4UINH 4XVJH 3D5OF 3FB6B 3FHAA 4L4VE 1WIPA 2OR9H 4G9DA 1WFTA 3BN9C 2XWBB 5IQ9A 3ARVA 1CQYA 5DLML 1HE7A 4EXKA 4M1GL 1RURH 2F53A 2V7HA 5IW6A 2ZCKH 3MRCB 1D5XA 1EFQA 1G7LA 1MJ8H 3EYUH 5CINL 1OAUH 3EYFA 4GS7B 1KB5B 3DHJA 1TJHH 5IVXE 3T04D 3PNWB 2PYEB 1EEZA 1RZGB 2X7LA 5CBAA 5IMKB 5T1MB 4KZEH 5DD5H 5A2JH 3SKNB 3VXRD 4GS7C 2COQA 2JELH 3HE7A 1J1OH 3VRIB 5CZVH 4Y1AB 3VDCA 4LSPH 1XF2B 1QEWA 3QHFH 1S7RA 4Z7NE 4XC3H 4XXCC 5AYUH 5C8JB 4P4RB 5KJRL 2R39A 4MJ4A 4JM2D 1A14H 1KJ3L 4PJ9A 1YNKH 1OP3H 4PJHF 2ZG1A 1MFCL 4GO6B 1FL5A 4PBWD 4L29B 2X4TA 2HWZH 1A7PH 3C6LD 1N6QL 3OKNA 1HZHL 4M6ML 3G08A 4KXZH 4FG6C 3JWDH 4PFEA 3FO0L 2BCKB 5DQ9A 2FJFB 1DQTA 3NIDE 4PRIA 3C87A 1OCWH 1SMOA 4M00A 4X6BB 3UJIH 3DXAD 4JY6B 3UTQB 5BS0E 2AK4D 4KJPC 3WE6B 2XFXB 5E2VH 5EU3A 4GAJL 4RA3A 3MLYH 1KN4H 3PP3H 4YFDB 4N0FA 4POZC 2X70B 3FB8B 1ZWIB 4OKVA 4QRSB 4JFDE 3P4NB 2P8PB 2AXGB 4L1HA 1RJLB 3VXME 2DKMA 5EU6D 3MV9E 4ZUTA 3VFMA 2DM3A 4XP9L 3NPSB 4YO0A 3FB5A 4OSUH 4OI7A 3CZFB 1YEEL 5GZNC 1ZHNB 3D9AL 3VFTB 3V6OA 1CFNA 5I1CL 1BFVL 1PG7X 4JDVA 1FYTA 1INEL 5D1ZA 1QSEE 3NPSC 2ZSWB 4K7PL 3BPOB 1U8NA 5C0ND 5JW5B 3ESUF 1H3WM 3OZ9L 2CIKB 2ZOLB 5E8DL 5CGTA 5C7XL 2ICWJ 4KHTL 1NKOA 1NAMA 3BDYL 1KB5H 1UZ6E 2OL3B 3BPOC 3FFDA 1I8KB 1PY4A 2NX5B 2AJVH 3WFHB 4ELME 3PWJA 3RNKB 3Q6FA 3IFPA 5JDSA 1ITBB 5GRWA 2QEJA 4W4OA 4RGOL 2HKHH 4OGAD 2BOCB 2QKIA 3HZYA 4YHIA 1LO2H 2PR4H 1YMHB 1K2DB 1Z5LA 4Z7WF 1DUZA 4YQXL 3K2MC 1BQSA 4PG2C 3DVGA 4DVRL 5IF0B 3BRGC 3SJVD 5D2LE 4YXLL 3DROB 2YPVH 5LAXA 3KLHD 3TIDA 3SQOH 5DRZB 4WUUE 3WN5B 1CXHA 4M1CD 4PJ8D 3GJEB 1NDGA 3H7BB 2EDDA 3QIWA 5FHBH 5EO1B 3CK0H 4JQXA 5T3ZD 4PJIE 3HUJF 1JV5B 3CVHB 3TCLA 3BZFA 5J57B 3AB0C 4KFZC 2A0LC 3CLEL 4HAGA 1IM9D 1T5XA 4WUKH 4PJ5B 1H3UA 4I5BB 4QXTB 3SDDA 3MBED 2GK0A 5L9DH 1AD9B 1U8LA 5B39A 1EXUB 4ZSOA 1X4YA 5T33H 2ADJB 4MXWL 4LHQB 4KK6D 1WBZB 5JO5A 2RIKA 4FQ1H 2Y6SC 5H35B 5ID1A 1KT2A 1YY9C 3QXAA 1LK3H 4JKPH 5IEHB 3U7AA 3ZHLA 1BJ1H 2JJTA 4DGYH 3DMMA 4PV9B 3D69B 5IV2A 2GAZB 3BISA 4PGBA 1EH9A 4FMKA 5KSAC 3U9UB 4XAKD 1UG9A 5MEOB 4I3RH 4S1SH 4IJ3C 4AT6A 4K8RD 1RQ5A 3QDGD 4PTTB 4HXBH 5KAQG 1C5BH 5EFIA 2WANA 4OGYH 2VLLA 4NZTL 3G5ZA 4Q58C 1NMAH 2W9EH 3U2SA 4X8JA 1M6OA 1RIHH 1LEKB 3ARGD 4O51A 1KPUA 1FV1B 3JVGC 5AG8A 1EO8L 3VFGH 3IVKA 2XQBH 1FVDB 3BWUC 1EA9C 1F3JB 1UWXK 1TQBB 4ZPTB 5ID0B 1B0WA 3QUYD 4LVEA 1IFHH 3DNKA 2ATPB 2IH3A 1TQBC 2IFFH 3V4UL 4Z7OF 1I9RL 2BXYA 3LH2L 4X99A 3QIUB 3E6FA 4YK4B 1V7NH 4J3SA 2GTWA 1S5IH 1GSMA 5L8KB 3D39A 2H3NA 3WXWH 3DVIA 5C86A 3L1OH 1AE6H 2V17L 4YK4C 2CXGA 4QRRA 1SJHA 3RY6A 1Q94B 1RZJH 5CUSL 1DSFL 3NZHH 3T65A 4PYHA 2P47B 1DEEB 3RL2B 5HVFB 1E4XL 2Z0BA 3AROA 5D71L 2NXZD 1I7RA 3KPMA 4LEXH 2YZ1A 5TQ2L 3W2DH 3LKNA 4Y5XB 2AERT 2D7NA 4WEBL 1RI8A 4RMTA 2MCPH 2NY3D 1KF9B 5C0GA 1MHHB 1JGLH 4K23L 4R9HA 3P4MB 4Y5XC 4XMPL 4I48B 5GS0H 4J23A 1XF4B 1FSKB 1XZ0B 3FO1A 5C09A 4IRJB 1NBZA 5I1EL 1L0XA 4P99A 3RY5A 2X10A 1LE5B 1UCTA 2D0HA 4Y5VB 3NIGE 2Q86A 4RFNB 1OAZH 2BK8A 1FSKC 2KZWA 4U6XA 1N64H 2GJ6D 2DI7A 4P5MA 4KK8D 4Y5VC 4HK0A 4RFNC 1IGFL 1OAXH 1I8MA 1ZS8A 5I2IA 4NQTA 4N68A 1XIWA 2O5ZL 5K59E 1OL0A 5ALCL 2GITB 4DQOL 3AMLA 2YD1A 4RX4D 5JW3L 5E9DA 1JL8A 2IH1A 2R56L 5DRNB 3PWPD 4HKZB 4QGTA 5I8CB 2ORBL 1ADQL 2AGJH 4PJGA 3O8XD 5C0BE 1HINH 2X1PA 4Y4KA 1IL1A 5DMKA 4DTGL 1G7MA 4FFZL 3WFBH 3M07A 3IAGC 4NO0D 1SQ2N 4QGYA 3VD5A 4AIZA 3HNSL 3PP4L 1IGTA 3MRLB 2EYSB 3U0WH 3QQ4A 4MAUL 3BGMB 5BQ7B 4R4NC 3S5LB 1CICD 5K9OA 1OPGH 2O93L 5CJOH 3ILQD 3QIBD 1E4KC 1NC4B 2CK0L 1ED3B 3T3ME 5I0DA 3O6LH 3RIFF 2H2PC 4ZXBB 1TITA 1JWSA 1UH3A 3QEQE 3QWOA 3NFNB 1DL7H 2OTPA 5F6HI 1T0NA 3RVWC 5JW4R 4LKCB 1BREA 4WI6A 5EH1A 4IOFC 3GGWA 1YDPB 3AY4C 5D5MF 3BQUA 1J5OL 2H9GA 4AEHH 4RQQA 5FA3A 4P9HL 3RVVD 1T0MA 4Z18A 3D2UB 1I8IA 1QLRA 3PWUA 1FDLL 5I1JL 4HW6A 2MPAL 4KUZL 3N1GC 4ZFFB 3P4LA 1OSZA 3Q6GL 1NGPL 1FFNA 1KLUB 3WSQL 1R3LB 5DVLA 1JTTA 1U6AH 3WV0A 1LEGA 2EICA 3TVMB 1I9IH 1EHAA 4XI5D 5JXEC 3MV7D 5EU5B 3TBTB 1HHGA 3RUGE 1Y18B 5J3HD 3TVMC 2OK0H 2VZOA 5BZDA 5LGKA 4CUCA 1YECH 1MY7A 4WDIB 3FCTB 2JCCE 3QXDB 4F9LC 4YH6A 3HAEG 2NY1B 1BZ9A 1E27A 2QTEA 2JK5A 5CMAA 1UH2A 4OD1L 1KC5L 1Q72L 1T20A 4R0LB 3RAJL 3VI3F 2V9QA 3DV6A 3UROR 4HT1L 3BWAB 4FFVD 3V7MA 4NQSB 2FLRT 1FYHB 3PHOB 3BEVA 4R0LC 5IT2L 5C0FB 5IFAL 4ZAKA 1P7QB 2ZWLT 3O6FB 5IHLB 4LLQB 2VXQH 4L3EA 3D0VB 5I1KL 1Q0XH 3GHBH 5T3XE 3B9KA 3X3FH 3PQYE 1HH9B 3O6FC 1BVLB 4HPOL 5ESVB 4LSSL 4IS6A 1DBMH 4HZLA 1FJ1A 1MUJB 5AWNL 4Y2DC 4M61A 3M1BA 5EC1B 5I1HH 2NY7H 1WT5C 3FN0H 4KI5C 5JUEL 1T2QH 3WDIA 1OGAD 1U91B 2BSSA 4LLDA 1IEBB 1KTDB 2Y9RT 1RZKC 2X4SA 3MRHA 3OKMB 4YHMH 4QHLB 3UXFA 3QISA 2FD6L 4G80A 3BO8A 2ESVD 1S9WA 1YYMH 4ZS6D 5D8JL 4P3CL 1A9EB 4NKOA 3MJ9H 5DJDB 3FOMA 4PJCA 4RFEB 5DEFB 3TWCH 2E8ZA 1NGZB 3D3VA 3FZUD 3ZE2E 5CP7B 2FEDD 1MRDL 1HNGA 5KTEH 3BT2L 4D9LL 43C9B 1VKXB 2ZUTA 5TDOB 2A9ML 3K2UH 5D7JB 3JBG7 2YUWA 5F70A 2ZUXA 3OKEA 4WFEE 5CZXD 1SYSA 1GC1C 5F1IA 1A7RL 4DK6A 5F9WB 1T7XA 1ZANL 4HEPG 5D7JC 3GBNL 3AREB 1UVQB 3PIQB 4PRDA 2IAMA 5GGUA 4OV5A 1FVCB 1U8QA 3LB6C 4F7MB 4TNWF 4OLWL 2I60H 4HCRA 5F9WC 3T4YB 4BH8A 4ODHH 5B3JF 3AREC 3AGVA 2D7MA 1JNHA 4QRTA 3O9WD 5BVJA 1FIGL 3D1MC 3P11L 2EDTA 3IJHA 2F5AL 1OSPH 2FZ3A 2OI9B 1MCRA 4KMTH 1HXYA 1YJDH 4Q6IB 2ZSVB 3O0RH 3MNZA 3WD5H 3PJSA 4Q6IC 1O0VA 5FYJU 3HAEB 3P73B 3P9LA 1QLFA 1EHNA 3LRSB 5DD0L 4UU9B 5C6TH 3F7RA 1X5JA 2UUDK 4JFPB 4KQ4H 5F6IB 5DS8B 1QR1A 1DQJB 1EMTH 5IEKB 5DDHB 3I9GH 2H6PA 4LDEB 5F6IC 1Q0YL 3MRIA 3FHQA 2E7CA 4OCWL 2PO6A 1AGBB 4KWUA 1MLCA 3RWJA 2W92A 1YNLH 4FZ8H 4RGND 1K6QL 4MNHB 1NLBH 1FZOA 3G04B 3BUTA 1SJXA 1D5ZB 1MLBB 1FORL 2X4PA 5DMYA 3RZCD 5DJ6B 4MVBD 4TOYH 2ATKB 1I85A 4M5YL 2DLTA 3MGTB 1A7QL 5IW1A 5KVEH 1MCWW 4ETYA 4O4YH 4LIQL 4HLJA 3MRKB 1HYSD 3G9VA 2C26A 2V9TA 3G6AA 4QTHA 1KYOJ 2VLRA 3TCXA 1H0DA 3K1KC 2X4OA 2DQCL 4B41A 3THML 3Q5OA 1UJTA 4KRNA 4LCWB 3G5XA 1G7JA 2B4CC 4P3DB 5D7LA 5T1DL 5GJTH 3DI2B 4GMSH 2AJ3A 1L7IL 2VXVH 1D6VL 5HHMB 3OV6A 1SBSH 4X6DE 2A6IA 4APQA 5FKAA 1HHKA 3H0TA 4F7PA 3S96B 4XWGH 3DO7A 2VAAB 1A9BA 1BX2A 5LQBH 3I2CH 4G6AC 5DT1L 1NAMH 3LY6A 3VXOA 2CRZA 4J12A 4HH9A 2HT4D 3FO2A 3CFCL 2ID5A 2NY6D 3VXUA 3X12A 5KAQF 3BXNB 5L2KD 4G8GA 2FR4A 1FFOB 3W0WD 3RVXC 2VQ1A 3FONA 2DQHL 4JFFE 3GSWA 1KN2L 1MF2L 2HJKB 1F6FB 3HAEH 5FOBB 5INCA 3Q2CA 1J8KA 1NCCL 3Q3GA 5D1QD 7FABH 2P7TA 3BPCB 4DFIA 1ZVSA 5AZEL 4OD2B 3ES6A 1N7ML 3RGVD 1FL3B 1CL7I 3T2OA 4GBXD 2XZAH 1JP5A 1AKJD 1I7ZA 5DUMH 1BLNA 2DDQH 5F44A 4UIKH 3WIIH 4U3HA 2AI0L 2F53E 4PJEA 2P24A 2X4NB 2EKJA 4MJIE 2GTZA 3AM8A 4R7DA 4UDTA 2IPKA 5I8KH 2B1AH 3LMJH 2OQJA 4GOSA 4IOSD 5LCVL 1OF2B 4LHUG 2FX7H 2OMBA 3FQXB 4JR9H 4OZFB 1W72B 1F4XL 4OGZA 1ZT7B 4BKLB 3IJYB 4GRLA 1K4DA 1YNTA 5IG7A 3LPWA 4UV4L 2YMXH 5TFSH 2FRGP 4H20L 4NN7B 5ACZB 1LQSR 2IFGA 2AXJA 3D18A 1U8PB 1BOGB 4JFQB 1C1EH 4PREB 2IANB 4KAQL 4OQTL 4WWKA 5DHVH 1NGXA 2VZUA 1K3IA 4NN7C 4GKZA 4FRWA 5L2JB 3FT4A 1CGVA 2E27H 4HJ0D 3ROLA 1DBKL 3VRLE 1WZKA 4NUGH 1S7QA 4UILL 3JSSA 5T5FH 2IADA 1RVFH 5IJVB 3O4OC 1MJUL 3C09B 4XWOC 3REWA 4PRIE 4XBEL 5FUOL 5CLWA 3O4LD 4YGVB 3WFCH 3UJJH 1JRHI 2IQAA 2BFVH 2N1KA 5C9JB 5GS2H 3VFNA 4YDJA 2YEZB 1T7ZA 3NN8B 3TLRA 4G8EA 5HPOA 4NJAH 2R2EB 1T3FA 4NKMA 1CFVL 3NCMA 3P77B 2R0LL 3T09A 3GRWL 4M7KL 3UTSB 3ARDD 1GGCH 4JEGB 1S9VB 1T5WB 2F9BT 4LNRA 4MZ2A 5DK0A 3IDIB 3V6OE 5J8OA 1GIGL 3SDYH 1FYTE 1HKFA 1U3JA 3SE9H 1X5AA 1T4KA 2CLZA 3C60A 5MENB 4OTXL 2WUCH 3BH9B 1OTTC 1DBAL 3QO1B 3ALXA 1IAKB 1MCLA 2C3WA 3EDFA 2NW2B 1IC4H 5AD0A 1AXSA 3MJ7A 5F72S 1IRAY 1PQZB 5JHDE 3WIHL 2GT9B 3MOBH 4PG9A 3ZKXB 1TNMA 5DZLA 4NQEA 5TDPB 2NTFA 3O3BA 5HGBA 1JPFA 1BBDH 3TO4A 3RWIB 2BX5A 4OLVL 2XTJC 3CGTA 4JPKL 1NMBH 3MJ6A 3WFDH 5CKGA 4BA8A 3CXHJ 4XPTL 2DWDA 4XNUL 1NBYA 3IFNH 4DGIH 3IDJA 2W0FA 3O2WH 3KWWB 4U4BA 2BNUB 4TVPE 1MCIA 1MWAA 3MLTB 3SE3C 4O2EB 4JPWH 5DJZB 4P59L 1U2HA 2X09A 4DW2L 4JLRA 3CFEA 3MV8A 1KCSH 4JQVA 2P46B 2H41A 4YAQB 3EO1B 4TPRH 4L4VB 1FL6B 4MLSA 5EUOA 2HLAA 4GJTB 1A4KA 4V2BA 1OB1B 4TSCL 3S97C 1JN6A 2W9DH 1JRHH 3LS5L 3R06A 1UM5H 1T6WA 9CGTA 5HD8D 4RA0C 3KPPB 2BVPB 1I9JH 3MRFB 5IVXB 4IRZL 4ZSOE 5A40E 3EOTL 4FHBD 4ODVL 1A1OA 1S8DB 1JPST 3QAZC 4OLZL 1BFOA 4XX1G 3BP5A 4XP1L 5E6IB 5D7IA 3D25B 4K3EL 4FQ2H 4J8RA 3QDMD 1AXTH 3R1GH 3MUZ1 4EN3D 2R4SL 4Z7QE 4XRCB 4WFGE 5T1LA 4QF1B 3BUYB 1CK0L 3MRJB 2CGRH 5AG9A 2V5MA 4I9WD 5F89B 3ZYJA 3N06B 1MCKA 3P9WB 3S37H 4X6EA 1H5BC 2P5WA 5JQHC 1YQ2A 1MCPL 3WNLA 2APBA 4ZTOH 3BJLA 1VSCA 3PGFH 4XNZB 5HYQB 1NFDA 4FXKB 2F58H 4GXVH 1HCVA 1ZA6B 5IIEB 1P1ZA 2CKBB 3K0WA 4XNZC 4M6NL 3HNVH 5FGBA 4AG4L 4ZO9A 4MHHI 3FJTA 1CG9B 4Y19A 1H3TA 4UOJA 1TZGH 3DX9B 4NSKA 4Q9RL 3EW3B 4L5FH 3HB3C 4BQ8A 2EE6A 1G1CA 3RVTD 1MVUB 5E08H 1MCEA 1DDHB 4YPGB 2CIIA 5LVEA 3BHBB 1F42A 5E5RB 5CZKA 3VFWA 4JFDB 1NUFA 3EYSH 3D39E 1UB5B 3V7AE 1NBQA 3VGEA 5I15H 4JQIH 1G7IB 3MV9B 1JGVH 4NZDA 3FB7A 3WL9B 4QRRE 2J2ZA 4F7CA 1MFBH 1G9ML 3KYMB 3QFJA 5HGGS 2FATL 3RY4A 2ZOKA 2C4FT 1LDPL 4PB9H 5KSBA 3RJQB 4C57C 2DQIH 3S98A 4BUGA 4LBEA 4TNVF 4G7VL 3JWOC 3ZHDA 1EJOH 4NZRH 5DD3L 1CDHA 1SJEB 5E6ZA 1CXIA 1MPAH 4JFZH 2LU7A 4IRSA 5F9AC 4NQUA 4IIQA 3PUCA 3QCVH 2MKWA 4JDTH 2QSQA 5EBLA 1NCAH 3VWKD 3QUXA 4S1QL 5C09E 3V5KB 1CGXA 1M71A 5SX5K 3QI9C 3SBWA 3WLWD 4FQHB 4JHAH 3KJ6L 2YRLA 4C55A 2PKDA 2IBGA 1EGJL 2A9NL 5JXAH 2AJZB 1R3KB 5CLTA 43CAA 5HBBA 3VFUA 2HAZA 4JVUA 2BC4B 1FNSL 5D2LB 1AQDB 4WI8A 3QDJA 3SGEH 5E9DE 4OD3L 2P8MB 1RZ7H 4UAOB 3V5DB 4LF3B 3RGHA 1B0RA 1LD9A 1SVCP 5DYOB 1K4CA 4ZD3L 2XT1B 4UAOC 4UTAL 1V7ML 4ODWB 2QHLA 5I71B 4XTRD 1NSNL 4RWYH 3DRTB 3H3PL 2VXTL 3GRWA 4IM8A 5HDBF 4PP1C 1YEJL 2HRPL 4NBXB 3GBLA 5I71C 1AR2A 2KQMA 4N5UA 4UTBH 4D2NA 4PRBA 6FABL 4LPTA 1KEML 2KQNA 4JZJA 5FYLD 4Z78A 3ROOA 5JLZA 3HMXL 4NP4L 4PJAA 1X7QA 3QUZC 5L7XL 3VXRA 3EFFA 2AABL 2Y06H 4R4FH 2VL5B 1AGFB 1GH7A 2HMID 4P2OC 4P5KB 3WIHA 2J7LA 4XGZA 1T22A 3J8F7 3V6FB 4JY5H 5DJAA 1MFDL 4DEPB 3V0VB 4JM2A 4XP5H 5TE4L 5LBSH 5IWLC 3ULVH 1T1WA 2VDLH 2V2XA 1INQB 3KXFD 4DEPC 3QUKA 4QHUA 2VXSH 1FRGL 1HXMB 3CNKA 4WV1A 4UIMA 3MRQA 1AR1C 2R2BB 1FZKB 3NCYP 1IKNC 5D7SH 2XZCL 3LZFL 5HI3C 1PSKH 4XCNB 1ZOXA 1KCLA 4H5SB 2AK4A 1R6VA 2HFEA 4GKSA 5TPWH 4LSTH 4NBZB 4P9MH 4OLYL 3L9RB 5IK3A 2IBZY 4G6KL 1JYXA 4G8FA 1N26A 4PS4H 2BHYA 3MNWB 5J6GA 3PDGA 3HA0A 2AJXH 5CEYA 2VLJB 5HY9B 1YEHH 3KS0H 5EU6A 3PABA 1P6AB 1NGYB 3QG6A 5M7QA 2VITA 1AGDB 3LV3A 4YE4L 1AO7E 4I8DA 4BSJA 1FBIH 1N3NB 3WUWG 4L3EE 2BMKA 3FQTB 1I1YA 1FPTH 4ZOBA 2AQ2A 4R2GD 1Z0MA 1R0AH 2FJHB 3STZA 1LO4L 3CCHA 3W11D 1EFXB 1EHLH 3TNMB 1CT8A 2HFFA 4JCLA 2HFGL 3TYGL 5DR5H 4D9RD 4WI4A 2NZ9D 3BDBA 2OL3L 3RTQB 4G5ZL 2GSGA 4HMDA 4QWWC 4H8WH 4S1DC 1WBYB 4J2XA 4C56D 4XP6H 5F7EL 4LARH 3D3VE 1QPXA 3MTRA 4PRPD 3RTQC 3RDTA 5E2TH 4X6FB 1OTSD 3IDGB 1P7KB 4M7ZC 1A3LL 1G6VK 1KYOK 2EIZB 3V4VH 3FTGA 1F8TL 3QPXH 4JHWL 4XAWL 4AMKL 1YN6B 2YA0A 4JB9L 4BZ1L 3P0YH 2O5XL 4Z0XB 5C0BB 5EC2B 1KGCD 1OQXA 1EHXA 3F6LA 2VLKB 4OBSA 3B2UC 1VACA 4TQEH 1ZVYA 3MLSL 1A6VL 3PL6D 1EPFA 1DVFA 4F57L 1OGTA 2VSDA 3RRQA 4IDJH 4WTZA 3NVQA 3UMTA 4TULH 2N7BA 1IM9A 2V5RA 2VDNH 2W59A 3HC0B 3CVHL 2FYYB 3SDCC 3C2AH 3U0TB 1P5UA 4RAUA 2Z4QB 1ZLSH 1UYWH 3KVQA 5CJQL 3QEQB 1J05B 2WUBL 3GJFB 2FIKB 2NY5H 1S78C 4L9LB 1LNUA 1QO3A 1AFVL 3LQZA 4PLKD 2BNQA 1F4HA 5BCAA 2BJMH 5JW4Q 4XMLH 5MEPA 4PLNC 4HEME 1I4FB 1J1PH 4L9LC 4BK5A 3NCCB 3LS4L 3L3HA 2KUTA 1OAQH 2E8YA 3OBAA 2X89D 5INDB 1IGMH 4S1RH 1Y0LA 3SDXE 1JWMB 3BSZH 3ILPB 3MLUH 3QDGA 3O45A 1QQDB 5FIEA 3X13A 1UM6L 4EBQL 3CFBA 1RUMH 2DQTL 5CGYC 2R2HB 3GSNA 3F8UB 3ARGA 3T1FB 5BVPH 1CFBA 2VLRE 4K94L 3RUGB 3MLRL 4FQQA 5C3LD 3SE8L 1G9NH 4Y7MA 3SQBA 2SEBA 4WHDA 3QUYA 3GMLB 4WHTA 2GY5A 3QNXA 5FB8B 1OAKH 1JIBA 3QHZL 5AZ2H 5TQ0L 1N59A 5JHLL 5D7LE 4LRNH 5J1AB 2FIRT 1UXWB 3E6HA 2HT2D 4XNYL 3H9SD 1CE6B 3O6KL 2DYPB 2C3VB 2VDQL 3S3PA 3DUUB 3FQUB 5F7UA 1AJ7L 3FQRB 4DCQB 3BDXA 3UO1H 2XWTA 5D2LF 5FA4B 4URTB 1I7UB 2X1OA 1RUQL 2VZVA 4HPYL 3MA9L 4HGKC 5IMLA 3VXUE 1QRNA 3BZEB 3U4EA 2PETA 4X9IA 3WHXA 3PQYB 3S4SB 1GYAA 3QH3A 3NIFE 3QJFB 4FTVD 1DP0A 2UZXB 3U4BH 4X6CF 4HWZB 4LCCB 4DN4H 1IAOA 3N1PC 1UEMA 1INDL 2OCFD 4OFYD 1MAMH 4JN1L 1J0HA 1WAAF 5BRZD 1ZV5A 4JVPA 2WINA 3BP7A 3HZKB 5FYJH 4S0SD 5KSUB 3MFGB 2FBJL 2R0ZH 4PJEE 3GI9L 5SWZD 3ZE0E 1CXKA 3CUPB 3VMNA 4CMMA 3L3IB 1JI1A 2AJSH 3QUML 3IFOA 1P6FA 3V8OA 3F7YA 3L3KB 3KPNA 3UTOA 2XN9D 1P4BH 1KIQA 3WJJA 3J7HA 4HGMA 3VMOA 3AAZA 2J88L 3I75A 4EUPG 2NY4D 3BN9D 5GRVK 3TZVC 2CDEA 4KJYB 3QQ3A 2HFTA 4OLUH 3ZKMD 25C8H 5GGTH 3STLB 3ZKQD 4CMHC 3MODH 4WW2A 1Q1JH 2ENYA 4ZUWB 3UPRB 1HKLH 1CFSB 3QIBA 3CXHK 5I1AB 3H42H 3TA3A 3GSRA 1DBBL 3ZDXF 5L88L 1A8JH 5CJ5A 1WZ1H 5IB5A 4EEEA 2PYED 4JHBA 2ADFL 2CLRA 4I1NB 5I1LA 1P4IL 3T1WA 4Y1AD 2DM4A 5GSRA 1UC6A 1TJGL 5EOTA 3PGCB 4MQXD 3I3EA 4JO2H 2X2YA 2OJEA 1MCCA 4NYLB 3IU3A 3KLAA 2AV7B 1XFPA 3QNYB 4OZGA 4WFFE 2XZQH 4FG6D 5I1IL 2ZUYA 4N1CA 1QBLH 2CJUL 1AGCA 4MD0A 1T89A 2DQJH 3K1DA 4GW1B 4EOWH 4HFUH 1MOEA 4YDVA 2D9QB 4KJPD 4QXWA 4U0RB 4D9QE 1V3JA 4M5ZL 3GK8L 4JFYA 4JN2A 5LJYH 2EH7L 1LEIA 1LO5A 3MUJA 1CTNA 1IAIL 3UYPA 4MD5A 4G42B 3NIGF 3IFLH 4U0RC 4PRNA 4P46A 2O5YL 1EZVY 4Z7UE 3HZVB 4LAQH 1D5BA 3OHXB 4U6HB 4NQEE 1XGUB 4XP4L 3ULUH 3OKKB 3ARBB 3E2HB 3GMRB 3WFEL 2ARJA 5F93C 3OJDB 2PF6A 2E7LA 1YYLH 1DR9A 5GZND 4X0KB 2R1WA 3PV7A 5F9JA 3Q0HA 3L5XL 4X80H 5JOPD 4ZDHB 3CLFL 1MIML 3TT3H 3RBSA 3W5NA 3QEUA 4RRPG 2YS4A 5I1DA 4HDIA 3LN4B 4G6MH 3RWEA 4TUOB 4JFFB 1R5IB 2GK2A 4L8SB 2P4AB 4XNQA 1DUYB 5GJSH 4NNPH 4HIHB 1DLHA 1OGAA 1FFPA 5I16B 4X4XA 3MV8E 4LVHC 1XT5A 5DI8A 1RUAL 1PKQA 5GRUL 4BQBA 1F4AA 1RIVL 3B43A 4G9DB 4NKIH 4KJWC 2I5YH 1JTOA 1RZKL 4M93B 4RMQA 5ICXA 5LKNA 2HKFL 2NX5D 2VOTA 1HILA 1ACZA 3E8UL 1FNGA 5IW6B 1R24A 1D5IL 3NFPA 4MJIB 1JFQH 1F11A 4M93C 3JTTA 3GSUB 1G7LB 4CJ1A 2V7NA 1G6RA 2IWGA 1FH5L 4HC1L 1PEZA 1YMME 1H3PH 4JO4L 3LKOA 3ZTNL 5DRWA 1JHKH 5CSBA 1NFKA 4HF5L 5DJYA 1EBAA 4MSWA 4Z0BH 4I3SH 1WF5A 5IBTL 3QXVA 1WJ3A 4TRPL 5EZIL 5D7IE 3W81A 1QA9B 1S7RB 3HE7C 3QCTH 3LEYH 3QO0A 4ZYKA 3GSOB 3X17A 1RZFH 1E4WH 4DKEL 3QEHA 3NAAH 1FL5B 4P2YA 4R7NB 5FUZL 1NL0H 5CD3A 4NO3A 4OB5H 4PJ9C 5F88B 1NFDE 4Q9QL 4U1SA 4ZFGL 4PJ5D 1URLA 1XF3A 3QA3B 4ZOEA 1QHPA 2RFXA 1GJIA 2Y6SD 3DGCR 4K3JL 1AI1H 1YY9D 3IDNA 3TYFA 3MC0A 3F5WB 4MCYB 4PRIB 5BZWB 4MXVF 4XPHL 4JRXE 4EUPH 4Y19E 5GGSY 2KPNA 2B5IC 5CP3A 4ERSL 4KY1H 1AIFB 2VERN 4GUPA 4N0FB 3SGJA 2QJDA 5F7MC 2JB5L 1Q8MA 4ZQKB 4OKVB 3RZCA 2G75A 5DJ2A 4MX7A 1J8HB 4LCYA 4HMCA 1RMFH 2DOCA 3VFMB 5GXBB 3EDDA 1TJIL 4PY8J 2Z93A 2IMNA 2J6EL 2K9UA 3QFJE 3VXSA 3TJEL 3GMOA 1LO0L 1ODAA 3BP6B 5CEZL 5KZCB 1Q9WA 5DD6A 5KSBE 1U8NB 5KW9L 5EZJA 4X7TA 2M26A 5E8PA 3V6OC 4XCFL 5M95B 4V1DE 2FH8A 1FLRL 3PDOB 4Z95L 4UNTA 4XVSH 4POYA 5JHDB 4ONHA 3U7YH 2QQNH 3ZE2F 4AH2A 3RNQA 3QIUD 1KJ2A 2C4FU 3Q1SL 5E8NA 1IC5L 3Q6FB 3UTPD 5JDSB 2Q76A 2GCYA 3UZQA 2V2TA 4J3VA 4A6YB 5EZOL 2YSSA 3MRRA 3HMWL 4OCSL 2EYTA 1UFUA 5HYJE 1CLYH 4R8WL 1YEKH 1Z5LB 3HI6H 4W4OC 2KH2B 2PYFB 1EJ6A 3DVGB 5FF6A 3MNVA 5TF1L 3JWNC 1HQ4A 2Y7QB 4ZUSB 1NC2B 4ENEC 5ANMB 1FLTX 5DQDH 2W0LA 1MQKH 1NDGB 2ICWI 2AK1L 5IMOA 1FVEA 1NBVH 4GBXA 4LLMB 4G3YL 3QIWB 1AKJA 2AJYL 4HK3J 1RULL 3FO9A 4Z6AT 4LNVA 4HGWB 3TCLB 3MBXL 3BZFB 2CDGB 2ITDB 4IRJD 3MRGA 3QIWC 5DRXA 5AEAA 1IAMA 5B3NA 3RHWK 1C12B 4HWEL 4UT9H 3SDDB 1M7IA 4N90D 3ARPA 3CFKA 3HG1A 2GK0B 4JO1H 3MUHL 4NZUL 4H0GA 5T3ZH 5B39B 4ZSOB 3BMWA 4NWTH 4PJAE 5IVOA 3SDDC 3VXRE 1NEUA 4U2YA 1KT2B 4U1LA 3QXAB 5EU4A 2I07A 4RSVA 4YX2L 1ZLVH 4QRQB 1KCRL 5A16B 3BGAA 2BZDA 1J11A 3FL7A 5E8OA 5ADPL 1DFBL 2QV2A 2E7MA 2P5EB 3TM6A 5CCKH 5HHQA 4PGBB 2R29L 2XNAA 2CQVA 2JJTC 2DD8H 2APFA 3TPKA 1CCZA 1YEDA 4XHJC 3DV4A 3DTXA 3H9HB 1Q9LA 1TENA 3V8CA 2MQ0A 4HAFA 2VLLB 1DLFL 2Y4SA 1KTKE 2VR5A 4FS0A 2H2PD 4OCRH 2A6JB 4DN3H 3NOIA 1U42A 4BYHA 4X5XA 1KPUB 3RVWD 4FFWC 1RU9H 1NC4D 1GZQB 4MDIB 4MB4A 4IOFD 1AC6A 4ZXBD 2E6JA 1MCFA 3HZMA 2CDFA 3VI4E 2AK4E 4J4PA 2DN7A 2Z8SA 5SWSD 5HI5D 3NCEB 3GSNH 4OF6A 2VDOH 3FN9A 1N4XL 2GHWB 2XRAL 2W60A 1F90L 5B38G 1QLEL 2AW2A 2XZZA 2GTWB 2FO4A 3D2UD 4YHKH 5C0DA 3D39B 1CF8L 2YD6A 1S7UA 3MFFA 4NM8L 3BE1H 2VLMD 3ARDA 1SJHB 2LU3A 4HC1A 3P4OA 1X5IA 2X41A 3V95A 4UMGA 4I18B 2VR9A 3TVMD 3L3GA 1FO0A 1MCNA 5EU7E 1JGUH 5ITBH 5F7NC 1UKQA 3PWVB 3RY6C 4I18C 3KPMB 3LKNB 4Q97A 5JR1L 1D6EB 3SCMB 3OAZK 5EBWB 2OXGA 5ITFA 2EIBA 5I30L 4GQ9L 4U1KB 5FGCE 1IC7L 4BH7B 2NY1D 1YEFL 3SCMC 5C09B 5GS1B 1NJ9B 1R3IH 4M8VA 4I2XA 4ZFZB 2EDYA 1G0XA 4O9HL 3UZVB 1YA5A 4MAYB 3RPIA 2Q86B 2V9RA 3ECBA 5IB3A 4U6XB 5GS1C 2A77L 2H8PA 2MMXA 4MAYC 1P7QD 3O6FD 1I8MB 1ZS8B 5I2IB 2APXA 3CX5K 1T1ZA 1UT9A 1XIWB 1KFAH 3CU1A 4JM4L 3HI5L 4YXKH 1N5YL 2DLIA 3MACL 1ETZB 2OTUB 4JFHD 5DQJB 4UT6H 3MLZH 4K9EC 1AHWA 5DHYB 4I0PA 3NACH 5LWYH 1XIWC 4KDVA 4FABL 4EI5A 1TPXB 4HIXH 1X5HA 3U7WH 2A6KA 3MQIA 3VRLF 5MEQB 2R1YA 5H94A 4E42A 4M48L 5GHWH 4JHZA 2A1WH 3RKDC 4AIZB 4XVTL 4Y4KC 3FRUB 1IGTB 3H9ZA 3RVUD 4XPGH 1FAKT 4P23B 5K9OB 4B0MM 5JZ7D 3WLBA 2EDEA 2PXYB 4FNLH 2FSEA 2WLYA 4PUBL 3OGCB 4GAGL 2V5TA 3FQNA 1L9MA 5CJXA 3ZDZE 4M1GH 3QCUL 5IM7A 4HWUA 2Z8RA 3JTSA 3WIFA 5D7JD 3TV3L 3U83A 5IVZA 1T0NB 4M7LL 5F7LB 5FO9A 5IFJB 2APTA 2BNQE 2V6HA 3LB6D 3RIFK 1UCBH 3BQUB 3H3BC 4HUUA 4EN3A 2FX8L 2H9GB 3ARED 4W68A 3K8MA 2HJLA 4RQQB 5FA3B 1IJ9A 3I02A 4PJFF 4LEOA 5E2JA 1T0MB 1L7TH 3GMNB 3SEPA 5ENWA 3BQUC 4XAKE 2N7AA 1KEGL 5GIRA 1KG0A 4ZS7L 5EIIA 1OSZB 4P4KB 1FFNB 4KMQA 4IBLT 4YXHL 3FRPA 1HNFA 3WS3A 4KROB 1KJ3H 1WCBA 5GZOD 5DJCA 1QYGH 1PX3A 2DIJA 1OW0A 4M9OA 4ODTL 4KROC 3UDWA 1EDQA 1HHGB 1XCTB 5I76A 1HZHH 2Y5TA 4M6MH 5FO8A 3OKDB 3OR6A 3TFKC 4IEFB 3L7EA 1I1AB 1JNNL 1C08A 1RK1A 3HC4L 3FO0H 4XBGB 5IB1A 1L9NA 1A6WH 2ADGA 2NLJA 5C0EA 4NC1E 4BFBD 4J6RL 1BZ9B 1E27B 1T04A 4XCYB 5CMAB 4OCYL 3RWDA 1T20B 4MDJA 4M43L 1U93A 3DV6B 1IQWL 1T03H 3GSQA 4Y16B 1ACYL 1JWUB 1QFOA 3BEVB 4QRUA 3W9DB 3DUSA 3OB0H 5D70H 5D6CB 1AO7B 5CEZD 5E5UB 1DANT 4L3EB 1QRNE 2R1XA 3OXRA 5EORL 1EK3A 2LE9A 1VERA 1EVTC 4XP9H 4Z77A 3BGFB 4IS6B 1FJ1B 2EDKA 3CFJB 3NZ8A 3QG7H 2OZ4H 5KS9E 1RZ8A 2OTWA 3B9KC 4AM0B 5I1CH 3HCVA 5FECA 2NY0B 3HFMH 5C3TA 2ENSA 4G9FB 4O58L 4K7PH 3P2TA 3VWJB 4AEEA 4KTEL 4LCWD 4PGDA 5D72L 1HIML 5E8DH 3DWTA 5T1KA 4PGEA 5HJ3A 2NY0C 2UWEF 2X4SB 4KHTH 5HHMD 3LQAL 1IC1A 5F1NB 4G6AD 3VWJC 3M17A 1AGEB 4YIQA 1SYVA 5E4EB 3C5ZB 4H25B 1GAFL 4NKOB 2HG5B 3FOMB 3A6BL 1EERB 3VXTA 3T0EA 5IVNA 4U1HB 2I26N 1OLZA 3OX8A 3DGGA 2F54B 4Z7QF 5DJXA 4LASH 4NRYB 1FNEA 1RJCA 1B3JA 5I17A 4EJ1C 4FP8L 2F5BH 4JVWA 1EO5A 1TETL 4Z7VB 4XNXL 4UINL 4XVJL 1KJMA 4YQXH 4OV5B 5GGUB 4DVRH 1U8QB 2EEDA 2OR9L 4XZUA 4UB0L 3VXPA 1KTRL 2L0DA 4BH8B 1YUHA 5FYKD 5J11B 1II4E 1JNHB 2IAMC 5H2BB 1LE9A 4KI1A 3LPGA 3ARFA 1CVSC 4ODUB 1HXYB 3WKMH 2ZCKL 4PJDB 3IF1A 1MJ8L 2D0GA 3EYUL 3PJSB 3B9AA 4JGUA 2DI8A 5EBMA 3VH8G 4B50A 4F58L 3EO0A 2HTLD 3P9LB 4KZEL 1E4XI 1J87A 3QZWG 4QHNA 4X83A 4LSPL 2DJUA 3QHFL 1I3GH 3BKCH 5FEBA 4MB5A 2DMCA 4GG6A 4O02L 3O3DA 1WVZA 3ULVC 4MXWH 3MRIB 3VG9B 2PO6B 4MQ7B 3RWJB 1MLCB 4QRPB 1KIRA 3SDAA 4F3FA 1NCDH 1WITA 1T1YA 2VTFA 3U6RB 1XGPB 1YNKL 4HH8A 1T7YA 4OIAA 2IAND 2YC1A 3OF6A 3VG9C 3SDXB 2PO6C 1A7PL 2X4PB 3T0XA 2FCBA 1AY1H 4LCUA 5DMIH 5ISZE 5F1OB 2X9YA 5C2UB 4QY8A 3RI5F 5KOVC 3PHQB 3BYTA 3GEWB 1B2WH 4NRZA 5A3IC 3UAJD 1I85C 2QQKH 2JJSC 1OCWL 4ZNEA 3DX7A 5BV7C 1JUFB 2VLRB 5EZLB 3REVA 2X4OB 4HS6B 1PKOA 4K3HA 5L0QB 1MFAH 3GMMA 4M1DH 1KN4L 1S7SA 2VC2H 1WWCA 1EO8H 1CYGA 5C0AB 2VN7A 5L0QC 3CH1A 2AJ3B 3S35X 5E8EB 3PHSA 3C8HA 1SVZA 5EO9A 4JJHA 2Q8AH 1DJSA 4RMRA 1LGVA 4F7PB 3WNOA 1A9BB 1MHEA 4X4YA 5ICZA 1BX2B 4YZFE 1L0QA 4OSUL 5I75B 3VXOB 4ZTPL 2FBOJ 3DUHA 3FO2B 3LN5A 3MJ8A 3BAEH 1GVIA 1UZ8A 5F7KC 4HUNB 3VXUB 2ICEB 4A2LA 1HQRA 2VJXA 3LKPA 3UTSD 5I75C 8FABA 5A2IH 1ZA3B 5J12C 3V6BR 2VQ1B 1OTTD 3FONB 4PJHA 4YHZH 5D4QA 4CU6A 5CUSH 4PJXE 4CL7A 5KG9A 5MEND 5INCB 3VH8B 5DFWH 1OGAE 2P7TB 1E4XH 2WWMC 1PG7W 3ES6B 2AJVL 4KRMB 1OAYH 5TQ2H 5F71A 1YEGH 4I4WA 4NOFA 4P9HC 3QZWB 1FIEA 4Y4FA 3IXTA 5DD1H 5SX4I 4WEBH 4ETQB 1BLNB 4FQXA 3MA7B 2HKHL 3B9VA 4K23H 5JNYA 3D0LA 2WBJB 2JB6B 1J18A 4J3UA 4LLUA 1VGKB 4PJEB 1LO2L 2P24B 2HJFA 4EVNB 4U7KA 1IGJA 2D31A 2OQJB 2WBJC 3OKOA 1DQDL 2YPVL 3AM8C 3OMZA 3MRBB 1A6TA 4HS8H 5FCUH 4CBPA 4S10A 3SQOL 4BFGA 1WLHA 4LSUL 4TUKL 1WWAX 1YNTB 5C70A 4RIRA 5HVHB 4C58B 4GRLC 4YUEL 3CK0L 5FHBL 3MYJA 3HLAB 3D18B 2FLBT 1LK2A 2R56H 2Y23A 3PL6A 4HXAH 5EOCJ 2ORBH 1ADQH 1E28A 5JIPA 4WWKB 5HVHC 3KYOA 4L4VD 4WUKL 3BP4A 4IHOA 3FT4B 1HHIB 1WSST 4WWKC 5DUPH 3HNSH 1RHFA 5L9DL 2Z91B 5T33L 3LEVH 4MAUH 1D7FA 3VE0A 3ZSTA 4FQ1L 1BZQK 1UWEH 2C7UB 5L8LB 1QFWH 1KELH 3AU1B 4CVXA 1Z9LA 1S7WA 2YUVA 1LK3L 2AQ1A 4WFHE 3GMPA 3UCRA 3UP1A 1PG7H 1QG3A 2CK0H 3ELAT 4B7IA 4DGYL 5DSCA 1DN2A 2IQAB 2DTML 2AEQH 4XPFL 5E6ID 4R6UA 2B1HH 4I3RL 1MAKA 4RGNE 2A73B 2X89A 3TF7C 1HEZA 4Z7WA 2L7UA 1YC8A 4FXGA 1IGIH 5D1XB 4PB0L 1J5OH 4HXBL 3CSGA 1C5BL 4OGYL 3SY0A 1T3FB 4MD4B 4NKMB 4DK3A 5CWSA 5D1XC 4OZHB 5I1JH 2MPAH 4IMLA 3VFGL 1IQDA 1NGPH 2XQBL 4LNRB 5DK0B 3IDXL 1U8KA 3VXSE 3HUJA 3WSQH 3BD3A 4KQ3L 4KRPB 2CLZB 2OLDA 5CS7A 5C0JA 1NCTA 3GNMH 5LG1A 3HB3D 2BVQA 4FQCH 1DCLA 3OAYK 4KRPC 5AD0B 1GGBL 1CS6A 5B4MC 1B90A 1S5IL 1FZJA 3MJ7B 1FO0H 1PEWA 3WXWL 4Z7UB 3L1OL 1AE6L 4MQTB 1S7TA 1N0XL 1VADB 1J10A 4NQEB 2NTFB 3O3BB 2X4UA 5HGBB 3TO4B 4JFDD 1RZJL 1Q72H 4LP5A 3CSBA 3MV9D 4Z7VF 4HT1H 1GGYA 2DWDB 3S6CA 3GUTA 3TO4C 3VCLA 1LP9F 1NBYB 2C3GA 1C5DA 4NQXA 4E5XB 5F21B 3GIZH 4RNRA 2FJGA 4G6FB 3EOAA 4JRYE 1F3DJ 3A0OA 2OJZL 5I1KH 3N9GL 4UUJA 3STBA 2DL2A 3FT2A 1JGLL 3UBXG 3TT1L 4N0YH 2H32B 2JJUA 4JLRB 5IOPA 4L3CA 4PJDF 1MNUH 3MV8B 4W6YB 3VFOA 1B4JL 3HPLA 1I3UA 1U8OA 4FMFA 5BRZA 1JPSH 5JUEH 1JGDA 4HBQA 4HFWB 3V2AR 1OAZL 5TDNB 4JQVC 1XF5B 2F15A 5CILH 2EDFA 2R0KH 5J7CC 1JN6B 3BPLB 3U46A 5ERWB 4EDXA 1N64L 3M45A 3VFPB 3DX6A 2W65A 5SWZA 4U6VL 1OAXL 4MNQA 4P5TB 2ADIB 3O6MH 3QFDB 1YEIH 1H8NA 1QFWM 3AC0A 4JANA 1J1XH 4XCCL 1YMMB 3HG1E 2E6QA 4U1IA 2AGJL 1A1OB 1JGEA 1HINL 2FWOA 3BT2H 4D9LH 1BFOB 3SDXF 3MROA 3WFBL 3BP5B 2DQDH 1VFOA 5D7IB 4J8RB 4OCMC 2IALB 3QXWA 3U0WL 1ZANH 4WJ5A 2BSRA 3PV6B 3FB6A 1RZIB 1T2JA 2AKRB 2XWBA 4PP1D 1QVOA 2BRQA 1FIGH 3P11H 1NFDB 2DJ4A 5I8OL 1ES0A 4WO4B 4ZUVA 1DL7L 4I77H 3SN6N 3MRCA 32C2B 1KB5A 5BJTB 4WO4C 2PYEA 1RZGA 3BD4A 2ZZUT 3BRFA 1NUNB 3CMOH 4AEHL 3S7GA 4JRXB 1O7SA 3I6KB 2RR3A 2FGWL 2GY7B 3SKNA 3BEWA 1KLFA 3F65A 4EXPX 1B0GA 3VRIA 5ESQA 4YR6A 5FGBC 4LSRH 4DFHA 1XF2A 3PGDA 4H0HB 5TGBB 1ZXQA 3HR5B 5FM5M 1MCOL 4YBLB 1CE1L 1ZKAA 5IGXH 2CIIB 1QSFB 2DKSA 4WI5A 1Q0YH 4NC0B 1P84J 4OCWH 2HVKB 3UBXI 4D0BB 1K6QH 5I18H 3S8WA 3UBXB 1AR1D 1I9IL 5FAAA 3FB7B 4FXLA 4F7CB 3R0NA 4CDGC 1L4IA 3RJDA 1XGRA 3B5TA 3QFJB 5EWIH 5HI3D 4LDOB 1A7QH 2ZOKB 1BIHA 1YECL 3GM0A 4C4KO 2VIRB 4LIQH 1M05B 4X6BA 5GISH 1J0KA 1GGTA 2YD8A 4JY6A 4NRXA 3QULA 4V1DB 4AQOA 3NGBB 2XFXA 2DQCH 3RWCA 2OX5A 3THMH 1GPOH 1TTGA 4TNVK 3ZE0F 4GXUN 4IIQB 1GGUA 3E1F1 3MR9B 1GXEA 3NGBC 2Y72A 3QUXB 2C3HA 1L7IH 1ZWIA 1D6VH 3TBSB 1M71B 4QRSA 3UTTA 3WKNA 5D5MA 4IIQC 2VXQL 4QTIH 1QRKA 4YHLH 2P8PA 2AXGA 2VLJD 1Q0XL 3GHBL 1S7VB 4PGCA 3QUXC 1WICA 2VABA 4LVOC 5HYJB 3NABH 3CZFA 5DT1H 1U8MA 1A1NA 1ZHNA 5FO7B 3VFTA 5E0QA 5I1HL 2NY7L 3VFUB 3FN0L 2OR7A 5KN5A 2ZSWA 1A2YA 1R5VA 2ZOLA 1KIPB 1K9TA 3PXJA 1XGQB 2DQHH 5ESAA 3DETC 1EFXD 1B0RB 2W91A 5E94B 1K4CB 1YYML 3DSNA 1I8KA 4QWWD 1WTLA 1LO3H 3WFHA 3RNKA 3RTQD 5KTEL 4LLWB 5ADOH 1JMZA 3K2UL 1F6AA 3WJLA 4HK3N 2BOCA 1BQHG 4PRBB 3MSPA 1A1MB 1KB9J 1DN0B 4JZJB 1K2DA 5DFVC 4PJAB 1X7QB 5GGRB 3C6SA 5LCVH 3HTLX 1WIUA 3B2UD 4JZJC 4ODHL 1F4XH 2GUOA 2HRLA 3GSXB 4WCYL 4Z5RB 1CXFA 5C0BD 4OZHF 4XGZB 3WN5A 1T22B 2IPTL 5FYLH 4PRHE 4KMTL 4XXDA 3O0RL 4UV4H 2UZIH 3MZTA 1T1WB 3QNZB 2HN7A 2V2XB 3JZ7A 5E03A 4QHMB 1JV5A 1RJYA 2X1XR 5F97E 4OQTH 4QHUB 1MRCL 5C6TL 4WV1B 4NO5B 1TZHB 4GRWH 2C5DC 4LU5H 1EEYB 2FECL 4KQ4L 4UZGA 5FDWB 4M8QB 3LKQA 1EMTL 2XKUA 3I3BA 3NA9H 4WV1C 3I9GL 4GLRI 1EXUA 3ZKNC 4UILH 4ZO8A 1PVHA 3OPZH 4NQDE 3QEQD 4Z7UF 4JCMA 1DQLH 2QL1A 3PXHA 5DUBB 1YNLL 2EZ0C 1MJUH 1NLBL 3SKJL 5IEHA 1IMHC 4XBEH 4G8FB 4JGJA 5DWUH 4F2MA 1X44A 4PV9A 3D69A 4YJZL 1YPZB 5CEYB 2ITCA 3T0BA 3U9UA 5MEOA 4O4YL 3PABB 5CGYD 5D6DA 2XKNB 3QG6B 2VITB 1WC7B 2BMKB 2VE6B 1CFVH 1LEKA 3KGRA 1P4LB 2VISB 4TTDD 2EDRA 2MSPA 4GMSL 1F3JA 5EU7C 5ID0A 3UC0H 1SBSL 1CR9L 2H2SC 3MZGB 5C0NC 3FFCE 1CT8B 2HFFB 4EKXA 2ATPA 1I1RA 1A3RL 2KL6A 5FGCB 1BQHB 1HH6A 1DANU 1DBAH 3RWHA 1RHHA 4M6AA 1I3RB 3QIUA 1NAML 4YFLI 4JZOA 2CD0A 2DYPD 4G43A 2Z35A 3ZL4H 2DQEH 3V4PL 3JV5A 3ZYOA 1QUNA 4Y2OA 2C3XA 3T0EE 4U7SA 2P48B 4J3OC 1JMXA 3RDTB 3OJMB 4JPVH 5D7IF 4OF7A 4ODSH 5E00B 3VJ6B 3GO1L 4OGAC 4U6YB 5C9KA 5T3XD 5BXFB 3DYOA 1GHFL 3RDTC 3PQYD 5ETUA 5T5NG 4CADB 2BVUA 3U30B 4Y5XA 1A6UH 5M94B 3AXLB 1VACB 2XACC 4TVPL 2YD9A 4X7CC 2EE2A 3FT3B 1NFDF 1NKRA 4AL8H 3KNBA 3P4MA 3WIIL 3C8DA 2VMFA 1DVFB 4I48A 3CPLB 1XF4A 2QQLL 5DZOA 4IRJA 4JDZA 1M7XA 2B1AL 1LE5A 4QOKE 1DVFC 4Y5VA 3B83A 3KPSB 5ELIA 2FX7L 1KCVH 2VDRH 4NQCA 5F8RC 3TJHC 2ERJB 4GG8B 3V52H 1G9MC 1VGEL 2APVA 2MJWA 4NN5C 2ERJC 5HHNA 1LNUB 2YMXL 4WFED 5TFSL 4DJMA 2BNQB 4GG6E 5DRNA 1C1EL 5MEPB 4HKZA 3NA4A 3QPQC 2L7JA 3BIKA 3MLVH 1ZLWK 5KSVA 4L9DA 3R8QA 5JW4M 3MXVL 4XP1H 2XYCA 2E27L 2J8UF 4JKKA 3MRLA 1X5FA 3M8OH 4NUGL 3O45B 3EJZC 2AEIT 1K3ZA 1TVDA 4DUVA 3BIBX 5T5FL 3CFBB 4QCIB 4K8RC 5HGDB 3L3OA 2C1OA 3A67H 2ZUSA 1NC4A 5IW3A 4C54A 4OFKA 3UJJL 4ZXBA 2BFVL 5FYKU 4S2SA 3ARGC 5DVKA 2VUYA 4WHTB 2OSLA 3QNXB 3B5GA 1N59B 2CR3A 4AG4H 5KVFH 3DIFA 3QUYC 1WISA 4LPUA 3P0VH 4NDMA 3MJ9A 2A74A 2RHEA 3AS2A 3QQ9D 3D2UA 3MLPA 4Q9RH 3T3PF 2VNCA 1I7TA 1OVZA 4NC1C 4D0DA 3GI8H 2FHBA 4ZFFA 1GGCL 2A38A 1Z0NA 3UYOD 3EO9L 5H8DA 1CLZL 1KLUA 2DS4A 2GJZB 1QRNB 2AV1B 4OGXH 4M03A 3SE9L 4ZFOA 1NUGA 4KKBD 3TVMA 1CDGA 3PF2A 2YUXA 4Y8DC 1RIUH 2X1WL 3QH3B 4BUHA 5EU5A 4PJHE 2JIXB 1Y18A 1IC4L 2FATH 5KS9B 1MRFH 1VESA 4LFHD 1DE4A 2EDJA 5FDYA 1WGOA 2UZYB 3FCTA 3MOBL 1FZMA 2NXZC 1KTLB 1QSZA 3NCYS 1MQ8A 4YPJA 5DD3H 3OL2A 1J88A 3G6JE 2A6DB 1BHGA 1NMBL 3WFDL 4PJBB 2Y25A 5DK2B 2EEAA 2VQUA 2ED9A 2K7QA 3ARBD 3IFNL 2FL5B 1UADC 4HUXB 4NQSA 3PHOA 4S1QH 4DGIL 3OG6B 4F37F 4CMMB 5K33A 3GMQB 1P7QA 3PDDA 4LLQA 3D0VA 1LILA 3KPNB 5A43C 2YN5A 4JPWL 1WT5A 1V3LA 3TH2T 3O3AA 1HH9A 4M6OH 2CUHA 4PY7B 1IM3A 1EGJH 1KCSL 2EO1A 2G5RA 4JFFD 2Z31A 4K9EL 3WNKA 4TPRL 3N0PB 2QSTA 2G9HA 1FNSH 3WJJC 2BOBB 4D0CB 4KJWD 1U91A 1CIUA 5DVMA 1U95B 2DLHA 3QQ3B 4OD3H 5IB4B 1JRHL 3L7FB 3OKMA 3LKRA 3QHTC 4ZD3H 1WBXA 4PJ7A 4WW2B 2CO7B 1I9JL 4M62H 1E4JA 3FKUS 1A9EA 1V7MH 3G5YB 5HI4D 4RFEA 5BMFH 5DEFA 3TA3B 1NGZA 4XT1C 4MJID 3H3PH 3ARRA 4WW2C 3OAZH 1VKXA 1BF2A 3ILQC 3QIBC 1IEAA 5D7JA 3TA3C 4FQ2L 3R1GL 1YPZF 4MMZC 3WFZA 2CLRB 1KPRA 3HMXH 4NP4H 5L7XH 2HTKC 1Q9OB 3S37L 3EGSB 3D85A 3T4YA 4Z7WE 2R15A 5JA8B 2MQ3A 2OJEB 4ZTOL 3IAQA 3NCJL 4GT7A 1MFDH 3MCLL 2ZSVA 4GXVL 5ISZB 4NQVB 4O2CB 3F7PC 2YD4A 3HNVL 1GRWA 3HE6A 3HAEA 3P73A 4GW5B 4MD0B 3HUJE 1PZUB 3LRSA 4UU9A 1FRGH 4E9LA 2BVOB 1PZ5B 4KKAC 1NCWL 4JFPA 2VKXA 2CXKA 4XI5C 1DQJA 4L5FL 5IEKA 4OBRA 4PRID 1T89C 5E08L 4YFLF 5J3HC 5E5MA 2IGFH 4DUXA 4PRNB 4K3GA 1NEZG 4P46B 5D9SA 5E7FA 4MLIA 1N2RB 5I15L 4OLYH 4JQIL 3W5MA 4F8QA 3QSKB 4P46C 1MFBL 1MLBA 1MJ7H 3AB0B 2ARJB 3RHWF 3MJGX 5DJ6A 1J8HD 2ATKA 4LP4A 3SHSA 4OF8A 4NT6B 5F9JB 4MA8H 4MA3A 2DQIL 2E7LC 2OS7A 3P30H 4Y8AA 4OFIA 4HDIB 3B5HA 3RWEB 1EJOL 4NZRL 1RK0B 2G2RA 2NNAA 5KZCD 1FC1A 4PJXB 1ONQA 5DHVA 1K85A 5BW7A 1FFPB 4LCWA 2LVCA 4X4XB 4JDTL 4P3DA 4D3CL 1NCAL 2D7QA 1LO4H 5KSAB 5BRZE 3IDMA 1OP5K 1NFIA 5JHDD 2R69H 2W0KA 4HKJB 3EZ8A 2DLGA 4IJ3B 4LHJB 5ICXB 3S96A 4JHAL 3SO3B 4E41A 3TYGH 3VXNA 2X4RA 4I13B 1HILB 1S5HB 1FNGB 4AY0A 4MCZA 1R24B 2F74B 5SWZE 4LPYA 4U1GB 4XH2B 4WU7B 5JXAL 3ZE1F 4MNQE 3IXAA 2OL3H 4Z7OE 1N6UA 3SO3C 4P2RA 2B0SL 3GJFK 3BXNA 3KPQB 1U3HA 1PLGL 3LKOB 4U1GC 4ZG1A 2YRZA 5DRWB 4JPIA 1FFOA 4X7EC 2LAAA 4XVUD 1RZ7L 2QHRH 4K94C 1A3LH 4ONFL 2H45A 2HJKA 5K9QG 5J56B 3LIZH 4OT1H 1F8TH 4XAWH 1NC2D 3S5LG 4KPHL 1X6NA 4BZ1H 3BPCA 2WP3T 2O5XH 4OD2A 1RFDH 3QO0B 1NMCB 2YKLH 1FL3A 1CGYA 1I3VA 2EC8A 1T83A 3QIWD 3UJTH 1HN1A 3KYKL 4TSAL 5JPNB 3B2VL 4HCRL 1NMCC 1A6VH 3KPRB 3IGAB 4UTBL 5CD3B 4MA1B 4NO3B 1X9QA 3BESR 3EJYC 2X4NA 4U1SB 3HRZB 1NEZB 2RFXB 5KOMC 2DM7A 1OF2A 2Y06L 3SDDD 4MA1C 2PTUA 3FQXA 4YGAB 2AAVA 3CVHH 1ZT7A 2F8OA 4OM1L 3IJYA 3MMEA 1EUTA 1DQQA 1ITCA 2YBRA 1WCQA 2ZUQB 5TE6L 3QRGL 5LBSL 3ULVL 5T5NF 2V5SA 1BOGA 4K3DL 4WFGD 4JFQA 4XHJD 4PREA 2ZUQC 2IANA 2P5ED 5HGAA 5CBEB 4RGNC 2ZNXA 3LS4H 5DO2C 2Q6WB 3SGJC 3VMPA 5K9KA 3CSYA 2BDNH 2W1NA 4XNMB 1CDBA 5KS9F 5D7SL 2CRIA 2FX9H 3QUMB 3RZCC 4XBPB 4X9GA 4MVBC 4FFWD 1X4ZA 2ZG2A 1PSKL 4P2QA 3VXSB 1KB9K 2XY1A 1UM6H 3GMOB 1Q9WB 2DQTH 4LSTL 5DD6B 5BV7L 5IJVA 5EZJB 4X7TB 3IKCB 4ORGB 5E8PB 3TGXA 5K9JL 1OWWA 4PS4L 4R96B 5J1SC 3D48R 4PJBF 4YGVA 2YRPA 1J0JA 3KPLB 5DVNA 5IQ7H 2H26A 3DRQB 2AJXL 4WU5A 5AAWA 3QHZH 2XPGB 5TQ0H 2YD5A 3RNQB 3ORJA 5JHLH 3T8XA 4UT7H 3U36B 5JPMA 5E8NB 3ZDYF 5K9QI 1FBIL 1MEXL 3UTTE 5D5ME 3D39D 1EVUA 2VDQH 2V2TB 1HDMB 3P77A 2YSSB 4TSBL 1FPTL 2Y36H 4OJFH 1S9VA 4B53A 3EOYG 1R0AL 1J9CT 4YHNB 4PY8I 3MUGA 1U3ZA 4JRYB 1RUQH 1AXIB 3MNVB 3MA9H 1XGTA 1EHLL 2ZUVA 3VGFA 4HIEA 3EUUA 4YHOH 1HQ4B 4UQ3B 5MENA 2D7TL 4M3KB 1IAKA 5SWSB 5IMOB 2OP4L 3FOLA 3SCMD 1FVEB 3PWNA 4LHUA 1A7NH 4H8WL 4JAMB 5J06A 2X4QB 4XP6L 4JN1H 4H88H 4LARL 5C09D 5TDPA 4GBXC 5DRXB 3S36H 1UA6H 4MAYD 4OZIB 4DZ8B 4ORZC 3V4VL 1K8DB 3QPXL 3HG1B 3SKUD 5IP4A 4OQ1A 1IAII 3KWWA 1XIWD 2BNUA 3QUMH 1XCQA 3MLTA 4RMSA 4TQEL 1KXTB 1OY3B 4O2EA 2UVFA 1XR9A 4Q6YA 3EHBD 4HJGA 2DBLH 4K2UL 4CN1A 5HHQB 4YAQA 3EO1A 4TULL 1QACA 4L4VA 1ZSDA 4PD4J 4BJLA 1YEDB 2VDNL 3DV4B 4AZ8A 5GGSA 1Q9LB 1A3QA 3C2AL 4P23D 1ZLSL 4LLVB 3L3DB 1UYWL 2PXYD 3MREA 3KPPA 3KPTA 1OM3L 2BVPA 2WLZA 3AMKA 4GKNA 2Q3AA 5K93A 3S9DB 3MRFA 2BJML 2DIAA 4XMLL 4BFIB 4YDKL 1DBBH 4Y2DB 1J1PL 1S8DA 2GIYA 1TFHA 1Q9KA 4BZ2H 1UACL 1MHPL 5E6IA 4WW1B 1IGML 3TESA 3BQUD 4HIIB 4S1RL 1HHHA 4HG4J 2WM0A 4XRCA 4J4PC 4QF1A 3BUYA 2YPLA 2H1PH 1P4IH 4YNYB 3MRJA 3TPUB 5C0DB 1JPGB 3T0WA 1RUML 2DWEB 3MFFB 4U1MB 1ZT4A 4P4KD 4E0RB 4PJXF 3WNMA 3P4OB 4JY4B 5HYQA 5B3JE 4KROD 4FXKA 1G9NL 3KHQA 4L4TE 3ARDC 4LLAA 1EO7A 3MOAL 2CKBA 2P44B 5C0CB 3TFKD 5AZ2L 4UV7H 1C5CH 3RL1A 4WGVB 4LRNL 2EKSB 5ECJE 4OCNC 1U92B 2ZKHL 2QLVB 2NCMA 1I1AD 1J7VR 3B6SB 4HMEA 3U9PH 4M5ZH 3GK8H 2EH7H 4LGPB 1MJJA 4RFOL 1X5GA 4LCIL 3UO1L 5DA0B 2Z8WC 3K81A 1SY6H 3T2PA 4Y5YB 3RPIB 1UQSA 1UB5A 4RAVA 5HGHA 4FFYH 4Y16D 4BELD 4MA7L 3TN0B 5H37G 3WL9A 1GZPA 2X9WA 3KYMA 5HPMA 3WFEH 4Y5YC 1IT9H 1AO7D 4L3ED 1T1ZB 3U4BL 3TN0C 1CFTB 2ZJSL 3CLFH 1MIMH 1UWGL 1AHWB 4RISH 3INUH 4I0PB 5FM5O 3EYVB 4WEMB 4EI5B 1P9MC 1VPOH 1T7VA 2NY0D 2A6KB 1SJEA 1AHWC 5E2WH 4G9FD 4YEFA 1MWAL 3C9NB 4WTXA 3EDJA 5H94B 3VWJD 2W07A 4I0PC 5FYJL 2EIDA 4ISVA 4EI5C 1UM4H 1I1CA 1TVHA 2DQUH 4HHAA 1FGVH 2Z9TA 3V5KA 4JO3H 4OZFG 4F33A 3KAAA 2IPUG 2AJSL 1RIVH 3WLBB 3C5ZD 1RZKH 4Y4HA 4EDWH 4W70A 4NQCE 2EDWA 4FQHA 4GRMB 3GHEH 1NDMB 3OAYH 5IM7B 3VG0H 5CD5C 3JTSB 2AJZA 3WIFB 5JOFB 4HKBB 2F54D 4ODBD 2BERA 1BD2B 3U79A 5CJXC 1FH5H 4FQIH 1EEUA 1A7BA 2GSIB 3ZTNH 4HUUB 5GGQH 4NNYA 1KENH 2DM2A 1BQLH 2P8MA 4CNIA 5MHSE 1F4WH 2HJLB 3FAXA 4DVBA 1GC1H 1BWWA 4LEOB 25C8L 4PRHB 5DYOA 5ENWB 5D93C 4TRPH 1IBGH 1Q1JL 5EZIH 3UTZA 1HKLL 4EN3C 5GIRB 2IMMA 1KG0B 5DEGA 5GRJH 1IGYB 4N9GB 4ODWA 5EIIB 3H42L 4X6CA 1T1XB 4U05A 4NCC2 4N5EC 1ZLVK 4D8PA 1GL4B 5F3BA 3WS3B 1VFBB 5F7HA 3QDAA 1WAAA 4DKEH 1PAMA 3BKML 5DJCB 2P8LA 5FUZH 4XB7A 4ZNCD 4WHCA 5I76B 4NQDB 3JV4A 1OW0C 3MCG1 2DIBA 3L7EB 1C08B 1RK1B 3UDWC 4KVCL 1UH4A 2ADGB 2VL5A 2YD2A 1UKTA 3SOBL 4MS8C 4P5KA 1T04B 4PTUA 1W0VA 2PO6D 4GW4A 4QRPD 1ZLUH 1ZTXH 4JFOA 4MDJB 3V0VA 1U93B 4ERSH 4NUJA 1QKZH 2XZQL 5D2NA 4OIIH 2VXUL 3CU7A 1QBLL 3GSQB 3SE4A 1INQA 1ND0B 5A3ID 1OT1A 1J0IA 4KTYA 3CDGA 1Y6KR 2DQJL 4EOWL 4HFUL 2R1XB 2R2BA 1FZKA 3NCFB 1MI5A 5C08A 1NGWB 5E99L 3Q5YA 1KXQE 3K3QA 2VLRD 4OUUB 1RZ8B 2OTWB 3HCVB 4H5SA 4YFEA 3X3GL 5CEZH 1RAMA 3FFCB 1N8ZA 4LPVA 5JMRA 4NHCH 3L9RA 4PGDB 2MCG1 5C0AD 3ULUL 5T1KB 4OZIF 4PGEB 5HTSA 2HVJA 1T21A 4ZUUB 3U4AA 2HT3D 3MNWA 2O26U 4KC3B 5F8QC 3TBWA 5A2FA 3C8KA 1FLRH 2B4CH 5E56A 3JUZA 4YIQB 2VLJA 3G5VA 3GKZA 4Q0XH 3OKLB 1HOCB 3VXTB 2RCSL 3T0EB 3PG2A 4BFEA 4CVZA 1AGDA 2J3SA 1N3NA 3O41B 3OX8B 3VXUD 5DJXB 3O4OB 3T0EC 5GJSL 1VA9A 4JFHE 3HMWH 1S7XA 1ORQA 4JFEA 4R8WH 1FN4A 2WWMD 5J89A 4P0DA 3RBGA 5HHXH 1M7DB 4NKIL 4ZPVB 2I5YL 4X7DC 3TNMA 2JE8A 4L4JA 1AH1A 2BRRL 3PWLA 4OIBA 2NPLX 3NTCH 4HUVA 1CGWA 2G60L 3ARFB 1CLOH 4I0CC 4R90L 1JFQL 2AK1H 5H37H 4PJ7E 4G3YH 3BW9B 4QOKB 2AJYH 1RULH 4ACPA 2WBJD 1WBYA 5AAMA 1CU4L 1H3PL 3ARFC 4KI5F 4NIKB 5FYKH 1G7QA 1JCKA 4I3SL 3VGBA 3IDGA 1P7KA 4HWEH 2EIZA 4OI9A 4ALAH 3BMVA 1CL7H 2Q7YA 2DAVA 3OJVC 2XI9A 2Q87A 1A21A 2XQYG 3QWRD 2X44D 3RIAF 4GG6B 4Z0XA 1IEHA 1F2XK 5EC2A 2VLKA 1KIRB 3SDAB 3CVIH 1A6AB 4AENB 5C07A 1JPTH 4F3FB 1RZFL 2XA8L 1FNAA 3NAAL 4OZFH 1W72H 5B21A 4G8IB 2YC1B 5ADPH 2WZPD 2NR6C 4WWKD 3SDAC 5GS3A 5IHZA 2XTJB 4QY8B 3K4DA 1AI1L 5IR1A 4Q9BA 4NRZB 3CX2A 4MHHG 4AK1A 1JTPA 2FYYA 3DX7B 3U0TA 4DGVL 3QJHA 3REVB 1F2QA 1DLFH 3RI5K 3QEQA 1J05A 1D9KA 2FIKA 4KY1L 3W39B 5J1TC 3V0AC 3BKJH 3ZYZA 3T2NH 5FKPB 1I4FA 3KJ4B 3MRDA 4AIOA 2APWA 3WUWA 5ILTL 4FA8A 3IJSA 1NANI 1RMFL 5INDA 1NLDH 1QP1A 1MHEB 3KJ4C 5D1XD 1N4XH 2XRAH 2EO9A 3ILPA 5TJWK 1EIBA 1F90H 1QQDA 3L95B 3LN5B 1UZ8B 4NGHH 4WFFD 1CF8H 1W8OA 3LKPB 2PW2A 3ZT5A 8FABB 4HWBA 1NGQL 5F7DA 1W2KT 1CZ8L 5J6HB 3QAZB 4PJHB 5IBLC 4KHXL 5EOQL 1SEQH 1BECA 2F8VA 5CEXB 1NCNA 4G7YL 4KRPD 5HHOA 1U8HB 5B4MD 4D9QD 5FB8A 3U7YL 2ZPKL 5GGTA 3OB0K 4MMXC 3BZ4B 4JRWA 5J1AA 1UXWA 1YY8B 4I4WB 4Y4FB 1HI6A 1K8IB 3G6JB 1CE6A 1JJUA 4LVNB 2DYPA 1H5BB 4FQXB 1RD6A 5JNYB 5I30H 3FQUA 4E41E 1ZGLP 1G9EA 4NQED 2NZ9C 5HVWA 1IC7H 4Y4FC 3FQRA 4LLUB 1YZZA 4DCQA 2HJFB 2XOTA 1CLYL 4LVNC 3TO4D 1YEKL 3HI6L 1IGJB 4K71B 5FA4A 4FQXC 2I9TA 4O9HH 4P2RE 3BZEA 1W0YT 3TNNA 2EEBA 3WS6A 1VB9A 4K71C 2EXWD 1CTOA 1NCBH 1RPQA 4G6FD 3MGAA 5HHVL 5DQDL 3A6CH 2BNRA 1BJ8A 1MQKL 1IKFL 3WDJA 4XCEA 5DMGC 1NBVL 4HWZA 4LCCA 1N5YH 1N0LA 3MACH 3BVNA 3MYJB 2VR4A 5BS0B 5J9PA 1P2CA 3DVNA 3IRPX 3MV8D 5E1HB 5F9OH 4FABH 4QT5B 4YC2B 3LKSB 5GRXG 5J4MA 1X5YA 4IHOB 1SBBA 3P9MA 1HHJA 3HZKA 4M48H 5KSUA 4YC2C 3UEZA 4YWGL 1Y6MR 1WUNT 3VXMB 3BH8B 3VE0B 4NWTL 4P5TD 1NANH 1JK8B 1L6ZA 2OYPA 4CVXB 3CIQA 1S7WB 1YMMD 4WEUD 3L3KA 3GMPB 4O00A 4GAGH 3EYQC 2IG2H 4YBQD 4DZBB 3U0PA 1J0YA 3QCUH 1QSEB 4MNGA 1E6JH 4DKFH 5CCKL 4D94A 5IHUL 3TV3H 1VENA 2LAGB 3W82A 2Q3ZA 2DD8L 5DURB 5HDQH 4Z7WB 1BEYH 2ICES 4H26A 4KK5C 5LGJB 2FX8H 3I6GA 2WWKT 3O2DH 4NNXA 3QI9B 3LQAC 2Y07L 4NM4H 3STLA 4OCRL 1L6XA 4S0TD 4ZUWA 3UPRA 4ELMB 4UI2A 3NFSL 2MHAA 5F3HB 3ULSA 4K8RL 1V8HA 3IB4A 4WO4D 1U8KB 4P2QE 3HUJB 2NYYD 2JTDA 3UX9B 1HSAB 4HIJB 1FGNL 1DBJL 3ARUA 1CGSL 3GSNL 5HDBE 1KLGB 3AS3A 2BVQB 4JRXD 1ZHLA 1QFUL 3V5HB 1TNNA 4N8VG 4YHKL 4PJGE 1NQBA 4WUUB 2CKBH 3PGCA 3BIAX 3DBXB 1V3MA 2XG5A 3H2WA 1S7TB 1QSFD 2HT2C 2X4UB 2QR0A 1Z3GL 1ZGLB 4KU1A 5BOZG 1NAKL 4PJIB 4K55A 4M43H 4HUWB 5ITBL 5FV1L 1ACYH 1MAJA 4NQXB 4RNRB 3QFJD 2B20A 2FJGB 3QUZB 1ZLWH 2NXYC 4U2ZA 3EOAB 2K3TA 5C2BH 1JZ3A 3GIVB 4FN0A 3FT2B 5MENE 1E6OH 3ARWA 4P2OB 3CDFA 3GM8A 4L3CB 4X9HA 4HG4K 4K7FA 3VFOB 1HSBA 4V1DD 3F7VB 1U8OB 4Y0GA 3OQ3B 1EBPA 1OHQA 3JWOH 1JGDB 3DX8B 3E3QE 3DURA 5GGVL 4KTEH 2JJVA 4IOIA 5MERA 1B6DA 5D72H 3U46B 3OHXA 4EDXB 4KZDH 4U6HA 3QUXD 4U1JA 5A1AA 1CDUA 2YD3A 3ARBA 3OKKA 4YDIL 3DX6B 3GMRA 5I19L 3OJDA 4MNQB 2I24N 4JANB 4GG6F 3CSPA 3JWDC 4EUPA 4PLJC 2YA2A 3C6LA 1JHLH 1QHOA 1YN7B 1GAFH 2E7BA 3I6LE 3MLZL 4PPTA 4UT6L 4XMKH 5HYJD 5EOCH 5F96H 3NACL 1JVKA 3RWFB 3LN4A 2FWOB 4JFFA 1EAPB 1R5IA 4LSDA 3U7WL 1IILE 1IGCH 4L8SA 2CMRL 4RWHA 3DETD 3RA7H 1F4YH 5GHWL 2BY1A 1DUYA 1UB6B 4NWUL 1CDCA 2A1WL 4HIHA 3DXAA 4FP8H 5I16A 4KVNH 4WJ5B 4XPGL 2EDBA 2BSRB 1TCRA 4KV5E 4XNXH 3WBDA 5JMOC 1I8LA 2NY4C 3MCKA 4WNQA 4W81A 5D96B 1UJ3A 4FNLL 4UB0H 4EZMA 4NJ9H 1QVOB 2E9WA 1S9XB 3ZKMC 4CVWA 5D96C 1BGXL 1TXKA 1W0WA 5I1GL 1ES0B 4MJIA 4N8VB 4ZUVB 1U58B 4O2FB 5HHPB 3SO5A 5DFVD 3GSUA 1DTUA 3SPVA 3X11A 1KPVB 1UCBL 1AP2B 4CW1A 8CGTA 1UEYA 3O2VL 4F58H 3CXDH 2FEEL 3F58H 1OT2A 2GYSA 3BEWB 1B0GB 5ESQB 3KDMB 1L7TL 3VFSA 4YR6B 1ZK9A 3PGDB 2Q8BH 4TVSa 1QA9A 3TBVB 5BOPA 1JNLL 4O02H 3WYRA 2YPLE 3T77B 4R4BA 2WIIB 4YHPB 3GSOA 3MRPB 5HYSG 4MQXC 2AEPH 4LKXB 1BWMA 4LSVL 2NTSP 1QYGL 5IVXF 4Z76A 2DI9A 4R7NA 5DA4A 3IU4H 1XGRB 5F88A 4M7ZB 3ZKND 4P2CG 4PJCE 3I85A 3QA3A 1G7HA 3WUZA 4MJ6B 2DLFH 3V79C 2BY2A 1CIDA 1A6WL 2EZ0D 4FQLL 3F5WA 3G6JF 4MCYA 4Z7NF 5BZWA 1LWRA 4NRXB 3QULB 2M8XA 3SJVA 2BSED 3RWCB 1AIFA 5GQBA 4TTGA 1T03L 5DMJB 3MRMB 4PJ8A 4RRPA 3HC3H 4ZQKA 2VDKH 2NY2B 5D70L 4H1LG 2RB8A 3UTTB 1F3DH 5D5MB 1J8HA 3S4SG 5CIPB 1VFUA 4PGCB 4F80A 4PJFA 2NY2C 3LRGA 3SDCB 3NIDF 2VABB 2EDXA 2YPKB 1U8MB 1A1NB 3QG7L 4ZTPH 2OZ4L 5IROC 3VU2A 1ZEAL 3MBEA 2UYLB 5KN5B 3HFML 3BP6A 1IE5A 4NO2A 4BSVB 2H2SD 1A2YB 3MLWL 3CJJA 1WWWX 4KGLA 1R5VB 4ELKB 4GAYB 3ULVE 5ESAB 2OXHA 3PDOA 1TCMA 2DQFA 3AS0A 5JHDA 2AJUL 2RGSA 3CMGA 5LXGH 3NH7H 3MGOB 3R0MA 5IHBA 1CBVH 1BM3H 4G6JH 1A6ZA 4XX1E 3OSKA 3V6ZB 1F6AB 4L1DA 1O7VA 4LASL 4A6YA 4FOMA 3B8SA 1ZGLM 3MYZA 3G6DL 3OKYA 1AQKH 2F5BL 3RDTD 4NFDA 1VHPA 3WJLC 1UZ6F 2PYFA 3C6SB 5HYSB 3BKYH 2EYRB 1DQDH 1G6RL 2Y7QA 2GUOB 4EQ2A 4ZUSA 3I84A 3ETBF 1VFAA 1NC2A 3CDCA 4HJJH 1T80A 5ANMA 4LSUH 4GMTL 4TUKH 4ELMF 2JCCB 3GSVB 3F6IA 4XXDB 3WKML 4XPBH 1JZ7A 4LLMA 2HN7B 2ICWA 4YUEH 1CD8A 3WN5C 4HGWA 4FZEH 1DVFD 4LOUD 5E1AB 5ALBH 4X6CE 4WI2A 1RJYB 2CDGA 2ITDA 3TJHD 4WY7L 3HPJB 1X5ZA 4OKDA 1C12A 1RZJC 1WAAE 3KPSD 2R0WH 3LKQB 2UWEA 4MJ5A 3VFRA 3VXQB 1G7PB 1I3GL 3BKCL 1QOKA 3K8LA 5I8EB 5CIPH 3OAUL 4GH7B 2R4RH 4G8GE 1OP5H 3QPQD 4H1LB 1KBGH 4J1UB 1NCDL 1H3GA 2IQ9H 2BNQD 4QRQA 3JV6A 4LSQH 5A16A 4PJIF 3TBYB 3QEGH 3VD4A 1SEBA 2PCPA 4GSDL 1X3DA 5GS0C 4X98B 4F2MB 2P5EA 3KG5A 5IESH 2DTMH 1AY1L 5DMIL 3EJZD 3GJFH 3KR3H 4XPFH 2ITCB 1BAFL 1MH5A 2VDPH 3NCBB 5D2NE 1U9KA 3OR7A 4NCC1 1B2WL 5FK9B 3H9HA 4PB0H 2QQKL 1ZHKA 5FM8A 1EV2E 2BSTA 4LFHG 2DICA 4L4TB 4B5EA 1N5AA 1MFAL 2A6JA 5D6DC 3HI1B 1UXSB 2GJ6A 1MI5E 4J3WA 5C08E 4M1DL 2V5YA 4N0CC 2VC2L 1GZQA 4MDIA 3LVEA 4UQ2A 3IDXH 5L6YH 4OCXH 1U8IA 3EFDH 2QADB 4RX4A 4JJ5A 2Q8AL 2ZCHL 4KQ3H 3ZDXE 2AXFA 3PWPA 3LEXA 5EN2A 2DQGH 1VDGA 3TZVB 5DC9B 4HWBH 4ODXB 3O8XA 1HH6B 2XTLA 5FHAH 2R9HC 3RWHB 1RHHB 2QADC 4QNPE 1SM3L 1V3KA 4JZOB 4NO0A 2D3VA 3S34L 4PRAA 4QXGH 1GGBH 4CMHB 4G43B 2Z35B 4OLXH 3BAEL 4F7EB 2VLJE 3LD8B 1L0YA 3QIUC 1N0XH 1YQVH 4BQ9A 1CICA 1KJ2L 4CJ0A 4YHZL 3LD8C 3UYRH 1QRND 4I18A 1X4XA 4NZJA 4Q2ZB 2P1YA 4UDUB 3PWVA 5ETUB 4JFEE 3QXUA 2JIXD 4OM0H 4X5WB 1OAYL 1REIA 1YEGL 3ARQA 3SKOA 5DD1L 2OJZH 3N9GH 1D6EA 3SCMA 5EBWA 3DI3B 3HKFA 5C0RL 2PN5A 5T3XH 3TT1H 3KNBB 5CSZB 4U1KA 4H1LH 4AEIL 4BH7A 1GOFA 2XWJA 2O61A 1B4JH 5GS1A 1RUKH 1NJ9A 3KPOA 1XH3B 3U1SH 4ZFZA 4JDZB 3P40A 2DBJA 2VZSA 4MAYA 2EH8L 4Z8FH 4NQCB 4IRJC 3L6FA 3CFDB 5EA0L 3MLXL 4HS8L 5FCUL 2I9LA 4U6VH 4TUJB 1VFMA 3W9EB 4F9PC 1PYWB 1FAIH 5HHNB 3MV7A 4XCCH 1ETZA 2OTUA 5DQJA 2E9IA 3GBML 3EOBA 5EUKB 1ORSA 1X6LA 4HXAL 5DHYA 2Y1VA 3BIKB 2VLKE 3DJ9A 5KSVB 5C07E 2FH6A 5MEQA 3S35H 3BX7C 5DUPL 4POZD 4Y89A 1JBJA 5DJ0B 3I50L 4X6DB 5C6PB 3FRUA 4PV8B 4LRIA 1GGIL 3SGDI 2XXCB 3LEVL 1BIIB 1RJZB 4P23A 1A7OH 1UWEL 1OLLA 3H6JA 1WZLA 1QFWL 1R3JB 2PXYA 1KELL 5K59F 3IDYB 1TZIA 2OZ4A 2UY7A 3OGCA 1PG7L 4QHKJ 3L3OB 2C1OB 3TA3D 3SKMB 1CXEA 5KVGH 2DB8A 3ZZ1A 3EYOB 1FNLA 5I8OH 5B38A 3IDYC 4S2SB 2AEQL 3N1MC 2G5BB 4R26H 2OSLB 2B1HL 2HTKD 4L8DA 5IFJA 3N85H 4ZXBC 1IGIL 4LVHB 4NPYB 3DIFB 4HV8B 5FYJE 3LHPL 4NDMB 2FGWH 5EULV 4HULB 2A74B 5HI5C 3GMNA 1I7TB 4HKXB 2FHFA 3P0GB 3C08H 4D0DB 3NMEA 1MCOH 1CE1H 4QXUH 1X5KA 5EUOE 3T3MF 4P4KA 2ESVA 5I66A 5ISZD 5IQ9B 2GW5A 2VL4A 3MXWH 3BZDA 2F53B 2V7HB 4ZFOB 4KKAD 3GNML 1CFQA 3DSFH 3L5WA 3VGHA 1D5XB 2HH0L 3EYFB 4FQCL 1XCTA 2X7LB 1EEZB 5DJ8A 5CBAB 3OKDA 1DE4B 5HHOE 4KUCF 1FO0L 1I1AA 2VN4A 3DYPA 3MOQA 4XBGA 2BP3A 3MRNA 4U0QB 1FZMB 3HE7B 1KCUL 2WNGA 3C5JA 3EAKA 1XGYL 4FQJL 1QEWB 5DTFA 4JG1H 4P46D 4XCYA 5ICYA 3RX5A 1YJDC 2IF7A 4MXVE 1DQML 4MWFA 4NHUA