2I60H

Crystal structure of [phe23]m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
228
structure length
221
Chain Sequence
VQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combinatorial optimization of a CD4-mimetic miniprotein and cocrystal structures with HIV-1 gp120 envelope glycoprotein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords EXTERIOR MEMBRANE GLYCOPROTEIN(GP120)
total genus 40
structure length 221
sequence length 228
chains with identical sequence R
ec nomenclature
pdb deposition date 2006-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i60H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i60H01
5LQBH 4CDGC 5CIPA 3BYYA 1VFBB 1AD9A 2CRZA 2AI0L 1T03H 2F9BT 1FYTD 5F96L 4XCYB 3MJ7B 5TFSL 3O9WD 1A0QL 4QCIB 2DICA 2VSDA 1AXTL 1R0AL 3VFOA 4P59H 1CFTB 2CIIA 1J1OH 1P2CA 3FMGH 2D9CA 4JFQB 4MXQC 1MFBL 5FK9A 2NY4C 3VWJC 3VWJB 3PABB 2R29H 3B4NA 1PDKA 1IQWL 1QA9A 1PG7H 4ZSOE 4A6YA 1WT5A 2A0LC 4KTEH 1MCFA 1JL8A 2HJLB 3RVUC 2Q76A 1UCTA 5BZDB 5IHBA 3VGAC 2VLKA 1P4IL 4TYUA 4Y5VB 2XWTA 2A74A 2R1WB 4IJ3B 1F3DH 5IQ9A 3OPZH 3MR9A 1WZMA 4OZHA 4S1RL 4I77L 4KJYB 1N3NB 1WBZA 3QFDB 5SX5H 1FG2B 2F5BH 1BQLL 3CXDL 3I6LD 4H5SA 4HMDA 4QT5A 3DIFB 3UAJD 4X7FC 5DJ8B 3FRUA 5CJXA 1R3JA 4LGRB 1AKJD 5D1ZB 3GHEL 2RFXB 4PP2A 5D70L 5EN2B 4M7KL 1MCDA 2BFVL 1CBVL 2GT9B 2FJFA 3AB0B 3OHXB 5F9OH 3PHOA 4R90L 4PYHA 1HHJA 1KB5A 5KVEL 2W0LA 4HUVB 5L0QB 2GYSA 2CKNA 1UWGH 1MRCL 5FYKH 2OZ4L 1J88A 3DWTA 1S9KC 3RNKA 5ACZB 3EHBD 4XNQA 3WNMA 3TBVB 3V6ZA 5E6IB 1WSST 5HVWA 3DVNA 3GHEH 3PWNA 1A21A 5BVPL 3KYNB 1SJHB 1ZSDA 1HZHH 1ORSA 1Z9SA 4G7YL 4JQXA 4Y8AA 2NZ9C 1S7UA 3CDFA 4KTYA 3G9AB 1UJ3A 1VGKA 2XY2A 5HHME 4JZOB 3IFPA 4F9PA 5HSFA 4Q0XH 3QEGL 3IGAB 3RWJB 2AP2A 3MROB 4IMKA 4L8CB 3OPZL 4NWTH 1F4YL 1MWAH 1Z3GH 4ODXA 2FO1A 4QHMA 4CVZA 3MLRH 3MUZ1 3LB6D 4LCIL 1X9QA 2VTFA 1A3LH 5KZCD 3UEZA 2VISB 3RU8H 3T0DA 5BO1L 4HT1L 5GS2H 1V5JA 5K9KB 4HS8L 3SKOA 1E4XI 2X1PA 4X7CC 4Q7DA 4RMUA 3FJTA 3Q6GH 4LL9A 5CEZD 3G5ZA 4XNMA 3IAGC 1IAKA 1OTTD 4NYLB 3RX7A 1LEKA 1HNFA 1MHCA 8FABB 4Y5YB 2VITB 1XIWC 1SBBA 5T3XD 1D5XB 5I16B 1SJEA 4D9QD 5FB8A 4NDMB 1BLNB 1IM9A 1EZVX 4ZUTA 3DI3B 3K1DA 3TJEH 1K8DA 3A6CH 4LLUA 5J3HD 1TJGL 4OLVL 5CP7A 1WEJL 1HHHA 4FQ2H 4K71C 4UIKH 2O61B 2DTSA 3JSSA 1BZ9A 5F1IB 3C5SA 2H26B 5FUCC 5CLWA 3CK0H 5IBUB 3RDTA 1BJ1J 1C7TA 4MJ2A 5D8JL 1I3UA 1OAQH 3KHQA 4UT6L 4AG4H 2P5EE 3OB8A 4CADB 4WFHE 4OSUL 1GYAA 1PD6A 4LCWD 3MRDB 3V0WL 2WK2A 4PJFA 1DDHB 3H8NA 4Z78A 4KI1A 4AY0A 4DVRL 5D1QB 2X4RA 1G9ML 1KT2B 4P2QD 4ERSL 4Q6IB 3GIVA 4YHPB 3FO0L 2NY4B 1QR4A 4XWOC 1CFSB 5CJOL 1YUHA 4ONGH 3AREB 4POUB 4RISH 5DJ0A 1MOEA 5DS8A 3NIFF 3E2HC 2I07A 3HC3L 1ZWIA 3N0PB 1TXKA 2CJUH 3LS5L 2WIMA 1A7RH 1U3YA 2OK0L 4MD0A 5SWSB 3ZKQD 5KJRH 5E8NB 4JB9H 3MLSL 2VDQH 4N9OB 3B83A 3IDJA 3VFGH 2Z0BA 1I1AA 4RX4A 2WINB 1T83A 2B4CC 5HYQB 1H8OA 3BXNB 3DV4A 4WW2A 1RIVH 5FYLL 3ARUA 2P43B 1UQSB 1MCCA 4DKEH 5BV7L 2CK0H 4OD3H 3TIDA 4LCUA 5CILH 2E9WA 2IGFL 1ZVYA 1MHPL 1C12A 1JPSH 1LK3H 4KK5D 4RMQA 4WHTA 5CSZA 1KCUH 4F2MB 1S78C 1HSAA 5DR5H 3SE9L 3BKML 4HWNA 2XZAL 4XPGH 5KVGH 5JOFB 3AFLA 2VDRH 2VR9A 2Q87A 2CRYA 5JDSA 3G5YA 1YY9D 5HYSA 1JMXA 4HV8B 3UTSE 1XGYH 3VXRE 2GI7A 2RIKA 3P77B 4ODHL 3V5KA 2D0FA 3MRMA 3VI3F 3CXHJ 3V5DB 3T4AA 3ZSTA 1PYWA 3VG0L 1RJLA 5IKCB 3QHZL 1FLTX 3WFBL 3DBXA 3IU4H 3ZL4L 3MLXH 4CN4A 1BFOA 2OSLA 4RMTA 3T0EC 3ARXA 3IETA 1OD7A 3B5GA 4FXGA 4ORGA 4C56E 4KMTL 3STZB 3EYVB 4YBHA 4M03A 3I3EA 1YNTA 1WFUA 1XF2B 1U8LB 3ESVF 3O3EA 3Q1SL 3QDJD 5FDWB 4MAYA 3IRZA 4HWBH 3SKNA 2XKNB 2AV1A 3WHXB 4KKLC 4LSQH 2QQLH 4GKZB 3QI9B 1HHIB 1S7WA 3L3OB 1RULH 5DK2A 5T1LA 1V05A 3VGFA 5E8EB 3ALWA 3QCUH 3RGVD 1RUPH 1XGTA 4HIHA 2ORBL 1DTUA 4YXHL 3CZFA 1NAMB 2ENYA 2DMCA 1LP9F 1P69B 3T0WA 1T2QH 3D85B 1NFDE 5EUOA 2QQKL 3WE6B 4GAGL 4U1IB 5IJKA 1C12B 1UVQB 2VLME 1I1FA 4CGTA 1NCNA 3CXHK 4MQXD 4X6DF 4NRYA 1UKSA 1I7RB 5J6GA 3GMOA 4YHIB 1IAMA 4M1GH 4ODHH 3LN9A 2ZSWB 4ZFFB 2JK5A 5CCKL 3IYLW 3OWEA 3FO9B 5DMKB 4JLRA 2O5ZL 3NIGE 3QA3A 2A9MH 2IAMC 3HKFA 1GOHA 3SGDH 4AQOA 4OLZL 3B5TA 3MRLA 5EPMB 3TIEB 3HMXH 1BBDH 4OZFA 1KCUL 4MXVE 4XMPL 5ANME 4CU6A 2A9NL 3S3PA 5JNYA 2ZOKB 1A7NH 3RJQB 2FSEA 2HT2C 1VFOA 1IILE 1XR8B 4E0RA 1F11B 4DJMA 4YHPA 4J6RL 2Z91B 2LTQC 1AXSB 3HE7A 1UG9A 3CFJA 4G5ZH 1YMMD 3E8UH 2EO9A 1KIUA 4P2RE 1HOCB 4TUJA 1WF5A 5D96C 1ZANH 4GAJL 5C09E 1OGAA 1YMHB 4X80L 3GSNA 3KDMA 4HGWA 5E99L 4HWEL 4XX1E 3T4YB 1NC4A 1U8MA 1ZVSA 1U6AL 3KYOB 4JFZL 4QRPE 4L5FH 4QHNB 1G7JB 3NACH 3IFNH 5IOPB 5L2KE 1PJ9A 1X6LA 2GQHA 1H15B 2QADB 2XOTA 3GK8L 1LO2H 4JQXC 3DO7B 1ZT1B 3W9DA 3MOQA 1AR2A 3O3DB 3WDHA 1J86A 3GSOA 1VEOA 4XBPB 4KHXL 5D1XA 5KTEH 3VE0B 5I15H 5FUOH 3RAJL 3CDGA 4AM0B 4OT1L 3OF6A 4P9ML 4ZYKA 1RVFL 2IFFL 5SX4I 1X44A 4GW5B 1ZA3A 1DVFC 3SDAD 2CR6A 4POZD 4ZOEA 3MV01 2OM5A 4G9FB 4ZSOA 4RFOH 1A1MB 3WO4B 4OTXH 2A2QT 4K7PL 1A6ZB 1QQDA 2D7OA 3DO3A 3FN0H 4H0GA 3P0VH 4LFHD 3V5HB 5DUML 3NZHL 5DHVB 1FVDB 3L7FB 3NFPB 2RHEA 3MZTA 4BZ1L 2WWMC 1TTGA 3QQ3B 5INCB 4WFGD 1UJ3B 1VGKB 4JHWL 3WJJA 4NHCH 3GBMH 1CE1L 2DQJH 1I9JH 3C5ZC 5DMIL 3MBED 3RVTC 4TUOA 2O5XL 3O11B 2YS4A 1EUUA 5F9AC 4I5BA 1ACYH 2J4WL 4NKMA 3VXSE 1O7VA 3FN0L 5DA0B 5F7FA 4D9RD 3QHTC 2H6PA 3FKUS 2XWBB 3QZWB 3X11A 1MI5E 5HDLA 4M5ZH 3ULVD 3B9KC 3L3GB 3PJSA 1FO0B 2ZG1A 4UIMA 3RDTC 1NDMB 1PQZB 5HYJD 3DXAA 3T3MF 2AK1H 5GS0C 1FRGL 4HK3N 3N06B 3TBWA 5JA9A 1MQKL 1OAYL 5EA0H 3GJFA 1R24B 4Z7WE 3MV9D 4K8RL 2F53D 3CJJA 2ZP0T 1CGWA 5L7XL 3NCYS 3V0AC 1I8MA 5I1JL 5BOZG 1TVHA 1OARL 5IT2L 3P30H 4J3WA 1C1EL 3TC9A 4RQQA 1I8IA 3ZE1F 1I3VA 5F6HI 2OLDA 2H32B 1ZT7A 1LDPH 3WSQL 3INUH 4S0TD 4UZGA 2JCCE 4MCYA 1KIQA 4XBEH 2HJFB 5TDOB 4I13B 4ZNEA 4FFWC 4JY4A 4M1DL 2D31A 1FV1A 3HAEA 1UJ3C 4PR5A 1B0GA 3PP3K 2B4CH 4ZOCA 4K3GA 2X4QB 4PJBA 4I77H 1JPTH 1T0PB 3IF1A 3ZYOA 4IRZL 3MRCA 2J5LB 5DI8B 5I1KH 3S96A 2R23A 3WLWD 3WO4C 1FZOB 3FT2B 3MYJB 2JJTA 4KMLB 1L7IH 4I0PB 1JTPA 1FL5A 2KBGA 2VKXA 1FC2D 1KN2L 2VLKD 4XT1C 3VXSA 4WI8A 3QA3B 5C2UB 5HGDA 3HRZA 1S8DB 4AL8H 4YXKH 3RVTD 3MNVA 2W9EH 3GMNB 3EBAA 2ED9A 1NBVH 5HJ3A 4OCYL 3F5WA 2IPKA 3BWAB 2VL4A 2BY0A 3S37X 4X9IA 3DVIA 3O2DA 4K9EC 3HE7B 4EUPH 5C6TL 4OB5H 2ZSVB 3TBSB 1TVDA 5T1MA 5EUOB 2X4OB 4OM1H 3OJDA 2VQUA 4G3YH 3ARGB 1Y6KR 4HIJB 4ZDHB 4JZNB 3VFSA 2NTSP 4MQTB 1CGTA 4E41A 1XGTB 4HIHB 5GGTH 5EB9A 2AS5M 4PJ5A 2V7HA 4G8GA 4YHKL 4IRJA 3CFKA 4GG6F 2PTTA 3G6JE 3RWDB 4OCRH 4JN2A 5HPOA 1MFAL 4Y2DB 1OP5H 3VU2A 4ZFFA 4K3DH 4KTDH 3EAKA 3R1GH 5DJZA 3TH2T 5JA8B 2FBJL 4R3SB 4HIIB 1I3RB 1T4KB 2CKBA 2VLRD 4QXGH 5EG6C 3AAZB 3SE8L 4PRIE 3OGOE 5HYIA 1A6WL 2CKBH 3CVHB 2L4OA 1Q72H 3O6LL 5JPNA 5E7BA 3DX9B 4NPYA 4OAWA 3QDGD 1VSCA 5TE6H 4LLVA 3D3VD 3GSXB 3P0YL 4XGZA 4PD4J 4UOW0 5DYOA 4AENB 4BH8A 5L2KA 4H26A 4X6BA 1IC4L 1T1XB 2IAMB 4PREA 4WWID 5IFAH 3VRIA 3UX9B 2JIXB 2FECI 2R2BB 4AL8L 2IBZX 4OGXH 3L3IB 1ZOXA 1OLLA 4M6OH 2GFBA 5I19H 3GJFK 2CQVA 3FO2A 3O2DH 4X99B 4KPHH 3VA6A 1BFVH 2H2SD 4LLDB 4HC1H 4D8PB 5E8OB 1AIFB 1TETH 5ICYB 1RZ7H 4KKBD 4GMTH 1C5DB 5D93B 4M5ZL 2OP4L 4Z7UE 1FSKC 4IRJC 3U7WH 5JHDD 4RDQG 3SQBA 3T0BA 1JPSL 2O26U 2BSRA 4Y2DD 4XRCB 4PJXE 3WFCL 3VFRB 4MJ5B 2ICWB 1AE6H 1T04B 2FECL 3TFKC 1Q94B 4G8FB 4LPTA 4O02L 4S0SD 1CDCA 4HKBA 3V52H 1XF5B 1DE4B 4UBDD 3U4EB 1EFXD 3PWPD 1E0OB 4PRHE 2K7PA 3BQUD 2WIIA 3BP6B 1UWEL 4D94A 4XCCL 4JCMA 4GW4B 4XPAL 4EI6A 2AJSH 4JB9L 2E7LC 3CMGA 4TPRL 5CHNA 4I2XB 3VRLE 1JZ4A 4RFEA 1A7RL 1P7KA 4Y16B 3DPBA 2AXGA 1JRHH 4NNXA 4PV8A 2IFGA 2EYRB 2R2EB 3I2CL 5EOCJ 5H94A 2R56H 4PJEB 1GSMA 5AD0B 2H2PC 4I4WB 3BUYA 4P46B 3IVKB 1U2HA 4YC2B 15C8H 3QUXA 4J8RA 2BY3A 4L4TE 4KKLD 1HEZA 1XMWA 3EOTH 5T5FL 2HH0H 4BM7A 2BHUA 2BVEA 3D69B 4NQCB 2IPKB 3BWAA 2N7BA 4UIKL 2B1AL 3R4DA 2VXVH 5I0DA 4DZ8B 4RCAA 2Y1VA 3GJFH 3RUGB 4MWFA 3RY4A 1FFPB 5T1MB 3O4LA 1A4KA 4UV4L 2N4IA 2MWCA 1BZ9B 1EDQA 4DCQA 5D71L 1F5WA 5KW9L 3IKCA 4B41A 5E24E 3SDXF 1KTDB 4L3CB 4XXDB 4EIZC 1T3FB 3RJDA 1NGXA 2A1WH 4JRYA 1DBMH 3EFDH 1CE6A 3MRFA 3VDCA 4EIGB 3L6FA 4NFBA 3U4EA 5GS1B 4NT6B 4HWEH 1A9BB 4UV7L 4OTXL 3HG1B 3MFFA 2OI9C 1L0QA 1JPGB 4E5XA 3EFFA 4NO5A 2CH8A 3RWFA 1X4XA 4BK4A 3FZUD 1JGUH 1JWSB 1GHFH 4Z7VB 1ZHKB 1RU9H 4NO3A 2MQ3A 3KPRA 4JFOA 1U41A 2VABA 1U3HB 5KTEL 3KJ6L 3ZE2F 2E9BA 2BNQB 1XT5A 2VQ1A 1FNHA 4M6ML 4PR5B 3O6FC 5C08E 1YY9C 3UJIH 1A64A 2R23B 4CVZB 2RAMA 2ADJA 1I7TA 4HPOH 4MNQE 4P2CG 1N8ZA 3W9EA 4HH9B 1CGXA 4J4PD 4C55A 4UQ2B 3IFPB 5DD0L 5ACLA 1R3KA 3ARVA 1JK8A 3CAFA 2YD3A 4YR6B 4GAGH 4KJPD 5F70A 4PUBH 2GT9A 2FIRT 1AGEA 2PYFA 3TF7C 1T2QL 3MROA 1EHAA 2ARJB 4G6KH 5DUBA 3JWOH 2NY3D 1T7XA 4KAQH 4ZTOH 5M94B 5B22A 5D7IB 5IK3B 5TDNB 3IJYA 2FX7H 5D6CA 4N5EC 3NIGF 2YN5A 5IF0A 5CS7A 1GHFL 1DBAL 1PBYA 2Z8WC 4BUHA 4RWHA 1DN0B 5LGKA 5MHSE 2AJZA 2R1YB 4LLYA 2PO6D 4LKXA 5BJTA 3WIIH 4NUGH 3OJDB 1EA9C 3V0VB 4KHTH 4HUWB 2OL3B 3MACH 4O4YL 1F2XK 3WD5L 5HVHC 1Q9WA 4EJ1C 3GB7A 5E03A 3WL9B 1CLZH 2GJ6A 2LU3A 4NZJA 3S5LA 3VG0H 5FEBA 2R15A 4H5SB 1Z0NA 2FZ3B 4LGSB 4NN6C 5GRJL 1FL3B 1WBZB 4KU1A 5CLTA 1VKXA 3IJHA 2YK1L 5CBEA 4O02H 1SJXA 1T80A 2HTKC 2VXVL 1I7ZA 4FZ8H 1A0QH 4LLQA 1JGDA 5BV7B 4RIRA 3MMEA 4JFDD 3BP5A 4O4YH 1IAOB 5B39G 2DTML 1ZA3B 5F9JA 4AIOA 1NLDL 4QRUA 3V2AR 3IJSA 4PJGF 4OLYH 2NY1C 4MD4A 2YC1A 1K5NA 2EXYD 4WHDA 3EW3B 3FFCB 3ZHDA 4N0UA 1AGFB 1RIVL 3K81A 2B5IB 1RURL 5F44A 5J11C 5I1EH 4MCYB 2V2WA 3ELAT 3VXOA 2DLFH 1OF2B 5DUPH 3LD8C 5IESH 1LNUB 1CIUA 5IFJA 1KGCE 3ARDB 1B88A 3W39A 1F4AA 1RURH 1U8QA 3MLWL 1EEZA 5E9DD 4Y4HB 3IDGA 4FNLL 4DUVA 5DFVD 4F7MB 1P1ZA 4BYHA 3IFLL 3WFCH 2UYLB 4WNQB 2PYED 1A4JB 1AQDB 4NO0B 3LKPA 3ARFD 5FGCB 4L4TA 1MLCB 3VFTB 3O6KL 1MFAH 2D4DA 2P42B 1FNAA 1JPGA 4E5XB 3BEVA 4OCNC 1H5BC 4HHAB 1QLEL 5E2UL 1HCFX 1V7MH 4WFHD 3ZE1E 3PV7A 4LLMB 5FKAB 5C0DA 4PJXF 1B0WA 3CH1A 4DTGH 4G6AD 1KTDA 2O93L 1JGUL 2PW2A 5EU3A 3OR6A 4RAVA 1BQUA 4FG6D 2DN7A 1E4KC 1RPQA 3UO1H 4MJ6A 3IFOB 2R9HC 1XCQA 2CJUL 4RAUB 4K94L 3U4AA 3ZO0A 1CG9A 4TSCH 1YYML 1KEGL 1T22B 4ONGL 3FQRA 1T7ZA 4WEMB 2WBJD 3V5HA 1KTRL 3WIIL 4DGIL 1NLBH 3KJ4B 1A6WH 3O6LH 1C16A 3HC0B 1CDUA 2GAZA 3TZVC 3ZKMC 2AJVL 3MCLH 4FP8L 4NZRL 3OR7B 3DURA 1NANH 4X4XA 5HGHB 3TA3D 5E8EA 3KPRD 1E28A 2IAMD 1FNSH 4MXWL 3VXUE 5FUZL 1RZKL 3SDDB 4PJ7B 3N1FC 5CZVH 4E41D 4U1HA 3WV0A 1EAPA 2FO4A 3CUPB 1Z0MA 1XZ0A 3FRPA 2AEPH 5BMFH 2XN9A 3GSOB 1P5VA 3QDJE 1E27B 1ZT4B 3JV5A 5I71C 3FAWA 5GIRB 2UWEE 4JN1L 1IT9L 1Y0LB 3GHBH 3L3OA 3L3IA 3QXDB 1IL1A 5D2LB 2QHRL 4NKDB 3WN5A 2W0KA 2EDWA 3PNWB 3VRIB 4FTVA 1CFVH 3DBXB 1DJSA 3HC4H 3SHSA 2CD0A 2AERT 3BP4A 3BYTA 4NM8H 4C4KT 1A9BA 1WTGT 1C7SA 4LPWA 4GG8A 2BNQD 4OAWB 4H25A 1C5DA 1KN2H 4P5TB 1TQBC 4U3HA 2IAND 4LNRA 5DHVH 2C3GA 2VDMH 4XC3L 4IHOB 5IB5B 1IC7L 2V5YA 2X1XR 2OTWA 1KEMH 1BQLH 1EVUA 3KWWB 1OCWL 4FZEH 4QGYA 4JFPA 4WHTB 1CFBA 1AE6L 3V5DA 4GQ9H 3RGVB 2I9TA 1DQDL 3L3DA 1ACZA 4TSBH 5IVXB 2NPLX 5JPMB 2MOVA 3WDJA 1FPTL 2A83B 3KVQA 5E2JA 1I8KA 2VDKH 1DBML 3EFDL 5BRZD 1FVEB 2R0WH 4UNUA 2DJ4A 3HZYA 3HNTH 4N8PA 3REVA 4M93C 4QRQA 2VIRA 2AQ2A 4PJIB 3KXFB 4DN4L 2ESVB 3FQWB 4YHNA 3OKDB 3WHE1 4PJEA 2ZOLB 2C3XA 5C0JA 1R5WB 4LCCB 4LFHG 3VRLF 3K4ZA 1X5HA 3EJJX 3TM6A 3VXQB 3DV6A 5D1QA 1F8TH 3LHPL 6CGTA 2EH8L 4P5KB 5DEFB 1U3HC 1WZLA 1LK2B 1MNUH 3TBTA 1N5AB 1OAYH 1EFQA 1FFOA 1XR9B 3O4LE 4QOKE 1N6QH 2W9DH 2AK1L 3B3IB 5IVZA 4WI2A 1YEEH 4BKLB 2FCBA 2J88L 4KROC 3O8XB 4P2RD 1QP1A 5ABDE 3BEVB 1QRNE 5FUZH 3PXHA 1LEGA 5DD3H 5C0AA 2IJ0C 3BKCL 2P5WD 4IMLB 1J8HA 2ZUTA 1MY7A 3ZE0F 5CMAA 3EDDA 1EGJL 1QHOA 3HI1B 1QFUL 5J7CC 1D6EA 2DLTA 4GRMA 5HHNA 4JFZH 3C5ZA 2DOCA 5F6IC 4AMKL 4X5XA 5F1NA 4OZIA 5SWZD 4EI5B 3O41B 1D7FA 2BC4A 4Y19B 3AB0C 5I1LA 4PGEB 1W72H 4PV9B 2YD6A 4KK8D 4BK5A 2ZUXA 2DQDH 1BQHB 5CINH 2DQHL 1EHNA 2IFFH 4G6JH 2FGZA 4DWHA 3AUVA 3GB7B 2WZPD 3QEHB 1MUJB 5I15L 1JZ2A 5E6IA 4D8PA 4QRSB 3ARBD 5AYUH 5TDPA 4KZDH 3HG1E 4RGOL 4YBQC 3P11L 2AEQL 2CK2A 2DQUH 5E2VL 3U79A 1NBYB 1J1XL 1HN1A 2DAVA 5BCAA 2GY5A 3TWCL 3KLDA 3QXWA 5EU7E 1RJZA 4TOYH 2EKSA 2V7HB 1WVZA 3LV3B 5DWUH 5FGBA 2J12B 4OLXH 1HINL 5IEHB 1A7OH 2EDEA 1N0LA 4Y4KC 3LKQB 5FXCH 5EUKA 4QRTB 3C2AH 4NKIL 2GAZB 5C9JA 1GIGL 1HYSD 3QDMD 3PWLB 5DUBB 3I3DA 3FB6B 4RRPA 4BA8A 2E7BA 4R26H 2OI9B 2YPLA 5E99H 2J6EL 1CXLA 1FVCA 1NFDA 2H8PB 3LKPB 4JO1L 1F97A 5EUOE 2ID5A 5F93C 3MR9B 1NGZB 1Z6JT 4MNQA 3F7RA 4OLWL 3T3ME 1I8LC 1C5CL 3I6LE 1FZJA 1CD8A 3RZCA 5BS0B 4UOW1 3W5NA 5CD5D 2BNUA 2QQLL 1EUTA 1GGIH 1Q38A 1AGCA 4HDIA 4HQQL 4DAGH 3B8YA 1I1YA 4MHHI 5IFJB 5I76A 1F6AB 4WO4A 5L6YH 3ROOA 4FQHB 3ETBF 2BY1A 1FAIH 1JGVL 2WQ8A 4R96A 5ELIA 4ODSL 3ULUH 4Y2OA 1S9VA 4CNIA 4L3EB 4HG4K 2W9EL 3QNYB 4HFWB 4WTXA 1EX0A 5A43C 2X40A 3BGMB 2MQ0A 1U3ZA 4P2QB 2GSIA 1EBAA 5FA4B 3LRGA 1OAUL 1UM4L 4ZS6D 4YHLL 2J8UB 1TQCC 4U3CA 4P57B 3QG6A 4R2GC 2X9WA 3N1QC 4WGVB 3U30C 2E8ZA 3GMRA 3G6DL 3RTQB 1SHMA 2WP3T 1OPGL 2DLGA 4Y2DC 4IRZH 3D25A 3E2HB 4K2UH 1FZOA 2JJUA 3VXME 3V6OA 5I66A 3L3HB 4X9GA 5DI8A 5HDQL 3QR2A 1CFTA 2PUQT 4L1HA 2V7NB 4QO1A 2VAAA 4OD3L 3U36A 1LP9E 2C5DC 4KKBC 2YD8A 4MQ7B 1BQSA 1NGZA 2OTPA 5C0GB 2VLKE 4I3RL 1RVFH 1W0VA 3KYNA 4NQVA 3F58L 3OKYA 4KMTH 3KYOA 1V3JA 3JWOL 1LD9A 3L3KA 1F90H 1IGTB 2EYSB 5KVMC 4WO4D 3MJ6A 1WCQA 4QRPA 1K4DA 5ESQA 4ZO7A 5D7LB 5D7SL 1I1YB 1B0RA 4MVBD 1SMAA 5MEOB 4JVWA 3SGEI 3U9PL 3Q48A 5FO8A 3FZUC 2VQTA 5FYJD 2DWEB 1OQOA 4TN9A 4M6AA 1MQ8A 3VJ6B 1JI1A 4EQ2A 2BERA 1GC1C 3NACL 3PQYE 4H20L 1JZ5A 1L6ZA 3VXMB 5B3JE 4JM4L 2Q7YB 2HTLD 5D7SH 2YD9A 1ADQA 2GK0A 1JFQH 3EOBA 4OGZA 2EE2A 2J4WH 4O9HH 5CILL 3QPQC 5F3BB 1GOFA 1A47A 1DE4A 2L7JA 1BHGA 3FB5A 4W4OC 3K74B 4LEOB 1Y6NR 3QIBD 1RZIB 1LVEA 4U1KA 2I60L 3SJVD 3BGAA 4I0KA 4P46A 5FCUL 5J1TC 4YIQA 1B4JL 5JIIA 4J6RH 4E42B 3MLZH 3VGEA 1ADQL 2CRIA 4Y4KA 1F42A 2VDQL 1FC1A 3HS0B 4NIKB 2Y5TA 3ZHLA 4OZIB 3QEUA 3A6OA 4XNUH 2OK0H 4Y16A 4OZIF 3NN8A 3DX7B 5I6XB 3P0VL 5I9QB 2W1NA 2APXA 2I24N 4U1SA 1LO0L 2RQ8A 4PV9A 2VLJD 3G6DH 2JLLA 1C8PA 4N0RA 4X99A 3S8WA 4PPTA 1G9MH 2JB6A 4KRPC 3TLRA 4AEIH 1B4JH 4PB0L 4ZTPL 5GGQH 4FHBD 5CEYA 4LSPL 3WBDA 1LE9A 4F8QA 1NCAH 4OQ1A 2ARJQ 5MI0B 3F7VB 3VWKA 3O8XA 2PTUA 4LLVB 3FFDA 1I1AC 5J9PB 5GS0H 3RVVD 4X5XB 5F1NB 3RPIB 1WFNA 1J8HB 3F58H 5KSBE 4P23D 3EYOB 5IROA 4LSDA 1KCRH 4F7CB 1G7PB 4HS6B 5CZXD 2DKSA 3HZVB 3T0EE 4OD2B 4LASL 1OM3H 4LOUC 4GBXA 4X9BA 1E6OL 1U8PB 1P9MA 1TJHL 2EH8H 3OKKA 3B3IA 5JQ6H 4QLRA 4FFZL 4MD0B 1KIRA 4R90H 5F7LB 1IAIL 3DOSA 4YNYA 4X7SL 5IR1A 1UXSA 2MMXA 1KOAA 5C07A 4YFEA 3QUXB 3H7BB 2X1WL 4YGVA 5A2KH 4JHZA 4EBQH 3RU8L 1WZKA 5L9DL 3IDMB 1HSBA 1CF8L 1UQSA 2I5YH 4JG1L 3RGVA 1FQ9C 2I9TB 3WUWB 4PRDB 2A6IB 3CX2A 1NSNH 4RMRA 1I9RL 4QKXB 4I2XA 1R5IB 2NNAB 1MCIA 4XP1L 2VZSA 4LP5A 2V9RA 5IW1B 2ESVA 4EI5D 4PG2A 1JWMA 5IBTL 1IEAA 5CEXA 5GGSA 5J06A 5I17A 3O6FA 1HHGA 2FX8H 3S37H 1ZS8B 4LVEA 2W9LA 4PLJC 4J3SA 1R5VB 1DVFA 2NY7H 2G2RA 2ZSWA 3C8KA 3W0WD 2WUCL 3GJEA 2FB4L 2XKNA 5CINL 5HY9B 1ZTXL 3TN0D 5HD8C 4GAFB 4N0YL 4JANA 3F5WB 1C5CH 1MJJA 1QG3A 2DQDL 4NM8L 4V2BA 1MHCB 5H94B 1V3KA 1MRCH 4N8VG 5FYKL 3DTXA 1A6UL 5JXEC 1K4CB 5KVEH 3LKOB 4PY8J 3R8BB 4NO0D 3ZMRA 5D7KE 4MA3B 5IGXH 3SOBL 2HFEA 5ENWB 2EEBA 1J0IA 5EBGA 4OCMC 3CZFB 4HZAA 43CAB 1BBJA 1EV2E 5BQ7B 4ZUSA 1A3QA 4E41E 3G6AA 3QQ4A 3PWJB 3BPCB 4AEEA 4QTIH 1QHPA 1A7OL 4Q74A 1KELH 5A1AA 4OCXH 2QLVB 2Z92A 2JIXA 4S1RH 3QXAA 4OSUH 2UWEB 4HV8A 1GRWA 2X2YA 2YA0A 1G7HA 4X4XB 3I02A 3MNWB 5B39B 4JFED 1ZHLA 4R4NC 1FNSL 4PJCA 5AYQA 2JB5H 5DD3L 3G08A 4C54A 1XGUA 3GSUB 1FNLA 4NPYB 4BSJA 4MLSA 1UA6L 4X9FA 1QSVA 3MCG1 1NC2B 4HIEB 2R4SH 1GIGH 3SKOB 5HHPA 5MHSD 1EAPB 1A6TA 4UDUA 4HCRA 2P4AB 3BPLC 2HT3C 1HXMA 4BZYA 3C8KB 3T4AB 1I7ZB 3HS0A 4KKNA 2F74A 2FH6A 3U2SB 2AXFA 4J12A 4JREC 4M8QA 1LHZA 2EH7L 1RD6A 4C83A 2FEEI 3DGCR 4XP9H 2EDKA 2APTA 2NY4D 1VEPA 3CCHB 3OL2A 5FECA 3SDXE 1CK0H 1YQVL 1A5FH 4TNWF 3HCVA 4LRIA 5ALCL 3CLEL 1UADC 1EEYB 3L5XH 3VXNA 5AZ2H 5ICXA 3PP3H 2DJSA 4FQXB 4K3EL 3N1GC 2G5BA 3EJZC 1UB6A 4WNQA 3S35X 2OQJA 3D39E 3LRSB 3FOMA 4HFUH 1HH9A 3QUMB 3NAAL 4H8WH 5ESQB 4YJZL 2AQ3A 5T3ZH 4NNYB 4DQOH 1IGTA 2QL1A 2B4CL 5C0ND 3BP7B 2GK0B 2F54D 4KKAD 4ZYKB 3QIWA 1YEJL 1XCTB 3FO0H 4Z77B 1A4JA 1YUHB 3HZKA 4HWZB 5EUOF 2RB8A 4TRPH 1KYOK 3MUGB 4J4PC 3HUJA 3IAQA 2V7NA 1NKRA 2VL5B 1DQLH 4YEFA 1X3DA 3CK0L 5C0GA 3J7HA 4F7CA 3O6FD 3RIAK 3O4OB 5DMYA 2HJKB 1HH6B 2XACC 4ZPTA 3UTQB 1IFHL 2QHRH 5GZND 3IJSB 5GS0D 2EZ0C 3T4YA 3TT1H 4JFEE 3HPJB 4MA7L 5E5UB 4NN7B 5J13B 1NGPH 1AQKL 2F5BL 3CXDH 3AS2A 5C1MB 3SO3C 3BGMA 1D9KA 2NCMA 2NY5H 2WBJB 3PHQB 4R4BA 5FGRA 5IV2A 2YWYA 4DW2L 1DQDH 3O3DA 1URLA 3BEWA 1NCBH 1UXWB 4LKCA 5HVFB 2MPAL 2X5PA 5FA4A 2DQGH 4MNHB 3NOIA 5I76B 1CL7L 1EBPA 3LIZL 3MRKB 5TQ2L 1CE1H 1NCWL 3DRTA 1EGJH 4C56D 5KSBF 4ZOBA 3VDBA 2NX5E 1CLCA 1VKXB 1IAOA 1INQA 3QEQD 4L29B 2XWJA 3MRGA 2XWBA 1OSPL 2GSGA 4LLQB 3DETD 4TSBL 3KPPA 1ZEAH 4MAUH 5I74B 4OFVA 3C9NA 4FTVD 3GSRB 4AH2A 2L7UA 1MVUB 4LLWA 5DRZB 3GHBL 1T03L 4YK4C 1OOAA 1WUNT 5EO9A 1D5MB 4L8BB 1VB9A 1EO7A 3LSOB 4X6FB 3BGFC 1GGIL 3QDAA 3V8CA 4FQLL 2AJ3B 5EORL 2FX7L 1BAFH 1RZKC 1AP2B 3CCHA 4WCYH 5HHOE 5TGBB 4EUPG 4BFGA 3S4SB 5EC2B 3RRQA 3FO1B 2EDFA 1ZA6B 1LMKA 1UWGL 1Q1JH 3C8DA 5HHQA 5KSVB 1RZKH 4WY7H 1A6AA 4G9FA 4ZSOB 5BV7C 4QXUL 5DJXB 1VPOL 3V4PH 3ARWA 4AZ8A 3FT4A 3PHSA 1QRNB 5DD6B 2AJZB 2GTWB 2XI9A 1J10A 3RI5K 3ZKXC 5HHPB 2DB8A 5F7YC 4JN1H 1AGEB 3BQUC 3EDEA 3OKMB 5E4EC 3VWJA 2C4XA 3C2AL 4DGIH 2VDKL 1X5JA 4KGLA 4OV6F 2YD5A 3PDGA 3EYSL 4APQA 2CPCA 4S1DC 4ZXBC 3SGEH 4HG4J 1FL6A 1KB9J 1EHLL 3PGCA 5JIKA 2HVJA 3OB0K 1A6ZA 2ATKA 1JHKL 3L95A 3SKUD 4HUXB 3KXFD 3TT3H 4MQXC 3KPPB 4NC2B 4JFXB 4ORZC 5J6HA 1R3HA 4FQXC 4JJ5B 2XXMB 3MV7E 1J1PH 5C09D 1F58L 3CPLA 5E4EB 1DEDA 3DSFH 4J3VA 5I1LB 4N8CH 4MA1B 1U9KA 3HG1A 4LVOC 4A6YH 3GIZH 4PJBE 1OWRM 5E6IC 3GI8L 3IKKA 4JO2L 2YUXA 4L4VB 1XF4B 2YXFA 3S34L 3WJLA 3NCMA 3LEVL 1FH5L 3V4UH 1UT9A 3ULUF 3IDYC 4LEXL 3MQIA 2NY2B 3I02B 4LLDA 2R0ZH 2HRPH 4HF5L 3WKML 2NXYC 4PJ8B 4PRBA 3MSPA 2Y06H 4WEUD 3ZT7A 1P7QB 2JCCF 4Z77A 4JG0L 3F7QA 4Z7VF 4NOFA 4RFNB 1JF1B 4WVRA 1JPST 1HK6A 4JFDB 1BOYA 2D03L 2P24A 4NCC1 3ECBA 1ZE3C 4FXLA 5JIHA 1AJ7L 2PNDA 5DK0A 5INDA 1MEXH 4ALAL 2YXMA 5DFWH 1YDPB 2YA2A 3ZYIA 2YBRB 3AROA 3OX8A 5GHWL 5GRUL 1DQJB 3AAZA 1DP0A 1LK2A 5AUMB 2JJTC 2V9TA 1SY6A 1I3GL 2XPGB 3MGOA 5ERWA 4P5KA 2BNRA 1NLBL 1QFPA 3BIBX 4GKNB 1TQBB 3IXTB 5GJSL 4LPYA 4BKLA 5EZIH 1UXSB 2B0SL 1LO4H 1TNMA 2QQNL 3WO3B 5FM5O 3ZDYF 4KK5C 5GSVA 3ARBC 4XXCA 3GMLB 4KAQL 4ZTOL 4LDLB 2APBA 1T66C 3K4AA 3S3JA 4JZNA 3WS3B 4UTAL 4JRXE 1PG7X 5DJ6A 5T1LB 5DLML 3WFBH 5I1DA 3QHZH 4CW1A 1NQBA 1PY9A 3TBSA 2R0KL 3IDXH 1D5XA 2NX5B 1CGSL 2ICWA 2WUCH 4NRXB 2X9YA 1SBSH 4OQTA 4IHOA 1I75A 3ULVE 4RA0C 3AVEA 4OLYL 1T1ZA 4U7MA 1AFVH 4U1NB 5IBTH 5FM5M 1CLZL 2XZAH 2QR0B 3PF2A 5F7EH 3O6KH 3AY4A 4JKLA 2ITDA 1P6FA 4B0MM 4XAWH 1F3JA 1KUMA 1JF1A 3WDIA 1GGYA 2IG2H 4P3DA 2DL2A 4OI9A 5IG7A 1MFCH 2NW3B 3PNWA 4KRMB 2K1MA 5GRJH 1FIGH 3NCFB 1IC7H 3V6FA 3T2PA 1BLNA 2R0KH 4KQ3H 1DQQB 4JPKL 1T20B 5JORA 1WWCA 1V3MA 4KKCD 1CT8B 1JHKH 1DANU 2MFNA 4PGCA 5MEQB 2GJ6D 5ENWA 4MCZB 1OP3H 3WKNA 5SWSD 3WD5H 3NPSC 3LQMA 4GRLC 2AJUL 3G5ZB 5EU7C 4G80B 4YHZL 5TE6L 1I1RA 1U92A 25C8L 5CJOH 3Q0HA 3S36L 1KIQB 3OKNA 4IRSA 4PREB 1ETZB 3RQ3A 1DN2A 3BXNA 4YLQT 3CNKA 5CJ5A 3RVUD 4U49A 4KWUA 3MRMB 2FEDD 1W8NA 4LMQE 5I1AB 4U05A 1JWMB 1FL6B 4PRIB 2KL6A 2D03H 4FMFA 2VXQH 4JDVB 2XN9E 2B39A 1XZ0B 4Y16D 2Q7YA 2QR0A 1R3JB 3UXFA 3BKJH 1RK1B 3EOTL 4YWGL 4QT5B 1JTTA 3OKMA 1K2DA 1DLHB 4MHHG 4FQLH 2DBLL 3MUY1 5C3TA 5C0JB 2BHYA 3RPKA 4Z78B 3EDFA 4M62H 2EYTA 3ZTJH 3G6JF 3SDXA 2YBRA 2Z4QB 3C5ZD 2X4TA 4F80A 1NAKL 4JPIA 1X7QA 4XNXH 5ESVA 2NY2C 5HHOB 1LO0H 1ZA6A 1FVEA 2G5RA 3AS3A 5E8PB 3L1OL 4KHTL 5I73C 1YMMB 3RA7H 5CD3B 1OP5K 4HIJA 3TYGL 2VJXA 3VWKC 3ZTNH 3DGGB 1UACH 1KLFA 5BO1H 4JFPB 4PRBB 3B2UC 5FO9A 1MY5A 5SX5K 3SDAC 4FN0A 4L9LC 3TT3L 1TTUA 2OTUB 4P5TD 3DVGB 1F4YH 5I1HH 3D87B 1AY1H 5HD8D 1B0RB 5MEOA 2HFGH 2FEEL 2HKFL 2P5WB 1INQB 3VXMD 4Q2ZB 2EEAA 2RCSL 5K9JL 3DHJA 3KPTA 1HHHB 5E1HB 1FYTE 1F13A 3BJ91 4OZ4B 1CFNB 3KLHD 4KZEH 2EE6A 4ENED 4MLIA 4JQVA 4JY6B 4IIQB 4HLZH 5CSGA 5GISL 1YN7B 4X4YB 4NC1C 2JCCA 2R39A 5GRZA 3SY0A 2OBGA 2AKRA 1VEMA 2ZUYA 1NMAL 5DLMH 4CBPA 1BD2E 4WJ5A 3P30L 2YRLA 2AEWA 3DX7A 5FKPB 4X6CF 4PBXA 1RSFA 4PJAA 1A8JH 1S9WA 1Q0XL 4MS8C 3HTLX 1M7DB 4BQ8A 3UAJC 1VGEL 1CVRA 4ZFOB 3MRRA 4YIQB 2GCYA 3PGDA 2DQTL 3X3FH 1QRNA 5DD6A 5ISZD 1ZVHA 3SQOL 3TV3L 4LPCA 4DQOL 3LKRB 3BN3B 3RL1B 4UV7H 4HAGA 3U7WL 1K6QH 1IKNA 2KZWA 2UWEF 4NP4L 1Q9WB 2CGRL 1S7TB 1S7QB 4APQB 1I4FB 3KPOA 3NFNB 2AJYH 5H37H 3MMEB 3SBWC 5FYJE 2P8MA 3Q5YA 5D2NC 3BDXA 2ZOKA 4RX4D 3FQNA 4HC1L 3R0NA 1CL7H 1BM3H 1OAXL 3GBML 4OZFB 1BVKA 1A5FL 4Y89A 3CDCA 1DCLA 4LSTH 4F3FA 4ZNCD 1J12A 4WRLA 1FL3A 1KB5H 5T1DL 1RZ8B 3ALPA 4ZAKB 4P59L 3RZCB 1MCWM 2BCKB 3IJYB 4R4FH 1IEBA 1F02I 5EDXA 5HYSG 4MZ2A 2X4TB 4NN5C 3QIWD 5MI0C 4MAYC 1IJ9A 1W0VB 2DQFB 9CGTA 3CDGB 3FB6A 4L1DA 5IVNA 4GT7A 1AP2A 5IW6A 2OR9H 4MNGE 3BPOC 3I6KB 5J1AB 3NGBC 4JQIH 4JVUA 3BW9B 4PJCE 5H2BB 2QEJA 3CGTA 4PRIA 1DN0A 4OGXL 3CFCL 4PS4L 3PV6B 1BEYH 4M7JL 5JLZA 1D9KD 1KIPA 1KV3A 1W2KT 2EC8A 2FJHA 2IADA 2YR3A 4F58H 1PKQA 4GKZA 3N9GH 4JGJA 1RY7B 5D1XB 5JMRA 3ILPB 3HB3D 5C7XL 3UMTA 5IHUH 3QAZC 2NY1D 4ODVL 3TCLA 3HMWH 1GGBL 1QACA 3MO1A 1YEJH 5C07E 4MSWA 5IB3A 4OBRA 32C2B 3ULSB 4IBLT 4OQTH 1JV5A 1BGXL 4KQ4H 5IMOB 3U46B 4XVJL 5IHUL 2HTKD 3QNYA 3G04B 1CFNA 4KUZH 1X6NA 1CIDA 1CLYH 3UJIL 1NEZB 1CT8A 4XH2A 3UTZB 1I8LA 5ID1B 4CRPA 1M71A 4I48A 3MJ7A 2V2XA 1RUML 2DD8H 4JGMA 5GGTL 3DGGA 4K3EH 4I2XE 5I1JH 1G7LB 3MRJA 5C0AE 3PL6D 2G75A 2XV6B 1A1OA 4HKXA 4WCYL 1OGAB 4PJXA 1BFVL 3STLB 4P46C 4GXVL 3EZ8A 1CU4H 2VABB 4QXTB 2GY7B 3QPXL 3JV6B 1NJ9B 1HYSC 1NDGA 1CDHA 4NQEE 1ONQA 2PCPA 3V6OE 4PJCF 3WUWA 4Y16C 5DQDH 4KUZL 4F33B 3FCTB 5IEKA 5ILTL 2CDGA 4R7DA 4ZS7H 3CFJB 3FFCD 1WISA 3GI9H 1KB5L 4FXKA 3RL2B 2A1WL 3TNNB 4NNPH 1QZ1A 3LKNB 3FO9A 4K23L 5DMKA 5DMIH 5FOJA 4NJAL 5TQ2H 3BO8A 1AO7B 1FBIH 2QQKH 2W60B 3MRLB 4OF7A 3D2UD 3TIEA 1OAKL 1D6VH 1VPOH 4KJPC 4W4NA 3VFVB 2CGRH 4OM0H 1OAZH 3QISA 3AM8C 5IT2H 5D7IA 3UDWC 4O51B 5E2WH 4X8JA 1T0MA 2BNRB 5C08B 4EDWH 1MCEA 1NGPL 4K8RH 2J88H 1GGTA 4YEEA 4MA7H 5DDHB 5EA0L 1DLHA 2EYRA 1DBBL 4G80A 2F8VA 4KI5E 4M7LH 5EWIH 3VXNB 1RUAL 1NCDH 2LV4A 2P8PB 3TJHC 1KJ3L 3P73B 2UZXB 4PTUA 1NAMA 3LZFL 3I6GB 3LN4B 3V7AG 3QXAB 5JPMA 1D5BB 4PJBF 2ZUQB 2ATPB 1ACYL 2YPLE 5DQ9B 4QHUA 2IMMA 2V17L 2AJSL 4CMMA 5LAXB 1QO3A 3WFEH 3MV9A 2XTJB 2FJGB 2H1PH 1NCWH 1MCSA 2GK2A 2J8HA 5D1ZC 2CR3A 1E27A 4QRRA 3HAEH 3WXVL 1NC2A 4LVHB 5T5NG 4B53A 2DQGL 4PJGE 3BDYL 2RCSH 4AIZA 3PWUB 3WUZA 4Q58C 4OZGB 4TQEH 5IBLD 2LU4A 1S7XB 3MNWA 5B39A 4MJ5A 5ADOH 4H26B 2WBWB 4WW2C 4X6BB 1YQ2A 3VGBA 3VGAB 3GKWL 4PG2C 1KCVL 1DQQA 4DKEL 3EZJB 4KY1L 3ZZ1A 3E8UL 1FZMB 4I8DA 4HUXA 5FCUH 1TETL 2I60H 4F9PC 2DQJL 4X6DB 5AZ2L 4M43H 4NHCL 2DKMA 4ZUSB 5JPNB 1UACL 3O2DL 4QOKA 4UINH 5DZOA 1MCJA 5FF6B 5E8OA 5IMMB 2CLVA 5I19L 3BN9C 1EMTH 4PD4K 2F19L 2P8PA 3KYAA 5DHXB 4GRLA 4FFZH 5JQ6L 3LB6C 3T0EA 3VG9C 2IH1B 2R2BA 2YUVA 5IMKB 3SO3B 4JHAH 1FNEA 3TBVA 4ERSH 1I3RA 5I71B 3IFNL 5MERB 3GMQA 3WIFA 5B38G 1QSZA 2IPTL 3ARGA 3H3BC 3REVB 4ZFGH 3GSWA 3SCMB 4PB9H 3HG1D 3FT3A 2VH5H 4Q6IA 2ADGB 3H3KA 4FQCL 5EN2A 5IEKB 3BO8B 5T33H 2QKIA 3AY4C 1VADB 1MREL 4MX7B 5DJZB 3FRUB 3PGFH 5F6IB 3GMNA 3MNVB 1YC8A 1WTLA 4GBXB 4Z6AT 5JTWA 3AGVA 1Z9LA 1FBIL 3U7YL 1XH3B 4QXTA 2W07A 4NHUB 4LHUB 4XCEB 3OF6D 4LSQL 2YZ1A 1CN4A 2VXTL 4YHYB 2YSSB 3C5JA 5DVLA 3RA7L 3EJYD 1K8DB 1PX3A 2E7CA 5ILTH 2CMRL 3NCBB 1KEGH 5D2NE 5HGBA 1KLGB 5BXFA 3QZWG 3BHBB 3H9SA 4PRPD 5KVFH 1CXFA 5HI3D 1LEKB 3MRJB 4MS8D 4U0RC 3C8HA 5JZ7D 3QXDA 1ZHNA 2JJSC 3GUTA 1LGVA 1L0YA 1R3LB 4UILL 1SJEB 5L8KB 3VFOB 5KAQG 4H1LG 2X89A 4J7RA 3B2VH 1GGCL 4PRPB 4DKFH 5EOQH 1YN6A 3TZVD 3ZKMD 4ZQKA 5DGRA 1XGYL 3D0VB 3HMXL 3NZ8A 2PKDA 5C86A 2EDOA 1LO5B 2X42A 1AO7E 2OR8A 1HDMA 1EEUA 3JXAA 4K71B 5CIPB 5CEZH 3BPLB 3C09B 3W0WB 3ILPA 4BH8B 1HI6A 5DYOB 4M7ZC 4OQTL 3QEQA 2MKLC 5KAQF 1T5WB 2AK4D 5IMOA 5FYLH 3UCRA 4QHMB 3ULSA 5JW5B 3E6FB 3ARZA 4GAYA 3BAEL 1JHLL 2VZVA 4RBPH 5CAYB 3V6ZB 1KENL 4GAJH 4F37K 3RNKB 2EDNA 1J05A 1BF8A 2CXKA 1MCQA 1U42A 5EO9B 1PLGH 2FIKA 4HS3A 1MVUA 4LLWB 1RK0B 2BSTB 4NQTA 4XAKE 3PV6A 4MA1C 4M3JA 1WFOA 4CVWA 2VUOA 3V0WH 3QUYD 2H41A 4QRPB 3QQ9C 5C6PB 3LDBB 4XAWL 5KSVA 3I3BA 1S7QA 2ARJA 3ISWA 5EC2A 5C0BB 3LRHA 1OD9A 2GJ6B 4G9DB 4N0FA 1QRKA 5FA3B 4KJYA 1MPAL 3FCTA 5SX4H 1KNOA 2IGFH 4P5MB 4ONFL 5A2JH 4MNHA 4LF3A 4PRHB 2F53B 3X13A 5L9DH 5F71A 3MV7D 3GO1L 5EUKB 1MELA 1TCRB 2X4NA 4HH9A 3HRZB 2NYYD 3A6CL 4ZAKA 1INDL 3D3VA 5IB1A 2IBBA 4POZC 3EO9L 4HZLA 5DRXA 3TNMB 2CSPA 3I50L 2MQCA 3KLAB 1WIPA 2F74B 3QDMA 4J1UB 3OJVC 4ODSH 1AXTH 1R0AH 4BELD 3F7YA 4O2FB 4YFLF 4NUJB 3BOVA 2BMKA 4LNVA 5K33A 5JDJA 1LEIA 1CGYA 4ZFOA 1MF2H 3QWRA 4BUGA 1BOGA 1CL7I 1U8IB 1UB5B 3PQYB 1ED3A 1ADQH 4XX1G 1IRAY 3IDNB 4Z9KB 2YMXL 4JKKA 3FFCA 43C9A 5ETUA 1I9EA 4ZNEE 3UJJL 4PGEA 1MI5A 5ISZA 2HJFA 5TDOA 3MRNB 4P4KB 4U6YB 3ULUD 4ZUUA 4JEGB 4LU5H 4R26L 1JGDB 4UQ3B 4PJHE 4JRYB 3X17A 1UYWL 4NWUH 5C9KA 3FB7A 3QG6B 3UTPD 4NQDD 4UMGA 4R97B 2W9DL 4PJHB 1RZFL 4FQPA 3QWOA 1KLUB 2Z91A 1KPRA 3MLTA 1K5NB 3RUGA 4P5MA 4JY6A 1N6UA 4JY5H 1OAQL 4AG4L 3SDDD 1QYGH 1PKQE 1GC1L 3SE9H 4EVNB 4WV1A 3HE6B 4Q9RL 1OT2A 3P4NA 5A3ID 4FQ2L 3B8SA 2BMKB 5GRWA 4DN4H 4M7KH 2CK0L 1S7RA 5GGVY 1TTFA 1KJVA 3ARGD 4OLVH 2V9QA 4N8CL 3WIFB 1YMMA 4R8WH 4R0LC 2CUMA 4XCEA 1LDSA 5MENB 4KDVA 2C7UA 4HS3B 3V95A 4KMQA 4I1NB 1XFPA 1UVQA 2A9NH 4JFEB 4NNXB 2VLRE 3O4LB 3P0GB 1P9MC 4GRLB 5FFLA 3O4OC 3BKYH 3L7EA 4K2UL 3VMOA 4X6DE 3L1OH 5I9QC 4JAMA 4Z7WF 3NIDF 4MDJB 1DBKL 3DETC 4JKPH 5KSAD 5DHVA 3T1FA 4YGVB 3VCLB 4G42B 3WFHB 3MLUH 4WUKH 4S1SH 1QVOB 3MNZA 5FM8A 1XGUB 1J5OH 1BD2A 2Z4QA 5KSAB 4GKOA 2BX5A 3BKJL 1C5BL 2Y36L 3BVNA 1I1FB 4OUUB 1J05B 2ZCLL 1ZHBA 1U91A 2ORBH 2DKUA 4LSVH 4URTB 3P4OA 2XKUA 4I3RH 3RVWD 5D70H 3NGBB 1TJGH 1J0KA 2BDNL 2VLLA 3BDBA 5DRNB 1IE5A 1MFEL 4JFDE 4PBVC 4OFYD 3STZA 3V6FB 2EZ0D 2GFBB 4EDWL 1QLFA 2KKQA 5BZWB 5GZOD 3RWFB 2OCFD 1OY3B 3I2CH 4FS0A 4QHNA 4OF8A 3TJHD 3X14B 5C07D 4MD5A 4JQVC 1D6VL 2BSED 1QSFB 3AREC 1RIUH 1C16B 5FYLE 5DZLA 3UJTH 1RZJH 1T1ZB 4WENB 4K23H 3VCLA 1OAUH 1UM4H 2NLJB 2B1HL 4B7LA 1FGVL 4PJ7E 2OMBA 4UDTA 1JUFA 5EU6D 4ZS7L 1RMFH 4S1DD 1KC5H 1QBAA 3LMJH 2QSQA 4HXBL 1MCKA 4PLKC 2M1KA 1NCBL 4R2GD 3Q3GA 1KTLB 5B3JF 2FSEB 2C3VA 5I75C 5JUEL 2PW2B 4YDLC 4LDEB 5F96H 1IGYB 3P11H 2HVKB 3RWHA 3DUHA 1ES0A 4ZFZA 1JPFA 1HZHL 3ME0A 1DVFB 4XC3H 3P73A 1BJ1H 1IBGL 1ZS8A 3A67L 1CLOH 1KIRB 4PRNB 2YD1A 1V7ML 3JWDH 3SGDI 2CDFB 4U2ZA 3TH4T 3SDXB 4F7EB 1KN4L 2BHZA 1MHEA 5FYKE 3VFGL 2NX5A 5IM7B 1XCQB 3H7BA 5F7WC 2EH7H 4HEME 3LEYL 3WJLC 4U1IA 2VN7A 1ONQB 1KPVB 3CFKB 1NJ9A 4AMKH 1YEFL 1LO4L 2QQNH 4TRPL 3VMNA 3DHMA 4JM2F 2YZ8A 3QQNA 1CWVA 4P5TA 5GSVB 4I18C 4ZDHA 3D6GA 4MXVF 2VC2L 1IAII 3B43A 5FDYA 2GEEA 5FKAA 4BH7B 2NW2A 2Z8RA 5LCVH 4ACPA 5DUPL 4X4MA 4OD2A 4HWBA 5IBLC 3SJVE 4FTVB 1NEUA 5HI4D 4N90E 5J12C 4P48A 1JNHA 5DJAA 1XIWD 3HNVH 3VD9A 5T3XE 1XF1A 3JWDL 4D9QE 1EHXA 2YKLH 2PN5A 5MEQA 3BIAX 3TYFB 1HILB 4J3OC 2Q86A 4PJHA 1QBBA 1P84K 3P4OB 4HWUA 3U9UB 1FL5B 4GBXC 1ZT7B 1YYMH 1MF2L 1P7QD 2YPKA 5CEZE 2B7DT 1H3XA 4GLRI 2FHBA 3MBXH 4ZUUB 4HCRL 4CMHC 5LGHL 3LEVH 1MVFA 4P2RB 3DURB 4PTUB 3VXPB 5JW4Q 3GFUA 4P4KD 2AK4B 4N0UB 1F4XL 4DTGL 1AGDA 2DM7A 3PL6B 1B0GB 1UENA 3QI9D 3ZYZA 2R4RH 2J6EA 4YC2C 4YK4B 3E6HA 1A14L 1MRDH 4PLJD 4JM2B 1ZT4A 5EULV 5F7MC 4D9LH 3S37L 3FQUB 4GW1B 4DFIA 3JZ7A 5DO2D 4ZO9A 1LQSR 1AR1D 2FJGA 1HQRB 1S7UB 2R2HA 4Z95H 4EKXA 3AM8A 4V1DD 1G9NH 2O5YL 1ZGLP 3KLAA 3KPSA 3PHOB 1YEDB 5EU6A 3BD5A 1BP3B 4I3GA 5MEND 5ID0B 4M6NL 1CF8H 1CR9L 2I5YL 3MXWL 4C57C 2B1HH 2AW2A 3DXAE 5MEPB 2CIKA 3MGTB 1HHJB 1KB5B 4XWGL 2BSSA 1JIBA 1MCOL 1SJHA 4JR9L 3DXAB 4YPJA 3FQRB 1X4ZA 2DLFL 2XPGA 1BVLA 3QFDA 3MGOB 1WGOA 1JGEB 4WUUD 3MOBL 4WEBL 4LVNB 1TZHA 4GH7B 4XMKL 3DSNA 3LEXA 2XZQH 3RIFK 1JZ3A 1H9VA 3TFKD 4FQJL 2HWZL 3OG6B 4G8GB 2FJFB 5EORH 5L88H 3T08A 5E00B 4K94C 5TGBA 4XI5C 3GSNL 4Y5VA 4LLUB 3VA2C 2PR4H 5DJ8A 2I9LA 3MXVL 3MRQA 4FABL 1P2CB 2ZSVA 2D7TL 4KI5C 1IGJB 1OSPH 1KC5L 5EO1A 4ZPVA 2DIAA 3LQZA 5EO0B 3SCMC 5LVEA 5D5ME 1TCMA 5F89A 2XYCA 2ZUWA 1IAKB 2VZOA 3BZEA 4YXLH 3KPSD 1PG7L 2FNBA 1U58B 2P5WE 4JFFD 3ZTNL 2F8XC 5GS1A 4PJDB 4X7SH 2BY2A 1KJMB 5F21B 3MA7B 1CE6B 3MRFB 4CN1A 2GUOA 3LN5A 5HYEA 3MYZA 2WMPA 5DEGB 2DS4A 4JFXA 5EOCH 1JHTA 1TJIL 4L3EA 2E3VA 4LKCB 3D3VB 1HILA 2YD2A 3BW9A 5H2BA 5JW4R 4PGJA 5C0RH 5KW9H 4PJFF 3QIUA 1OM3L 4RWYH 3TT1L 4G6ML 1TZHB 1NCCL 2PW1A 2BDNH 2YRZA 1Q9KB 3EGSB 1UKTA 3JTTA 1YNLH 2WP3O 1EPFA 3OAUH 5LBSL 3DUUA 4FQCH 2GJJA 1ODAA 4TTGA 5J1SC 2E7MA 4UAOC 1FFNA 3WLBA 3O9WA 4LAJH 3LVEA 3Q6FB 3FFCE 5DD0H 3TVMC 1NCUA 1Q9OA 4M48H 2BP3A 3RKDD 3T77A 4WW2F 1WK0A 4K7PY 2VL5A 3EHBC 4PV8B 1HH9B 1B2WL 3QUMA 4DN3H 2P5EB 1DVFD 1WBXA 2AJUH 2CLVB 3BQUA 4OCWH 3QIWB 4C83B 2FATL 4ZUVB 3RX8A 2VIRB 2BJML 2OL3A 4AH2B 2VXUH 1ZANL 2VN4A 5ESVB 4O2EA 5D6DC 1NAMH 2I25N 3BPNC 4H8WC 4NQCE 3WHXA 1INDH 3SGJA 2A6JA 5ALCH 3KJ4C 3UBXA 4CU8A 2AAVA 4BZ2H 3DRTB 4OLUL 3K2UL 3PWUA 4UT9L 1JI2A 3V4VH 2DTMH 1N64H 1BQHA 5DJCB 3JWDC 2C1OA 1YEIL 4Z5RA 3WCYA 4F57L 1II4E 1AIFA 4OZIE 1OPGH 4QTHB 4TUKH 4G9FD 2PYFB 5C6WH 1MH5A 1YC7A 3MRHA 2VR5A 4ODUB 5IOPA 4NO2B 2H1PL 1AGBB 4M6OL 2X9XA 2Z93B 1IARB 4X4ZA 1UYWH 4NWUL 2K9UA 4MAYB 2BC4B 5IESL 1EO8L 3FN3A 4G8EA 4G8IA 5ADPL 1KENH 4NN5B 4Y1AD 3GSNB 3KDMB 4NQUA 5D7JA 5HHMB 1N5AA 1KJ3H 5DJAB 2B0SH 1U3HA 5CKGA 1E4XH 3B2UD 4NZTH 1A6PA 1NGWB 4BQCA 3RP1A 1P4BH 5E0QA 2ZCKL 1F11A 2FYYA 3VXUA 4O2CB 1ZMYA 4WIQA 4PJIF 5HDOA 2DM4A 5C0AB 4LQFH 4ALAH 2QTEA 2DF3A 1DLFH 2VDNL 1X5XA 2ADGA 4FZ8L 3BAEH 1UWEH 1ULVA 4MAYD 3DECA 3NVQA 2VZTA 4KXZH 5EFIA 5BRZE 1L9MA 4DKFL 1OB1A 1KULA 1N59B 2WWMD 4S2SA 4G6FB 3SPVA 1NUGA 3VFPB 4FTVE 3GI9L 2XQBH 3Q3GB 1T0MB 1FN4B 4J4PA 4OLXL 1AXSA 4YZFF 4BQ6A 1WWBX 4E0RB 1NBVL 3MLVL 3FOLA 2OP4H 3DYOA 2R8SH 4NQCD 1MIML 4WFED 3MPCA 3RX5A 5T3XL 5AWNH 3KPMB 4KZDL 3GI8H 1AO7A 4HKXB 2P48B 3PWPA 5DK2B 3QIBC 1BFSA 3ZT6A 1CQYA 4NN6B 1DBAH 4Z7UB 1X7QB 1F58H 2VE6B 4KRPB 1JP5A 2NR6D 1TZGH 1S7SA 3GMMA 2D0GA 1RHHB 1FNEB 2B8OT 2Q8AH 4HKJA 5E94B 4NRYB 4GSDH 5I1KL 1UEYA 1NFDF 3QH3B 1IC4H 3AMKA 4HXAH 3IS0X 4CDHA 2HTLC 4U31A 4UB0H 2E5EA 4HLJA 2JKXA 2Y6SD 4YE4L 4ZAKC 3KPNA 5E4IA 4PRPE 4KUCF 3QUYB 3HNSH 4DOHE 5GGUA 3TO4C 4QRRB 3MCKB 4KVCH 4CVXB 4OI7A 2VXTH 2FO4B 3CUPA 5SWZE 4XBEL 2C4FT 4TSAL 4UQ3A 5C0CA 2HG5A 2IADB 1IGFH 5D71H 5CGYC 4QF1A 3KPLA 4Y19D 1OGAD 4TOYL 4LBEB 2AABH 3QCTL 4BQ9A 4G43B 4NZUL 1DUZA 5HHVH 1FE8H 2A6KA 2EICA 1QPXA 1QFWM 4F37F 4F7TB 1FCCA 2V6HA 4FMKA 2IALA 1RJYA 4WU5A 4X5WB 5FHBL 2FBOJ 3RUGF 1BAFL 3WNKA 4G8IB 1IZKA 1RU9L 1N0XL 1BFOB 4JM2D 4KRPD 4U4BA 4D0DB 4OZFG 1N6QL 3HFML 4TULL 5ESAA 5L8JB 5J6HB 3F7YB 4JRYD 4QHUB 5ACMA 1KPUA 5D7LD 1T1YA 5D72L 2W0FA 2YA1A 3LY6A 1ZLSH 3O11A 5J56B 1E28B 4IOFD 4K9EL 4ELME 4NBZB 1RUKL 3MJ8A 2V5MA 2VDOL 2DWDA 3QDGB 4EEEA 5FOBA 1ORQA 3SKMB 2HMIC 1EGJA 1T5XB 3HR5A 4PRHA 2QSVA 2X4OA 5SWQB 3W82A 3BX7C 1P5UA 4MJIB 3MLZL 4HHAA 4BFIA 2FGWL 1S3KL 4P99A 4JHWH 4G42A 4R7DB 3CD4A 3LOWA 5H37G 1CICB 1WCBB 3JV4A 2MCPL 3S88H 1N2RA 2X4PB 3REWA 2P5EA 2B1AH 1BMGA 5INDB 3FB5B 4LQ1A 3O9WB 4FRWA 4LLMA 2P5ED 4JPWL 4HUVA 1F6FB 1CDGA 1XEDA 4Y4HA 3RTQD 3OR6B 5E5RB 3VJ6A 5L2JA 1T7YA 4ZUVA 1OGTB 4YHYC 3EO1B 5E08L 1NC2D 3Q6FA 3FQXA 1DFBL 1MCWW 2LTQB 4PJAB 1IVLA 3QBTB 4O2CA 1QNZL 3QIUB 3D1MC 5DJYA 5EIVA 5IJKC 4K7PX 4MJID 4LSUL 1AD0A 3CFEB 4P3CH 3IAPA 3EOYG 2DMKA 4PJ9C 3W0WE 3S6CA 4CL7A 1E4WL 1CXKA 5DD5H 3A6BH 3C6LC 5DMGC 2AABL 5HI3C 3W2DH 1FFNB 3P0YH 3WLBB 4K3HA 4M4RA 1EEZB 3T2QA 1UB5A 4GG6E 4N90D 1IT9H 1KYOJ 5LG1A 1MCLA 3FB7B 3Q5OA 1Y18B 3HNTL 4GMSL 4HK0A 3CFIC 1BVZA 1NFKA 1GPOH 1I7UA 4A2MA 4ZODA 5ETUB 5ADOL 1OF2A 5I74C 1G7MA 2OTUA 4PLKD 2OXHA 4WO4C 4GQ9L 3UYRL 3GZKA 2BRRL 3RWJA 5F9JB 3BDYH 8FABA 4PJBB 1F00I 4TULH 2H2PD 1OAKH 1KEML 3QPXH 2MTPA 1TZGL 2AV7A 1A02N 4N1EA 1VFBA 5D7LE 4YHLH 2B2XH 1XGPB 4Y4KB 3CLFH 1CK0L 1OGTA 4P2YA 4NNPL 4R97C 1FO0A 1GCFA 5L2JB 1AHWB 5E8PA 3LPGA 4XNQB 2P44B 5CJQL 1J1OL 5HHVL 4O2EB 5KSUA 2H32A 1UH3A 2BCKA 2HJKA 4K7PH 4JKMA 3S7GA 3NCYP 2APWA 4NSKB 1CXHA 2VNCA 1NGQH 1NPUA 1S5IL 2ERJB 5C0AD 4UBDC 3P9LB 4PRAA 5AEAA 1IGFL 3KPQB 1RZGA 2AEIT 2ZUSA 4XZUA 1P84J 1Q72L 4V1DE 5C09B 3HUJE 2P8MB 3NH7L 3VFNA 4G6AC 4M7LT 4D9RE 2UZYB 4HK3J 1QSFD 3HMWL 2DBJA 3QXTA 1XCTA 1G6RB 4G9DA 5CWSB 1VACA 4JFHE 5E2WL 5ITFB 3DVNB 5EBLA 1FP5A 1Q8MA 1Q9OB 3PJSB 3PWLA 2Y6SC 4OLEA 1S5HA 3EYUL 1JNNL 3NCJH 1BF2A 1SY6L 3O6ML 2GSGB 3FAXA 3QEQB 1ZLUK 2AJXH 1RULL 3DVFA 4X8XA 4JE4B 3J8F7 3LV3A 4WUUE 1ZLVH 3O3AA 4LHUD 2BVPA 4M1DH 5FHAH 2NXZD 3MBEC 1S9WB 5K9QG 3RFZC 4NC1E 2YD7A 3HCVB 5SWZA 1P6AB 4YGAB 25C8H 2Q8BL 5BRZB 5IGXL 4W81A 5F9WC 2EC9U 4HPYH 5DQDL 1DUZB 3BJLA 1Z5LA 2CUIA 2WIIB 3FRPG 4CN6A 4YQXH 4QY8B 4KDWA 2LQRA 1ZGLA 3RL1A 5IV2B 4P3WA 1E6JL 1T89A 3GRWL 5FYLD 3T3PE 3PWJA 3UTSA 5BZDA 1G7IB 3B9KA 5KANG 2HFTA 3JBG7 5IBUG 4XMPH 1KG0A 1BBDL 3H0TA 4LSRL 5CMAB 2CDEA 1G0YR 4MA3A 4IMLA 2XRAL 2FLRT 2BNQA 1WWWX 4JFFE 5F7EL 4PG9A 5CCKH 1P4LA 4GRWE 5DD1L 2X4UA 3T0VA 1LEGB 4NJ9L 1E4KA 3K2UH 4QRPD 2DI7A 4LSSH 4JG1H 3MV9B 4XNZB 1CQKA 4YHOH 1IQDA 5IWLA 2PO6A 4W6WB 2DQTH 3O41A 2XQYK 1VADA 3AMLA 2IQAB 2F5AH 3OMZA 5MP6H 5HDBE 5TJWK 2NY2D 3MREB 3M1BB 1D6EB 4M9OA 1SYSB 2AJYL 1XH3A 2BJMH 2VAJA 3IDYB 5KJRL 2VDNH 4X6EA 4ZPTB 2W59A 3UTQA 1BEYL 3ET9F 2KUTA 3WIHL 3QJFA 4LSUH 4C4KO 4HUKB 4ZO8A 4NQXA 4DN3L 1T6VN 4JFHD 3LAFA 4PRNA 3QT2A 2I26N 4LP4A 2FR4A 2E9JA 3WE6A 3RWGA 3CU7A 3K3QA 3RAJH 3OKLA 5D7IE 4F7EA 1CD0A 4JPWH 2CLZA 3OAUL 5LBSH 3ZL4H 2C3VB 3T0EB 3L9RB 2VDPL 4W6YB 5E8DL 2KQMA 4QGTA 3FB8B 3NIFE 3GMQB 2Z8VC 1J8HE 1OAXH 1BM3L 3NCEB 1IGYA 3KS0H 5FDWA 4X5LA 1CICA 3QULB 2ICWI 5I8OH 2R2EA 1U8LA 3MRIB 5B8CC 5KANI 1K2DB 4X6DA 5IQ7H 1NUNB 3RDTB 3NFSH 2AXGB 4PBWD 1DEEA 3PDOB 3VFUA 3JV6A 4AEHH 3S34H 4PJ9B 4XCNA 1V7NH 5HYJE 3TV3H 3H42H 1MLBA 4FZEL 4P23A 2PYEB 3GIZL 2W0FB 3PG2A 3N85H 3RDTD 2WUBH 2Y07H 4HGKC 3DMMB 2ATPA 1QSED 4WFFE 3C5ZB 5EC1B 5F8RC 4JO3L 3QUXC 3KLHC 4QHKJ 1FLRL 1GZQA 5ID1A 5LGJA 1AR1C 4IS6B 3X14A 1L6XA 4OD1L 2NY6B 4O9HL 3OGCA 3OKEB 4YDVB 1SYVB 1Z3GL 4S10A 1EJ6A 1L7TH 1GGUA 4XCFH 3MRBB 2A9ML 2ILLA 3PWPE 3V9FA 3H0TB 2OSLB 1CDYA 4YAQB 1Q9LA 3SBWA 5J0BA 1RHHA 5GISH 5K9KA 4R0LB 1A7PH 4Y1AE 2QV2A 4RDQF 3QUZB 1R3HB 1YPZE 1T89C 4OUUA 2VERN 4ODUA 3KAAA 3L95B 1JJUA 3MV8B 1M7IA 2E8YA 4EZMA 5EIQA 1WFTA 3SGKA 2ARWA 4U7SA 2C1PA 3MOBH 4WEBH 1ZLWK 2V5TA 3EOAA 4GSDL 2EEDA 3GIVB 2C3WA 4TVPL 3BZDA 2R1XB 4L8BA 1JNLH 1WZ1L 2HLAA 2ED7A 3KPQA 3HR6A 1M6OB 5ERWB 4HKJB 4JO3H 5E94A 1J0JA 4NQEA 1EFXA 3CH1B 5E9DA 4RMSA 3B9VA 5M7QA 5FO7B 3VXTA 4O51A 3S36H 1MAML 4Q9BA 1ZEAL 4NRZA 4FABH 1TZIA 3EJYC 5ITFA 3WEXB 3GMLA 3OV6A 4L4TB 3UO1L 3EO0B 4XPAH 2Z8SA 4XAKD 3WFDL 4P4RB 3SE4A 1IC1A 2HRLA 3TN0A 1IQDB 5KS9E 4H1LB 5CZXC 3LIZH 1U8NB 1DBJH 2HT3D 3IDMA 5IP4A 5E8DH 3D9AL 4PG9B 5F88B 1KJ2L 2X4QA 3U0PB 4F7MA 3UBXG 1Y6MR 1YECL 5KVGL 5CBAA 5DO2C 4X6EB 2NY5L 3RVXC 3O8XC 4XWGH 3GSNH 2Y7QB 4JFFA 4ZUWA 5EZIL 2J8UA 3IFLH 4L3EE 1YA5A 4AM0A 1BJMA 4FNLH 1HH6A 3VE0A 3I75A 4LOUD 4JFQA 1KF9B 1CI5A 2JB6B 1IGCL 1LP9A 2DYPB 4Z7UF 2YWZA 4YHZH 2VDLH 3VW3H 1B6UA 5BRZA 3S98A 1U8QB 1LEIB 1OHQA 3DARA 3P3YA 2EIEA 4KFZC 4U1HB 1I7UB 2ZCHH 2GJ6E 3O2WL 1WICA 1KIPB 1DANT 5JOPE 4JG0H 4ESKA 5B38B 5DFVC 4XPFH 2A6JB 1MI5B 5C70A 4S1QL 3SDAA 3ZSSA 2RJMA 2HRPL 4HF5H 5I1IL 1QVOA 3MNZB 5A2LH 3DVGA 5DC9B 5DRXB 3TNMA 1I85A 3VMPA 5I1GL 1U8NA 4QRUB 1Z5LB 4YHKH 1A6VL 1YEGH 35C8L 4KUCD 3CMOL 3SE3C 2AQ1A 2EDYA 3LQAL 3UTPE 4LIQE 3X13B 2SEBB 2YK1H 4Z8FL 1D5ZB 4G6JL 1HWGB 3QEUB 4LHUG 4G3YL 5CFHA 2EXYC 3IDXL 1WAAF 1NMCC 4XI5D 3CMOH 4OB5L 5IB1B 4XP9L 1W72L 3U2SA 4JDZA 5I1GH 1SEQL 3DRQB 3DUSA 3GSQA 3VRJA 2PF6A 5TDNA 1IEBB 4HCRH 5GGRA 1BFTA 3LS5H 5IWLC 4OCWL 1UB6B 2RR3A 3DUUB 4GO6B 5DXWA 1SQ2N 1V8HA 2E6JA 4TUOB 2P1YA 1PG7W 1M6OA 4KH2A 4S1QH 3MGAA 4Q97A 5J13C 4NN7C 1EZVY 3VFTA 2BSSB 5ICXB 4M8VA 3SGKC 1JCKA 1MI5D 2EIBA 3DIFA 1FJ1B 1FCGA 5I2IA 3HNVL 3M8OH 3ILQC 5DJDA 3T77B 3BKCH 2IMNA 4I3SL 4LAQL 1YEDA 2ZPKL 1S78D 3SE3A 2F15A 4LRNH 1FORH 2A74B 2R1WA 3VH8B 3JVGC 1JPTL 2LVCA 1RAMA 2VLKB 2PXYB 4PJDA 1P7HL 4OGAC 2JJVA 2Q76B 1AHWA 1J9CT 4M1CD 5F7UA 1NCCH 4XNYL 3W9DB 3HI1A 1AO7D 5TPWH 1CD1B 4EDXA 4YDIL 3WKMH 5C6TH 2JCCB 3U0PA 4GUPA 2JF1A 5I30H 4QRRE 3IDNA 4UTBH 4OCSL 4ZPVB 1CYGA 3BZ4B 4JANB 5TH2A 2CIIB 2F8OA 4MA8L 1FDLH 1Q1JL 1S9YA 3KNBB 3KYKL 5DTFB 4CJ1A 2H32H 3SN6N 3MFGB 2P5WA 3UYPA 2YSSA 3C5JB 1J87A 1F45A 4UOJA 5L7XH 1G7JA 3RY5A 4XVUC 5F1OB 2I27N 4X0KB 1FFOB 1KJMA 2NY7L 6FABL 4HT1H 3QG7L 1FFQA 1JYNA 2XA3A 1A3LL 2NNAA 5D6DA 1PEZA 4Z7QF 2X4NB 4N1CA 3GBLA 2MPAH 4QWWC 3LRSA 1FZKA 2D7TH 1UCBL 2JIXD 4ZD3H 2QQQA 2GJZA 4GLRH 1X5YA 4GKSA 3FQWA 3GJEB 3VFWA 2Z31D 5EIIB 2OJEB 4G7YH 5ALBL 3CFBA 1U93B 3O3UN 3IDJB 5IVXE 3TO4A 1I9JL 3WNPA 5FECB 2DM2A 4J8RB 1YEHH 5JHDA 5GGRY 4L3CA 3EO1A 4LSVL 4XXDA 2A83A 5DF0A 1CDIA 4M8QB 5C0CE 2C3HA 3LD8B 1KXQE 3OZ9L 2OZ4H 2Z31B 4Q9RH 4QXUH 1GAFH 1B9ZA 3A6BL 3AREA 1FDLL 3ROLA 3NZHH 5DJ2B 3N50A 4PJDE 1TENA 3HLAB 3VXQA 4DW2H 1HKLL 3KWWA 5H35A 2OQJB 4UTBL 1P7KB 5D96B 5I8KH 2B5IC 4D0DA 2AI0H 4YUEL 4GAYB 4CADA 5C0IA 4M3KB 3OAYH 3BH8A 3VXUD 1FO0L 5KBNC 1EO5A 3O45B 3Q5TA 3QRFM 2VWEC 2AEPL 4D0CA 2DDQH 1G6VK 4ELKB 4NKOB 2BNRD 2LABA 4HC1A 3PWVA 4JDVA 1ZHLB 4F15C 1RIHH 1U0QA 5D7IF 3BKYL 1ZAGA 1MRFH 1KTLA 1U8KB 3AU1B 3UJJH 3OKOA 4L8SB 3P77A 2R2HB 2E6QA 1Q94A 4R8WL 4RGNC 3G5YB 1CGVA 5FAAA 4Y5YA 3V7AE 3O3EB 3PIQA 4F9LA 5DJCA 4AT6A 3PDOA 5CGYD 1ZHBB 1U3JA 3FMGL 4NYLA 5IVOA 4Y19E 1JWSA 2IF7A 5HGGS 4JZJC 1RUKH 4U0QB 4JRYE 4XB8A 1YYLL 5LWYH 1QYGL 4QHLA 3NAAH 4H8WL 4P23B 2IANE 4FQIH 2QADD 4XPTL 3LS4L 4Y4FC 4FOMA 3KYMB 2VZ1A 2LVEA 2WWKT 3FO2B 1YEKL 4WV1C 4BSVA 5JOFA 4OFPA 1OT1A 2FH8A 4M02A 5DQ9A 2H2SC 3QUZC 3IDIA 4WFGE 5JHDE 1KCSL 1ZKAA 1U8JB 3K2MC 1Q0YL 2XG5A 5CZKA 2WSKA 4MB3A 5JDSB 3T1FB 4XCNB 2MNUA 3I6GA 4AQ1B 2EDTA 2NR6C 4JAMB 5DA4A 3MLPA 4OLZH 3S5LG 4F2MA 2WLZA 4LAQH 1T7VA 1W0WA 1MCPH 4XPHH 3QUKB 1H3TA 3WS6C 1VHPA 4LCUB 4Y0GA 1DDHA 3QULA 4YPGA 3KXFA 2YMXH 4OKVA 4XMLL 1RZFH 2I07B 3BH9B 3TVMD 2EO1A 5CGMA 3GSXA 4NBXB 4BH7A 1EAJA 4L5FL 2PTTB 2ICEA 4QNPF 5EOTB 5I18L 3C5SB 3U9PH 1T1WA 1U6AH 1YEFH 2ZKHL 3CFBB 2F53E 5F7NC 3OHXA 4C56A 2UUDK 3RWHB 4Z18A 5JXEA 3WFHA 3H6JA 4MMZC 4NQVB 4EVNA 3RBGA 2W60A 4I4WA 2H3NB 1UZ8B 3BE1H 5DEFA 4WGWB 3RIAF 4HXAL 3O4LD 2WQRA 2XFXA 4HIIA 3OX8B 2VDLL 1G6RL 4KV5E 1A6UH 1CFSA 4X8JB 1RUPL 4LIQL 4RNRB 1RHFA 4OCLC 5DMJB 1FN4A 3ROLB 4RFEB 1KELL 1MIEL 2GIYA 5TE7H 3GO1H 4F33A 1JNJA 4D3CL 1XAUA 5CP7B 3H2WA 3L5HA 3ARFC 2ZJSH 4YHMH 1G9EA 1ZV5A 3VDAA 2XG4A 2N1KA 1QSFA 5F1IA 4J3XA 1LD9B 5FB8B 5D2LF 3WXWL 1Z9MA 5FM4A 1KBGL 2HYMA 5F72S 1UM5H 4HXBH 2FD6L 2VISA 3THMH 1RMFL 1HHKA 5BZWA 5DQJB 2ATKB 2P45B 5FCSH 1JV5B 1S9VB 1CD1A 1UXWA 2J2ZA 3VI4F 1UA6H 2CXGA 4XH2B 3UTZA 3O81A 2IBGA 2CLRA 3WFDH 5HPMA 1VFUA 4XP6H 1L7IL 1RIUL 3QUXD 1U8OA 3FTGA 3P9MB 2KDGA 3W81A 4P2OC 1QFWL 4RIRB 3WXWH 3RTQA 4XHQA 2M8XA 3F12A 4KKAC 3BKMH 1WITA 3VXOB 1HQ4B 5JXED 5DTFA 4LQFL 2HVJB 3MV8E 4G7VH 2VO5A 3HI6L 4FQQB 4OZHE 5DC0A 5JOEA 3LN4A 3OTTA 3SDYH 4Y4HC 4PLOB 2OR7A 2GTZB 4MNQB 1DL7H 2NXYB 2YC1B 4K8RD 3O45A 4PJ8C 5JLZB 1FVCB 1NFDB 4MDIA 5KS9F 1QR1A 1JNNH 4Y5YC 1FJ1A 1VFAA 3T0XA 3VD5A 3B5HA 4HJJL 3VFMB 1T2JA 3D9AH 3OAYK 1EJOL 1C1EH 4YH6A 4DFHA 5CUSL 1H3PL 5C8JB 3UPCA 2NXYD 4QRTA 4LCWE 1ZTXH 1CZ8H 1UWXH 5D7JD 4RISL 4N9GB 4OFDA 1H0DA 2JELH 4JZJA 3L3GA 2DWEA 5DVMA 5D7JC 2IC2A 2VRAA 1NBYA 1QSFE 4TNVK 3HE7D 3TO4B 1M05A 1EH9A 3BRGC 1U8HA 1S5HB 1MCPL 4XPHL 4Z0XB 3FQUA 4GW1A 2ICCA 3LPWA 5EBLB 4CKVX 1BVLB 4Z7OE 4M6MH 5CJQH 3OQ3B 1SM3L 4ZXBB 3N1PC 3KJ6H 1MLCA 1D5ZA 1CG9B 2DLEA 2QADC 5EOQL 4LVHC 4HUWA 3NTCH 4N5ED 2BXYA 4OD1H 3VXMA 3ORJA 2ZZUT 4HJGA 4Y4HD 5GGSY 5TE7L 1HI6B 4OIBA 4JDZB 5FGBC 4TVPH 3L3HA 5KSBB 5IVXF 1KPUB 2DI8A 4X0KA 1JMZA 2J3SA 1NC4D 4KK6C 4LCCC 4DKAA 3BUTA 1TVBA 5FV1L 1VA9A 2FHFA 2DJUA 3MJ9H 3NABL 3UTSD 5DHYB 4ZFGL 1TJHH 1NGYA 1ITBB 2DMBA 3JUZA 1ZXQA 4Z7VA 1A2YB 2PW1B 3NA9L 1VCAA 1T83C 4DGVL 4ETQA 1KGCD 2HLFD 2P46B 3QO1B 2V17H 4FFYH 3W0WA 5F3HB 4OT1H 5GSRA 2VDPH 5GZOC 4YO0B 4GW5A 3BP5B 3RGVC 3RGHA 4JDTH 1T66D 4X98B 1RIHL 4OZGE 4HK0B 1DZBA 1K85A 5F88A 1AHWC 1C08B 4Z76B 1MSPA 1LE5B 2LU7A 1XGQB 5DJDB 3DROB 3TJEL 3DO7A 3IDUA 1MNUL 3GUTB 1R24A 3STBA 4MX7A 1V7NL 3I75B 2IWGA 5GRVK 1WV7T 2F54B 4DEPB 1JRHL 2ZOLA 4MD4B 4IOIA 1PSKL 1UM6L 4RZCA 1MJUL 5EOCL 1OAZL 3OG4B 3HPLA 2EDDA 1BOGB 4PY8I 3CVHL 4YDKH 1QLRA 4GG6A 2QSTA 5CKAA 3OXRA 3Q6GL 1XR8A 3E3QC 4JRXA 4R7NA 4QYOA 1J0YA 3PXJA 1YEHL 4PTTB 4JM2C 5A16B 4POYA 4NKMB 3WNLA 5B21A 3V6OC 4D2NA 4FQXD 4HSQA 2WAHA 2BSTA 4XP4L 4FQXA 5F1KC 3QDJB 2XKSA 2OXGA 4N8VA 4DUWA 3ZKSD 1R5WA 4W70A 3DXAD 4LMQI 3QEGH 4OJFL 1JGVH 4WDIA 2YPVL 5FA3A 3W11C 5GZNC 2XZCH 2YHGA 5C0BA 3BI9X 5JW5A 2OL3L 3NBNA 4ISVA 1RK1A 4ZS6C 3TBYA 5HHOA 1CXEA 5T1KD 3SCMA 5D9SA 1MJ7H 2CIKB 3OAZK 3FHQA 4LKXB 5BJTB 3BH9A 4BSVB 3VH8G 3FONB 3PGDB 3D18B 3M45A 5KN5B 1JYVA 2J8UF 4J3UA 1RK0A 2EDQA 3WN5B 5IFAL 3UPRA 3GBNL 3F12B 3WJJC 5BW7A 4Q9QL 3K0WA 3T0AA 1N5YH 1KJ2B 3QCUL 1Q9LB 1RUAH 4NJAH 1YN6B 5FUCE 4RGND 1DBBH 3E6FA 3SE8H 2HFEB 1OSZA 2A73B 4PGBB 2ZNWA 1D5IH 5J9PA 1VERA 3G08B