2I62A

Mouse nicotinamide n-methyltransferase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
FTSKDTYLSHFNPRDYLEKYYSFGSRHCAENEILRHLLKNLFKIFCLGAVKGELLIDIGSGPTIYQLLSACESFTEIIVSDYTDQNLWELQKWLKKEPGAFDWSPVVTYVCDLEGNRMKGPEKEEKLRRAIKQVLKCDVTQSQPLGGVSLPPADCLLSTLCLDAACPDLPAYRTALRNLGSLLKPGGFLVMVDALKSSYYMIGEQKFSSLPLGWETVRDAVEEAGYTIEQFEVISQNYSSTTSNNEGLFSLVGRKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide N-methyltransferase
publication title The Crystal Structure of Mouse Nicotinamide N-methyltransferase in complex with SAH
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 96
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.1: Nicotinamide N-methyltransferase.
pdb deposition date 2006-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2i62A00
5CIYA 3UJDA 1B42A 3PX2A 2OO3A 3GU3A 2PX8A 3HCAA 3OFJA 2C7OA 1YZ3A 2AVDA 2GLUA 2UYCA 3DMHA 5F2OA 2ADMA 1RI4A 3H2BA 2IP2A 2PX2A 4CTKA 2Y1WA 2PT6A 1SG9A 4RTRA 3OE5A 5DM1A 1SKMA 3LGAA 5EOVA 1MHTA 3M4XA 1BC5A 4OA5A 1L1EA 3DH0A 2XYVA 3G8AA 2GS9A 3GXOA 3GRRA 1IM8A 3PVCA 4HH4A 4F86A 3D2LA 4IKPA 2IGTA 4QTUB 3KR9A 3DXXA 4LWOA 5E1DA 3KKZA 3KQQA 4YUYA 4FR0A 4PYLA 3HCFA 5DM0A 5K0CA 2PY6A 3DMGA 4EQZA 5EQJB 1AF7A 5FCDA 3KPVA 5K0NA 3E7PA 3GIWA 2AS0A 2AOVA 3P9IA 3T0IA 2ZCJA 3KQTA 5LQKA 1I1NA 1R18A 2AN3A 1VE3A 2O05A 5ICEA 3ORHA 4X60A 4O29A 4P7JA 2C7PA 5GIOE 2YX1A 4MIKA 5HIKA 2B78A 2FCAA 2N47A 3A25A 3THRA 3PB3A 4E2ZA 2O06A 5CCBA 3GNLA 3FPFA 5LQJA 4Y30A 4RTNA 3O4FA 1XTPA 1ZHFA 4C04A 1SUSA 4X41A 1AV6A 5EPEA 4BP3A 4GOMD 1JTEA 1FBNA 5HOQA 4GOND 5CM2Z 5ICFA 4PONA 1KPHA 2GB4A 2B2CA 3B3JA 3R0QA 3I58A 2BR4A 4PGGA 5EMLA 3UJ6A 3M33A 2P40A 2GPYA 3M6VA 5CCXA 4WXHA 2PJDA 3P71T 5LQCA 3UJBA 2YR0A 3NJRA 3HVKA 1VPTA 2HNKA 3DXZA 1KYZA 5T64A 5FQNA 3T7RA 4M37A 1DCTA 2G1PA 3FTFA 2O57A 1VP3A 4E70A 5ERGB 3AJDA 3KHKA 1YZHA 2ORED 2UYQA 1VP9A 3SVZA 2WA1A 2ERCA 2PGXA 3G2PA 4GUAA 1JSXA 4PIMA 1D2CA 2HWKA 3RODA 4XUEA 4GBED 5K0GA 4DZRA 5DX8A 3FYDA 4FT4A 2PVCA 2JHAA 3MCTA 4PNEA 3ER8A 2KW5A 2ZFUA 2NNWB 2QRVA 2H00A 5EIWA 3KPWA 2VS1A 3SMQA 3WSTA 1JQEA 3HM2A 2QE6A 3DMFA 2VZ9A 2BH2A 3SX0A 3VC2A 1YFJA 5DX1A 2V7EA 3LBFA 1M0EA 4E2WA 5K09A 5C1IA 1NW8A 2AOUA 2ZIFA 4A6DA 3LSTA 1JQDA 1RJGA 3E05A 1KR5A 4C08A 3B89A 4AUKA 4FP9A 5KQSA 5DSTA 3HA7A 2FHPA 4OQDA 2ONYA 4DMGA 4YUXA 3CCFA 2ZWAA 3ELYA 2YUIA 3K0BA 4FSDA 4Y2HA 2NP7A 2AZTA 3UFBA 3I64A 3AWIA 3G2MA 1TW2A 3C6MA 3ELWA 1NW5A 3LCUA 1I4WA 1ZKDA 2Z6AA 1M6EX 5E1BA 1AQIA 5DM4A 3JWHA 1Q0TA 4E2YA 3VYWA 3CBGA 4EK9A 3OFKA 2ZWVA 5DTQA 4BLUA 5GM1A 1L3IA 4RTKA 5KQRA 3KQOA 3UA3A 1R00A 3DP7A 2ZSUA 3O31A 2PXXA 4GC9A 4CXMA 5EHGA 1SUIA 5FWAA 3UWPA 3BKWA 2B9EA 3OCJA 2EX4A 2AOTA 3RW9A 2IH4A 2PSSA 5K0BA 2JH9A 4RSRA 5E9JA 1JG2A 3FUUA 3BWCA 3ID6C 3G5TA 3Q87B 1N7IA 3NW9A 3THSA 2JJQA 3FRIA 3ER9A 5E2AA 4DM3A 4BLVA 2PT9A 3E8SA 5ICGA 1P1BA 3EVDA 5EZSA 2I7CA 5K01A 3EGEA 5GWXA 1KPIA 4RVDA 3NWEA 4IV8A 3M6UA 1KIAA 2IIPA 2ZIEA 4PGHA 3BGIA 5ICCA 4C06A 4LECA 4OA8A 3BZBA 3I5UA 3M6WA 2ZIGA 3KQYA 1XDUA 5K0LA 5BXYA 1VIDA 2PKWA 4RTSA 3Q7EA 3EGVA 5LQNA 3EVAA 3UJ9A 5E1OA 5CUQA 3V97A 4YMGA 3KR2A 1RI3A 4KIFA 3ELDA 3B5IA 4V0QA 3VSEA 5DTRA 4EVIA 3HTXA 1R8XA 3SSNA 3FPGA 5U4XA 1QAMA 4CTJA 1YFLA 3X0DA 2OXTA 4MQ4A 3R9XB 3OU2A 4HTFA 3A4TA 3E23A 3I53A 1SQGA 3TPZA 1ZGAA 2K4MA 3KQWA 3FUVA 4PYOA 2HV9A 1YB2A 1D2GA 4FT2A 2ZVJA 5EMJA 3HCEA 5FHRA 3GDHA 1G6Q1 1XXLA 4HRAA 5G02A 1R6AA 4PWYA 3SSMA 1FP1D 5K8VA 4B17A 4V0RA 2IDKA 1X1CA 3SSOA 4ER5A 1DL5A 3F4KA 1QZZA 1Y8CA 3L8DA 7MHTA 4QTTB 5B1SA 2Z6UA 3LDFA 3CVOA 2F8LA 1G8SA 5T67A 3UJCA 1XVAA 4RTMA 3PX3A 4GC5A 2QM3A 3GWZA 3OZRA 10MHA 1AQJA 3AXSA 3DLIA 3P9KA 3RIEA 1VLMA 2JH8A 3EVFA 3EVBA 3MTEA 4AZSA 5F2NA 1YUBA 4QQKA 1UIRA 1T43A 3A7DA 4CWAA 4PYIA 5P8WA 3NVKI 1XJ5A 2BR5A 3EVGA 2H11A 5IKMA 1Q0SA 2CWWA 5EMMA 3FPJA 3P97A 3R6TA 4R8RA 3IHTA 2A14A 3KU1A 4FGZA 3B3GA 4XUDA 4ZTBA 3TKYA 4C05A 3PT9A 5HFJA 2P1DA 4PYQA 4HSGA 2BM8A 1NBIA 2R6ZA 3GO4A 3HCCA 3KR0A 4Z2YA 2UZ4A 2YXEA 3GCZA 4R05A 1G60A 1NW3A 1G55A 2ZTHA 2P3LA 2XVMA 3P8ZA 5T6BA 5BW5A 3DTNA 5JUWA 1FJXA 1P1CA 2BM9A 2IPXA 2OBFA 4R8SA 3SXJA 1ZGJA 4DF3A 2Z6QA 1X1DA 2VDVE 3EPPA 5DSXA 3KQSA 2PV0A 4RTLA 4OX9Y 1WXXA 4AZTA 3O7WA 1O9HA 1IY9A 1RI2A 4L7VA 4PCAA 4R6XA 4C4AA 1MJFA 3LKZA 3ERCA 1VBFA 1XDZA 2BZGA 1TW3A 2NXCA 5HIMA 4F85A 1NW7A 1R8YA 2CKDA 2WA2A 2NXNA 5E8JA 5GM2A 4RTQA 5EKUA 1P91A 3HCBA 5DPMA 4AX8A 5C9ZA 4MWZA 3JWIA 4PINA 1H1DA 1HMYA 3ME5A 2NXEA 1QAOA 5KS2A 4RTJA 4K6MA 3DXYA 4RVFA 1BOOA 1JG3A 1PJZA 2AVNA 2ZULA 3FTDA 5DT2A 3HA3A 4PYKA 5HEKA 4DQ0A 2JHPA 5EZQA 4HC4A 4DCGA 1RJFA 3IV6A 3M6XA 1WS6A 3R24A 4PYNA 3TM5A 3NTVA 4PYMA 3MHTA 1INLA 3FTCA 2HMYB 5IH3A 3SGLA 3SR4A 3KQMA 3UA4A 3V8VA 1FPQA 2ZZKA 1QYRA 3CJTA 2WK1A 3A27A 3KPYA 3REOA 3VC1A 1EIZA 5LQAA 4ER0A 4CKBA 1KYWA 3CJQA 4GEKA 3C6KA 2G71A 2EFJA 3T7TA 2VDUE 4QQNA 1JTFA 4LG1A 5M5BA 3EMDA 1NE2A 3QOXA 1RI1A 2OB1A 3G7UA 2G72A 5E9QA 1IXKA 4OBXA 1VQ1A 4RYLA 4ER7A 4FSXA 3HVIA 4ER6A 4FS8A 4XUCA 2EG5A 2H1RA 4YUWA 3QOWA 2P3QA 2XYQA 5F2KA 5CVDA 4C07A 3BKXA 4M7RA 3KQPA 2NYUA 2PWPA 4ISCA 5DRYA 1VL5A 2ESRA 2ZBPA 3G5LA 1XDSA 3MAGA 4EKIA 5DRTA 4EMSA 3LPMA 5FADA 1F38A 5E8RA 2YVLA 1HNNA 4QDKA 2P8JA 4BY9E 3M70A 4UOEA 1SVUA 2AOWA 2AOXA 3LKDA 1NW6A 3UJ7A 2ZBQA 4C03A 2NXJA 3HCDA 4FZVA 2O07A 2V74B 4RX1A 5EVJA 3TFWA 2AN5A 3A7EA 3FPHA 3MTIA 4KIGA 5FHQA 3EVCA 3HP7A 3CC8A 5D1NA 4F84A 2UYHA 4POOA 1NV9A 3KQVA 2OKCA 3CGGA 1JG4A 5D1HA 3EVZA 4HTFB 4CKCA 4EKGA 3T7SA 4YV2A 4RWZA 1ZG3A 3I9FA 3PFGA 4E2XA 5LSAA 2C7RA 1BKYA 3OU7A 1O54A 2FPOA 1JR4A 1O9GA 4HG2A 2IFTA 2YXDA 2B25A 3KPUA 4M38A 1EAMA 2G70A 2P7HA 3PLAE 3MQ2A 3TMAA 3AY0A 2IBSA 5DTMA 1EJ6A 1P39A 3BUSA 1Z3CA 2E5WA 5E9WA 4NECA 3DUWA 5E2BA 2O0LA 2PXCA 3S68A 3MCZA 3MERA 2AN4A 5MHTA 4XCXA 2ZZMA 3C3YA 5CVVA 2OZVA 3TM4A 2ZW9A 2PBFA 3FYCA 4ATNA 1JG1A 1ORIA 1WXWA 5GIPE 1U2ZA 1X19A 3GJYA 2I9KA 2QYOA 3OU6A 1R74A 3EMBA 4GOLD 1G8AA 1UFKA 3HVJA 4JXJA 5HILA 4E33A 4YV1A 3K6RA 2P3OA 3FPEA 5DX0A 5EKXA 2HR1A 2JG3A 2GA9A 2G8NA 3CKKA 3NDIA 1RJDA 1WG8A 4GOOD 3SM3A 5LR6A 3QV2A 3UBTA 4KRGA 1N2XA 1XCLA 3P9NA 4IWNA 4R6WA 1WZNA 4U7TB 4RTPA 4P7KA 5CD1A 3PTAA 3LDGA 4KWCA 1BHJA 4KVZA 4QPPA 3P2IA 3NMUF 3G2OA 4KDCA 3KPJA 1NKVA 3KR1A 9MHTA 3ANXA 5CVJA 5DXJA 5E1MA 5K03A 3G2QA 3FUTA 1L3CA 4YMHA 3HVHA 2PLWA 5FWDA 1KP9A 5LQUA 2IBTA 1KPGA 3FUXA 2BR3A 2VP3A 1WY7A 1FP2A 5EG5A 5BW4A 3TKAA 1V39A 3G8BA 1EQAA 3NDJA 5FA8A 4P7GA 1NBHA 3BGVA 3P2EA 3HA5A 4QVGA 2XVAA 4WVLA 2IH2A 4GF5A 3FRHA 4PIPA 2R3SA 5EHIA 2FK7A 4DCMA 4E31A 5BP7A 1SQFA 3OE4A 2QRVB 5JR3A 3LX6A 4RTOA 3ELUA 3UJ8A 4G56A 4M36A 2NP6A 4AZVA 2Q41A 5HIJA 2UYOA 3FTEA 3MGGA 3P9CA 4PYJA 5K0FA 2PX5A 4RVGA 4H0NA 2PX4A 4U7PB 2I62A 2XBMA 3NVMB 5HIIA 4CKEA 2FRXA 2Y1XA 1EJ0A 3FZGA 2AOUB 4E32A 3LHDA 1EG2A 3OPNA 3TLJA 2PWYA 5FQOA 4DKJA 2IDJA 2OY0A 2YXLA 1D2HA 1OR8A 3TRKA 8MHTA 5DWQA 3GRUA 4DA4A 2EJUA 1JQ3A 1UWVA 4MTLA 3LDUA 1QANA 1L9KA 2CMHA 2OB2A 3OZSA 3OZTA 4HGZA 5CVUA 4RV9A 4QPNA 3HEMA 5DLYA 5EC8A 5FULA 4KW7A 3LECA 2LD4A 3EEYA 3IYLW 1X1BA 3TR6A 2GH1A 5HZMA 1NV8A 2B3TA 5FA5A 2DULA 3PS9A 2ONZA 4OQEA 1I9GA 2IH5A 1X1AA 4P58A 1PRYA 2VDWA 1TPYA 2EJTA 4AZWA 5C0OE 5EIFA 1KXZA 4BLWA 3HNRA 2YTZA 3B3FA 2AOTB 3LCVB 3TQSA 2DPMA 5GINE 2ZZNA 2FYTA 2CMGA 3DLCA 1NT2A 4RVHA 2CL5A 4YUVA 3P2KA 4HGYA 2P7IA 4X63A 3LL7A 5DM2A 4BP1A 5EEHA 2OYRA 2AR0A 1G38A 3BT7A 2XYRA 1L3BA 1ORHA 2PXAA 3AXTA 1JSZA 4E30A 3EVEA 3G88A 2OPBA 3R3HA 3TOSA 3LCCA 1KHHA 3IEIA 1XCJA 3NWBA 3BWYA 1DUSA 2P35A 5H02A 4YV0A 3MB5A 3JWGA 4X61A 3GRZA 2QY6A 4YUZA 1F3LA 2FK8A 4X1OA 3BGDA 5K0EA 2JHCA 3DR5A 3GGDA 3B7PA 1ZQ9A 5EGSA 4QVKA 3FUWA 5CVEA 3BWBA 2I6GA 4A6EA 2ZLBA 2YQZA 3PFHA 3A26A 3UJAA 4QDJA 3UZUA 4GQBA 4LWPA 5GP1A 1QAQA 2HTEA 2ZBRA 3C3PA 3JWJA 3EGIA 5EEGA 1M6YA 3U81A 5KYGA 1RJEA 5K05A 4ER3A 4PCLA 5KVAA 4OBWA 4MHTA 5FUBA 3GRYA 4IV0A 1N7JA 3CJRA 3BXOA 4KDRA 3C0KA 5FTWA 5DXAA 3DOUA 3LBYA 5LQRA 1YF3A 3DULA 3BWMA 3G89A 3GRVA 5GOZA 1RI5A 2GAFA 4P7FA 5EMKA 5K0JA 3EEOA 2P41A 2C7QA
chains in the Genus database with same CATH superfamily
1YJCA 2UAGA 1XFDA 4LDRA 1QVZA 1SQ5A 3K3PA 1PJCA 3GU3A 5BMVA 2PX8A 2FMKA 1WF6A 4PWZA 4D3XA 5LP6A 1MABB 4XEUA 2OD9A 3RV3A 4X44A 1HT3A 3CNBA 4RIEA 3ZI7A 4A8JC 3S3TA 1EK0A 2VAWA 2Y1WA 2OL4A 2O8FB 1YKGA 3PFKA 3HBAA 4PZUA 5KYTA 3QMVA 3LBHA 2FP4B 1XYGA 4GWKA 4KO8A 4QDOA 1O95C 5J58A 3DH0A 5EIOA 3FOCA 4I9HA 2CHEA 1IM8A 5BRJA 2KBFA 1TDJA 4LWOA 4QECA 2VT3A 2YWBA 3AZPA 4O63O 2ZU6A 1QK4A 2XGMA 2R751 5FCDA 5I9MA 4ZN6A 1MB0A 3HJRA 4ZAGA 3TIIA 4RKYA 2IU6A 3KQTA 5K5EA 3IQGX 1AQUA 4NJEB 3QKSB 5JAHA 1JH8A 1Q6ZA 3ORHA 1J8QA 1Z8HA 4O1HA 1PGOA 4M0MA 1DDIA 1Q2UA 1E2JA 3G85A 3VR2D 3ZNOA 2V6MA 2AK3A 3ONVA 2X7JA 3L7AA 4GP9A 1ZVVA 1WMDA 4O8ZA 1HORA 2A0KA 1J49A 3GEGA 3QVLA 5KJ6A 1E9RA 2BM1A 2IHJA 1KKMA 1ZHFA 2H2GA 3JQBC 4G8CA 5BNFA 2IHYA 1KSJA 4O5AA 5EKDA 4WKNA 4H4DA 3HACA 1GAXA 2D0DA 2WM8A 3AX6A 3ZCXA 3ZQ4A 2GT1A 2J08A 1PZXA 1UDRA 1WDMA 4TV9B 4ABYA 2V7BA 4IJQA 2Q7XA 3EA4A 3UJ6A 3HDTA 1E7MA 1WB4A 3DEYX 4IDFA 4URYR 3TINA 4OLBA 4K81B 1HZZC 2XQIA 2EU8A 5JQGA 3E81A 1MV8A 1QCDA 3ZIAD 1ECLA 4DSAA 2ZI5A 2PSEA 5JAMA 3DP9A 1TYAE 1KRWA 1N5KA 2O8VA 2W5UA 5FPTA 5GVSA 1CP2A 1SBCA 1YOBA 1KVRA 1JFFB 3F7TA 4R1TA 4Y9RA 4XARA 1YJ5A 4RL4A 5DBGA 4ZQFA 3TOVA 3VO1A 4CU2A 3HR8A 4CIXA 5C80A 4C5AA 1ESCA 2Q5HA 4U6SA 3I9LA 4KDEA 3TR5A 1MO5A 3FSEA 3RAJA 3DTVD 1MAWA 1CB0A 1NVGA 1CEYA 5CB0A 1N2EA 1EKXA 4HQLA 4OQZA 1Z6ZA 3SX0A 4LV6A 4Z0TA 2J9ZB 4JH0A 4WXEA 2IRWA 3SC6A 3AVQA 3MJFA 4TM7A 2O8BA 3SHFA 4A2QA 1DC3A 3UAOA 4DS3A 3UUGA 3DO6A 1I2MA 3EQ2A 4HZUA 4S1VA 4TXJA 5JI3E 3ADBA 4P35A 3GAZA 3OPYA 4DBLC 5TGDA 3O1LA 1DSSG 3PU6A 1UZMA 4FHZA 2DR0A 1RHUA 2QN8A 4MVJH 1T9ZA 4RVNA 2D00A 2G06A 2JLCA 3AWIA 4AKIA 2R84A 3RVLA 1NTRA 2CL7X 3C6MA 1G8GA 1RJ9A 5IX8A 5EESA 1RPZA 4XWAA 4HDCA 3VOTA 2Q5JA 2O3JA 5G53C 1USKA 3ZS9A 3GLIB 3E7DA 3JWHA 1OAKA 4OQ4A 5F5LA 3W9UA 4E2YA 2JEYA 1SIWA 2PQ0A 2ATVA 2XADA 1M7HA 2N9UA 3AEZA 3AETA 3M9WA 4XKJA 2NTVA 3W79A 4UXIA 4IDCA 4CJXA 5IVPA 4DXAA 2QZ9A 2WSYB 2ZBVA 2PS0A 3L0YA 1R00A 5H5JA 5EHGA 3FWPA 2DEUA 2AE1A 2GBCA 4K9NA 4P9NA 1XLWA 2IHBA 3MG9A 5AKIA 4TSFD 4PO1A 4J0FA 4RK1A 5AM1A 5FUVA 5J9FA 1T3LA 1XRQA 2YWEA 1M2VA 2ORWA 3UYLA 3QLUA 3W5SA 421PA 2IUYA 2QN1A 4IX9A 3I32A 3NC4A 3W7AA 4XM1A 2PMKA 1T4CB 5KNCA 4DVJA 2PT9A 4XB1A 3R5HA 4MYSA 1AQLA 4IJ6A 4JX9A 5EZSA 4F3TA 3ST7A 4BAUA 2BMEA 4IVRA 3DO5A 4ENWA 6NULA 1EM8B 2FX2A 3GG2A 4RFSB 1QU3A 1Y82A 3GLIE 4M6WB 1YVRA 2O5EA 3R3UA 2V5UA 2IIBA 1L1QA 1AUOA 1U28A 2J8ZA 2PTGA 3K53A 1LK0A 3KHSA 1R0KA 2WIFA 2KHZA 3MMZA 2GLXA 1KSGA 4B7XA 1DO0A 2D0OB 5AOAA 1D4AA 5CGQB 4NK5A 4KIFA 5TXGA 3QE0A 1J5XA 2P4HX 1HLGA 2HQ1A 5C32A 1BX1A 1NKTA 3V8NA 4DMMA 1SOMA 3FI9A 4F91B 4NAVA 1HDOA 4HYQA 4HPXB 4C3VA 3BMCB 1J7JA 2HJHA 3DL7A 1I80A 1CUHA 4UHFA 3CN9A 3NEPX 4YVFA 1JEYB 5ALEA 1FQKA 4J6FA 1Z2PX 2ZAYA 4Q3CA 2R8XA 1LNZA 3AI7A 2UXDB 3GI1A 2A94A 4NQZA 4Q3KA 3SJZA 3BORA 4UNRA 1PEYA 2DPHA 2K4MA 2WM9B 3VO8A 1W5EA 1B15A 1WV1A 2ZS9A 3KWFA 4ZCSA 2D7DA 3GDHA 2IEGA 2F1KA 4Q3BA 3L1VA 1E1DA 4A2WA 1OFGA 1HYGA 4H35A 5JJCA 3GL9A 2Q9UA 5LQMA 2HK7A 1EJBA 3LOQA 2I6XA 5G0SA 5B1SA 3VR6H 3QTBA 5J63A 1E2UA 2F8LA 4BFXA 3BIXA 3QTTA 5JNLA 1PLJA 1A7KA 4J0EA 4ND2A 1T0IA 3N2LA 3PX3A 4LJKA 5T5QA 3ZHQA 1OKKA 2ZXFA 1R64A 5IDXA 1XWIA 5K6AA 4JA2A 2JJ2A 3V4OA 2CL0X 5JPDA 2LWIA 1DIHA 1Z0DA 4L73A 7MDHA 1PL8A 2MCFA 1JHAA 1NPDA 4PW0A 1Y6JA 5C1PA 1Q0SA 5FBKA 4AP9A 1QJ4A 2H18A 3P97A 3MGAA 2YN0A 3K92A 4NSNA 1AGRA 1WUHS 2X8WA 3PT9A 4RAOA 3KLPX 4PYQA 1VE6A 2QTBA 5B4UA 4HZIA 1PGJA 1SY7A 2VUUA 3WA7A 4JI4B 1TJYA 1W1UA 1RHMA 4PZLA 4EI9A 5BT9A 2ZWPA 3KDAA 3P8ZA 2R44A 1T26A 3RVKA 3DXFA 4C0HA 4DM4A 1BROA 1IOZA 4AL4A 3RUIA 3J81A 2WSSD 3CYFA 3EPPA 5BSTA 1GQ2A 4GPEA 4AZTA 4D43A 2VTDA 1JT9A 3O7WA 1IUKA 1RI2A 4G4IA 1JFRA 2YIJA 3ERCA 1IVNA 1WDWB 3AR2A 4GDFA 5DJ5A 1A8IA 3BREA 3VR4D 3GJ0A 3GVIA 2B0JA 4QQ8A 3VR0A 2LGJA 1SPXA 3FGOA 4X92A 1IBMB 1NUSA 4ZYUA 1RW4A 3HCBA 4LV5B 2YYYA 1DFIA 3PUYA 1H1DA 3MT0A 2ZTSA 5TVKA 2ZUSA 4AO7A 4R1OA 4WT7A 1Z73A 3L6RA 1FW8A 4ZHQA 1YDMA 5J4VA 2O20A 2GYYA 5IDWA 1WSWA 5FWYA 1QLJA 1JE0A 1HF3A 3RT9A 3P19A 3IH5A 5ENVA 2HK9A 1KZ1A 2CCKA 2YYZA 1DX4A 3RUCA 4NABA 4JGBA 5B12A 4QFBA 4MUMA 4JOSA 5AUQA 4UHHA 4CT4B 4B9AA 5CHEA 2I7DA 2JCXA 5HKKA 2EZ9A 3CIOA 5LZ4A 2R0QC 3GVXA 1RR6A 3QVSA 4M0FA 2DUWA 4NYMR 1FPQA 3HR4A 3RANA 4BEJA 2VRCA 4WZBB 2X9GA 3C1UA 3KPYA 4IXTA 3FDIA 1MT3A 4UVIA 4IY1A 3VC1A 4E3WA 5JAIA 3T3NA 2IYYA 4UUAA 2ZSJA 2Q6TA 3IERA 1MO4A 1XU7A 3HV0A 3KSDO 3EF1A 3OKCA 4JLAA 4RIHA 3PWTA 2ZPAA 5E9QA 1T29A 2I2BA 1D2NA 2ZT5A 3B6KA 2BJHA 1NNI1 3AK4A 2FQYA 2OLJA 3A4NA 4HFNA 4PLZA 2XV1A 5K3DA 2P3QA 3AEKA 2CVZA 4N3BA 4TQAA 1FYDA 4C7JA 5LMNB 3ADKA 1E9SA 4ADSG 2PWPA 1NMYA 4I1SA 4OY3A 4B3FX 4PRLA 5A4AA 2CSXA 1STOA 2H7CA 1XP8A 4Z9YA 4PG7A 1G8YA 4ZQHA 1RNLA 2AEMA 1SB8A 1BE1A 1YQTA 3RASA 2L82A 3KM0A 4TSRA 2ZBQA 3L7BA 2OAQ1 3RHSA 1L4MA 1N2IA 3G2HA 2IDMA 3A1DA 1QH0A 1KQ3A 4FYKA 4N0MA 2O0JA 3H9UA 4DLBA 2KX7A 4YRQA 4QOHA 3EVZA 1I2AA 5F12A 3VJKA 4EKGA 3T7SA 2B8TA 4WA8A 1Z6XA 2ECFA 3ET4A 4QYSA 2DLNA 4EFKA 3INGA 1O54A 4KCGA 1FVXA 1TMOA 3FTNA 2Q7DA 1D4ZA 1I5OA 2BOVA 3RIXA 3LVBA 3JARA 1CQJA 4FXPA 3ZD7A 2JAQA 4PGMA 1SCAA 2P6MA 4DCSA 5IRCD 1I94B 1HNZB 4KPYA 1G8JA 4BBJA 1U0EA 3CLHA 4GBJA 4U39A 3B8HA 2QGNA 4R1QA 1KE1A 4UUBA 5LBIA 1CW2B 2ZUDA 3NHYA 4F3KA 2C82A 2NU7B 4BMSA 3NHRA 2NSLA 1EP1B 4GMGA 1W73A 1LZKA 5B2ZA 2AZ4A 1TK9A 4Z49A 3B2EA 4N3CA 1WXWA 3FIUA 2NWQA 3PRKE 2I7XA 3E8XA 2B98A 3EMBA 1G8AA 4M8KA 5AI6A 4FCCA 3A9WA 1TM4E 2X1HA 2BF4A 1WHTA 2GCPA 3A6DA 3EYAA 1CF2O 3FNIA 3LAWA 5J47A 4JV5B 2QJWA 3LPCA 5FR1A 1C41A 1S96A 2ZRDA 4LY3A 4YRMA 1B26A 3H3FA 4PHGA 1ZIYA 4TWJA 3JD4A 3WB2A 1JPUA 3PC3A 5B58C 5DKFA 1ZRMA 3IP8A 1PFVA 3CZQA 1FYXA 3UJHA 4J7UA 3WRYA 1BHJA 4FN5A 1LD3A 5FPSA 2OKGA 4KDCA 1MDBA 2MOKA 4GX1A 1QQ7A 3PPVA 5K03A 1M6NA 3H6HA 1J1ZA 1C9KA 1HM5A 3ZIUA 5FWDA 1SGWA 5AW2A 5B7QA 1RLUA 3C1TA 4ALKA 3ITNA 1FLAA 3PD1A 3GJQA 2VPQA 4G4GA 3HCNA 1QQAA 3I9JA 3EAFA 5WRFA 1ISPA 4IFEA 3BHJA 2HZ7A 1VCOA 2RJ3A 3GNTA 4MEAA 4PNHA 5HCUA 4EW3A 4CEIB 3TEJA 4K9RA 2WF5A 1GQSA 1WABA 2GN6A 1W4AA 1ZLXA 1TF5A 4WVLA 4DYDA 5CDSA 1J2RA 1TVMA 4UNSA 3WGMA 1J2YA 2OM2A 4RTOA 4KQJA 3AJRA 1KXJA 2V7QA 5KNDD 5L7TA 5IPFA 3K9GA 3K71B 1FW6A 3VNUA 3BSFA 3D3QA 1CC1S 4MP6A 5HIJA 3HABA 3MGGA 3IQZA 2YC2C 3HADA 1JQBA 4B5LA 4DDMA 1I7LA 2WYVA 3Q7QA 4JWKA 3EZNA 1O0SA 2B4KA 1XTQA 3QFSA 1E0DA 2JIOA 4US0R 3D6FA 1Y81A 5EINA 2BYTA 4UM9B 5BNTA 2AMLA 1M0SA 4I4TF 1QDEA 4AG6A 2FDCA 3TGPA 3U48A 2V7WA 4UU0A 4DA4A 3CTMA 1JWLA 4Z7JA 4RGVA 1ZUIA 3C8HA 3DBRB 4K5QA 5H8WA 3P0EA 4Y0AA 5CVUA 4WGFA 1N8KA 1NM5C 5F2EA 5FULA 4HUQA 2JCBA 3NXSA 2O8DB 2AE2A 3IVXA 1U1DA 5H3LA 2W90A 3BE5A 4RE6A 3W77A 2NO5A 3ZWDA 1P2UA 3WYCA 1PZGA 4KWEA 1U0OC 2DULA 1C3OA 1GN9A 1ZUD1 5JD4A 4JMPA 4B3JA 1NYLA 1W96A 4OTZA 3R6WA 5I4KA 2QMEA 3HNRA 4JDUA 2ERXA 1PD1A 1GXSA 1VGRA 1ULZA 3ZCSA 3QW2A 4JUFA 3ZK7A 1ITZA 1N6LA 3BZUA 5AVXA 3Q2OA 3FMGA 4G89A 3P2KA 1TUEA 1NURA 3LA6A 1EAYA 3LL7A 4UVHA 5EEHA 5AYVA 4AG5A 4CE6A 5L9AA 1G38A 2HQOA 4QE3A 1KBZA 3F5MA 1HLDA 1N92A 3PHHA 1XPUA 5LYJA 4JODA 3G88A 4G0MA 4TZ6A 4AI6A 1YI1A 4B32A 1NTOA 4CM1A 1WO8A 4FKZA 1NZDA 3IEIA 1IG0A 4EGAA 1XPJA 5FX2A 1DDOA 1NHWA 4ZJUA 2AL7A 4K2AA 3FIJA 4YPFA 1FYWA 4RLSA 1WCWA 1V4VA 5K2OA 3HJGA 3KJEA 1AG9A 1H0KA 2A4MA 2P9EA 4EHDA 2QG6A 2XYGA 3VDMA 2QRKA 2ZE7A 5KMGB 2Q3JA 3BWBA 3U4DA 3WIDA 2HDOA 4Q1EA 2O7VA 3U4CA 5H0IA 1A1SA 2ZI3A 2UV8A 3UJAA 4FGWA 5IJZA 1XCPA 2FPGA 3ZHYA 1NZJA 3OZVA 4LWPA 4BFLA 3SDZA 4OCZA 2EGHA 2H1LA 4L78A 2DFLA 5AJUA 3W2GA 1WLYA 1ZICA 1EZ1A 1XD9A 3JWJA 2JD1A 5IYZF 1P4AA 3SEQA 1KI2A 2Z08A 3R5FA 1NQVA 1UFRA 2H85A 3DDWA 4IV0A 1IXSB 4QQFA 4TYQA 4ZQIA 5EJAA 3SLKA 1C0LA 3PFNA 3OEED 4FWBA 3WJ2A 2QTRA 1U2QA 4LKOA 5LQRA 2C5AA 4ZAZA 4Z4GA 5BMOA 1MN6A 1C3VA 4R0VA 3H3JA 5EMKA 2W70A 3T9EA 4MPDA 3ZHOA 1EFRA 1SKBA 3LUGA 1SB9A 3PEEA 4NULA 1IBRA 3L1JA 3HCAA 1BMFA 4REQA 1E2IA 5AVJA 4NMLA 1ZNWA 3H0KA 1P7PA 1F12A 2AG6A 2GFQA 1UH5A 1G3MA 1I4OA 1A8QA 3NBXX 4QBIA 1CPYA 3KEQA 3NEYA 4W1SA 3MS2A 4ZU3A 1KOFA 3QI7A 4S1PA 1DKNA 1LLDA 1O5IA 1U7HA 5CDYA 3OE5A 2QP3A 2A0UA 3LKBA 4MS1B 1AGPA 1T1GA 2E89A 5THKA 3H1EA 4G8DA 5C3UA 5EXEA 2ODPA 3V1TC 3WRVA 4FMDF 1SHKA 5KU1A 2EFDB 2KBEA 1R0SA 4PG4A 5G3ZA 1RSZA 1UMKA 5FIUA 4CUJA 1E9AA 3A36A 5E7JA 5LXTF 3QQ5A 4P36A 1U3DA 3EAQA 2G0NA 3P2MA 5CH5A 3A9VA 3W5CA 2CNLA 4XWKA 4TV8F 2WU0A 3KPVA 2AS0A 3A58B 4Q15A 1NN0A 1S01A 2QAIA 3KYJB 4YRLA 3GGSA 5TGTA 1Q22A 1GPAA 2DT8A 4LCJA 4ND3A 5CT9A 4F2HA 2Q9CA 5B3LA 1C0KA 1LBQA 4HDKA 4EI8A 5GIOE 3KDPA 4C2AA 1RXEA 1ZSNA 3IALA 1PWYE 4MR8A 1D2AA 2LXNA 1UBSB 4QULA 3AVWA 4ZA2A 2Z3WA 1GPYA 1I14A 3MMNA 3V3KA 4EM6A 2JVJA 1XAGA 3PDHA 4PFSA 4MRPA 5AJVB 5EPEA 5K3OA 2VXOA 1J70A 2DHDA 3GLRA 2WWGA 1YQ9A 5ICFA 2G07A 2HGSA 1O03A 2CVHA 2RJNA 1I7PA 1U9YA 4L9WA 4UBJA 4WZ6A 4PN7A 3U5TA 2JBHA 4WXHA 3NHKA 1ECPA 2KE5A 2ZUWA 4Q3LA 3WKAA 4JLWA 3F47A 1NMEA 3AFIA 5FI0B 5JSFA 2BPOA 4PZYA 4G1EB 1FXUA 1XYVA 2BEJA 3ANSA 3L7MA 3SLRA 3U3RA 2MIIA 2FWMX 3L49A 4RV5A 3DFFA 4WJZA 2G4LA 1WE2A 4IW3B 1M1NA 4ZFNA 3KJZA 2APJA 3B9QA 2A2ZA 3OD5A 2YIVX 4M9UA 1E3SA 2X8JA 3GEMA 1O5OA 2NUPA 1Q5PA 1V0JA 4D4KA 4L2IA 3SJCA 3AUTA 4E6PA 1KMHA 2ZFUA 1EMDA 1LQUA 1TQ2A 1Y3AA 3CCBA 4XQEA 1XA4A 1KOJA 4KBFA 2O7RA 4CMHA 3PEYA 1IPFA 2QSZA 3EWSA 1O89A 3LZCA 1QP0A 3F4LA 2RHDA 4P4GA 1V8DA 5JDCA 3OE7D 3CW2A 1UJNA 2FSPA 1KQOA 2RARA 1WXGA 4WOBA 5AVSA 1R0LA 5CDFE 2A5FA 2V0CA 1KR5A 2J3QA 4ZREA 4P08A 3P0IA 1U7TA 5KQSA 2Q29A 5JXHA 2I7VA 1T5LA 1GNSA 4Y2HA 2R8YA 3M3PA 3IVGA 1QH9A 3ZDDA 3A05A 4D9JA 1EX7A 1NP7A 1DINA 2EGGA 1UR5A 3QIAA 3W6UA 3PQDA 1WHSA 3DV0A 1CS0A 2Y71A 1MPTA 1DKQA 3R5XA 5AQEA 1AXEA 3HP1A 1Q3KA 3IELA 1KI3A 1W581 3KQOA 3DP7A 4HNHA 1U8ZA 1PYDA 1SULA 2MYTA 4A10A 4EY7A 2J5QA 4BE9A 1JGTA 1FJHA 2HPAA 2IY9A 1U3WA 4IIYA 3WDMA 3X2EA 3ZQJA 3HDJA 1F9AA 3BWCA 3ID6C 4DR2B 1AKEA 2ATIA 4RJTA 3JQ7B 5DISB 3QLVA 1GFIA 2YZNA 5F3WB 4D41A 3M7IA 3OOHA 2I7CA 2X58A 3Q0TA 5AW1A 1PG2A 4F0JA 4C5CA 1B6SA 2FXIA 2ZB8A 1AN0A 2X3UA 4DVGA 3M5DA 1K5PA 4ZV4A 1JR6A 4BVKA 3KQYA 1XDUA 2PKWA 1P1FA 3AM4A 5M29A 3TQHA 4GI7A 2F43B 1N0IA 1PHRA 2F8SA 4TT3A 2EZ8A 3B5IA 3F5FA 5BSGA 4CIBA 3H97A 1NJ1A 3L79A 3HKBA 1QQ6A 3PL1A 3KB1A 5LZ8A 4PQYA 4RZQA 4GWLA 1JAXA 1UUFA 1NWHA 2B5VA 3O47A 3LWDA 4A15A 3TCXB 3DVRX 2IEDA 1J8VA 3O92A 2JJ1D 1YQXA 1QIEA 2BEKA 2EP8A 3OIYA 4ZALA 4BKUA 3STHA 3C5WP 2ZRQA 3QQPA 3LF1A 1VOTA 1XFAA 1P0QA 1OYVA 1YR9A 2JLQA 5G02A 4Y9UA 4LYDA 4ZICA 4V0RA 3QVKA 5THQA 1FP4B 4WHMA 1IXZA 2QR5A 2RFLA 3PF9A 2VR1A 1I13A 4LXYA 1A8SA 2H57A 1G5QA 2GEKA 2QLJA 4O4JA 1YJQA 3LK6A 1GPUA 1WV0A 1P4HA 4Y9SA 2J45A 4ZEVA 3D0RA 5FD8A 3HXMA 1IEVA 5DHUA 1KL7A 2XNDD 1T2FA 4D82A 2GPSA 1Z7YA 5TPZD 5DM60 4F6RA 1R10A 2ZRHA 3IIKA 1NNEA 3V7YA 4TMWA 3CX7A 1MHPA 5P8WA 4JDPA 4E5YA 2QP9X 3Q9NA 3VBEA 5CCEA 3WS7A 4ALLA 5EMMA 5TV2A 4L0MA 1V16B 3B12A 1RQNA 3ELBA 3FPAA 2D13A 2MYUA 3USES 4PLWA 1OI4A 4PSVA 2JKYA 2JZNA 5KTRA 5IFLA 1XEAA 2G67A 3UCXA 4PVDA 4E11A 1P60A 2GO1A 1QV6A 3C6QA 2W8BA 1DAOA 3CE6A 1BYIA 3EPLA 3STUA 2ZB7A 4DDVA 4EJSC 1FUUA 1SBZA 1O9HA 1QGOA 4DYVA 1F9EA 4M49A 2PZ8A 4E7PA 2O0HA 3D8TA 4DV4B 3PNKA 5ILOA 4D4JA 1EESA 1YBAA 1N8NA 2FZVA 4OQXA 2XXBA 3N28A 5IAEA 5F7XA 2PZGA 1QQ5A 3GEPA 1C1YA 2NXNA 4H27A 1XTTA 4ITUA 4ZVPA 3KJIA 2HD4A 4OO3A 5IN4A 1SUBA 3LXXA 5G40A 3GIDA 2O4UX 1Y89A 4M55A 4FFSA 4K6MA 4E2FA 4JEHA 4OLAA 1LDMA 1BOOA 1K8YB 2PK3A 3P32A 5AICA 4CMGA 2CDRA 5FH9A 5GOTA 4CMIB 2A9FA 2BGKA 3AEUB 2A9QA 4US2R 1RLTA 4PHFA 4YO8A 5EZQA 4BVLA 1PQPA 3W6NA 4LRXA 3IV6A 1AQ6A 2R5FA 2Y6UA 3AP3A 1SCJA 1NLZA 2C00A 4FW8A 4RHXA 4TLBA 2WHXA 1T4MA 2HF2A 2WYUA 1H4VB 2HMYB 4OHFA 1UKVY 4NONA 4L95C 3C87A 1SG6A 3SR4A 1OE0A 1JSRA 4ZAWA 3BXGA 2F3RA 2Z2YA 1SXHA 2ZIAA 5L53A 2JH3A 1NUHA 5JS2A 1FMJA 4WXYB 1VB5A 5LNK6 3PBKA 4KK4A 1AZSC 4R2LA 1N6NA 2VWQA 5ALSA 5B2FA 1IWPB 1KYWA 2RH9B 1KK1A 4MW7A 4NBLA 1OTXA 3SD7A 4FWTA 2QZJA 2TYSB 4UBNA 4MWBA 1K0FA 5M5BA 2A3RA 5IXYA 3DFKA 1GSHA 3HYNA 3WBFA 3L2OB 4JEMA 4BEVA 4FSXA 4PLGA 2C92A 2FA9A 3AKYA 2VXBA 4XH9B 2RHOA 4JNKA 4ZP1A 3C6BA 1TUGA 1OTHA 4LRUA 5A0TA 1QLWA 3ET5A 4PSUA 2WD7B 1UJMA 2HIGA 4WL0A 2ZIVB 3G2JA 4D9IA 5AVRA 3K31A 3MAGA 4OHKA 4EMSA 5JMOA 3SF0A 2VPZA 3K0SA 2Z4TA 2NLOA 1WNFA 4PV7A 1HYQA 1Y4AE 1CNEA 2VH2A 3AHCA 4KYVA 3AFMA 3P26A 4MAMA 5FLEX 2YN4A 3RS2A 1WB6A 5EYPB 3MS7A 4C03A 3TFOA 1F1BA 5HX7A 1KAHA 3HMKA 2X0EA 2EFHB 3A10A 2AMVA 1EDZA 2QL9A 1B8OA 1QSGA 1CIVA 3CX6A 4RUKA 4ZV9A 1NOKA 1MJ5A 1GM5A 1VSBA 1XWWA 3UV7A 4POOA 1K7YA 1FXSA 4DMRA 2LCFA 3QYJA 4AJ2A 3QVGA 1E2EA 3V32A 2R7AA 3FF4A 2DBRA 3RQIA 5B3JC 1FMFA 2W83A 3D64A 4HZGA 1BKYA 2X5NA 3WGGA 1WBBA 2EKPA 2JAWA 1L4GA 3GT7A 5LUAA 1KK2A 2EX0A 2YXDA 3RYHA 4QZVA 1L5VA 1W93A 4JYMA 3E3OA 4O1MA 1EJ6A 2IA5A 2AJDA 4F7WA 4CV3A 2G9QA 1Z3CA 5KVSA 5E9WA 1Q7RA 3DUWA 5DEOA 1O97D 2ZR0A 4M54A 4CG0A 1YBVA 3QP9A 3C3YA 1YB5A 1DJOA 3C3KA 5HR5A 4LTMA 4LC1A 2RKOA 1ST2A 1JKJA 4YQEA 5CX4A 4HKTA 5HK9A 2GEVA 1U8AA 5LP6C 1ZVJA 5F7OA 1R74A 3BRWA 4I5IA 4C0BA 3IEXA 4E33A 1K9VF 1T6BY 5HZGA 5EN4A 3K6RA 2XR1A 4J0JA 1H1LA 2JGIA 2BP7A 3NDIA 2FHSA 1MABA 4HAIA 4CL0A 1R88A 2X13A 4QU0A 4B40A 1XMJA 4YRJA 3SHTA 4C78A 5LMZA 4J4HA 1DT5A 4HYYA 4OK5A 3PL5A 2Z4SA 2GPAA 1WZNA 1QWSA 3M6MD 4R1LA 4MYCA 2FP4A 4ZYYA 2XBLA 1MXHA 4GE0A 4BQNA 2A33A 4ZQEA 3WYGA 3ZJ4A 2GARA 1E1LA 4JU9A 3ROEA 1T5BA 3P9ZA 3ICOA 5HQJA 1NBMD 3BDVA 1P4JA 5IBRA 3E0XA 5LDHA 1KP9A 2ON6A 1DXHA 1RCUA 3HWWA 1FS6A 5EZYF 1NSFA 4ZMBA 3GT4A 2XNSA 3Q85A 4IILA 5ALHA 2B1JA 1E2HA 1Q3HA 3KTOA 4HX2A 3QKSA 4OXXA 3VXKA 5KQLA 2D1FA 4XASA 1WUJS 2IIVA 3KZMA 4UBLA 3QEJA 5LPNA 3JQAD 1ZN9A 2R3SA 2FK7A 3O7MA 4E31A 1HR0B 2QRVB 1UANA 5TQVA 3ELUA 1ZNXA 4G56A 2WF7A 5KCZA 1QP7A 3FTEA 3NDPA 1ZCBA 2RH4A 3F5QA 2GHTA 1OLSB 4RCYA 4RVGA 4EFMA 4ZZ3A 1Z35A 5EY5B 3DZ8A 3ESZA 4CEHB 3AVUA 2BKLA 2GMWA 2QP4A 4PVCA 2XCQA 4TV9A 4NIMA 3PFCA 3FOWA 8MHTA 2E37A 1KMQA 5HM6A 2DX7A 2W2NA 1R9JA 4GW3A 1BU5A 3JTMA 4E07A 1L9KA 4BKMA 2WJHA 3TIGA 2RG1A 3HLTA 1VBKA 1E5DA 4BKOA 4ACAA 3EXFB 4YGYA 3TXAA 4CKBB 1QNLA 5FDFA 1YGPA 3COYA 3TR6A 2G9UA 4ABTA 2JIRA 1N6RA 2NU8B 3IUPA 1L5WA 2FEOA 1AHNA 2PGIA 1LLUA 5IHPA 3W7VA 5KYWA 4FFMA 3EMVA 1BE0A 3CR7A 3EQ7A 4LPSA 1GU1A 2Q6IA 1KI4A 5DCYA 1T6NA 1H9AA 3CR8A 3FB1A 3SU8A 5KDDA 2YTZA 4Q7LA 2AOTB 3ZCRA 5AJHA 2VJOA 4Y2SA 1GY8A 2IE8A 4YLYA 3RFCA 4BO3A 2CL5A 1E69A 4PPGA 3UB2A 1TKRA 3B6EA 4R1SA 1E6EA 3CSSA 2JCSA 2GEUA 1KMIY 3S7ZA 2MR5A 3FYUA 4B7CA 4UHEA 1P73A 2JZCA 3OWHA 4JKOA 5HOEA 3USZA 3L6DA 1XMQB 3K6SB 4YJKA 3EVEA 3I12A 2PUFA 1I36A 3ADDA 1HXHA 3WI7A 3U7GA 1VI2A 4GQAA 2PZJA 4IQFA 2J09A 5T8KA 3EZXA 5BPFA 2AWOA 1J99A 2CF5A 1PK8A 4XW2A 3NYWA 1Z0FA 3SXPA 5G1PA 2QY6A 1F0YA 1PDVA 4WDQA 3GLIA 3JRWA 4XVCA 1FPMA 1M3SA 2Z43A 2JHCA 3AI2A 4I9NA 4P34A 4D56A 4HEA1 3SC3A 3LTNC 1R0BA 3EC7A 2WMOB 4DGSA 3RSCA 1EU1A 5BUSA 4CMEA 3RIMA 3RADC 2KPOA 4RHUA 1HH4A 3AU9A 4L51A 5GONB 1LKZA 3GN2A 3QLUC 3TBKA 3JAWB 4H7HA 2GPWA 4WADA 1FF9A 4WOJA 3DEKA 3H4TA 1DC8A 1JFVA 3F7OA 3LDAA 4N1AA 5CFOA 2L2QA 5AK4A 2C2GA 4N49A 4IVNA 4PCLA 5COBA 4D3YA 4J4TA 3DEHA 1P8AA 1T4CA 4XOIA 5JWRA 4HAUA 2OYCA 3WQSB 4C0WA 4ROTA 1P0IA 3GRVA 1ML3A 1O08A 1U28C 3BWMA 5H80A 2GAFA 1G2OA 1Y9DA 2IU3A 3CPSA 3D5EA 1UT6A 3LVRE 4P93A 4RFSA 2BCEA 4ZOQI 2P41A 2A4KA 3HO8A 4M6WA 5CIYA 3F6CA 5CK5A 3V1UA 3HXOA 4HB4A 1VPDA 2WQ6A 2DRIA 1SHUX 4TUYF 4PPFA 1RQRA 1P1KA 1W48A 1Z4QA 2HN9A 1FFAA 2HSEA 3AIIA 4RMIA 4I55B 5BN4B 2UYCA 1RI4A 1CZOA 3H2BA 4J7AA 4WXPA 5LFAA 4JB8A 2QX9A 5DNCA 1OLOA 3OQ6A 3NAGA 2HF7A 5LJLA 3EY4A 3NRJA 5K4HA 3BMCA 2ZIWB 3Q9SA 3H8JA 1PD0A 5H70A 5KHAA 2WTBA 2ZJFA 4IFIA 4OA5A 3G9TA 1JEYA 1TAHA 4ZVSA 2Y1FA 3CGWA 1OBHA 2AX4A 4JJ8A 3D2LA 3CVXA 1RYHA 4AJKA 1O8BA 3FYTA 4YP7A 2V7GA 5KIAA 4OGWA 4MUAA 2Z0MA 5FNVB 3SQDA 2XWJI 4BVJA 3IODA 4WN3A 5K0NA 4Y18A 4CG2A 5L3SA 4K6FA 4AQDA 2ODNA 2P5TB 5A9TA 1SXQA 2W71A 3LWZA 1BYUA 5KYKA 2JPDA 1KK3A 1ACMA 3AJEA 1NLUA 1CZRA 4PZEA 3BWVA 2PUVA 2PKXA 3A04A 2JD0A 2JGRA 5FPHA 3W34A 2FPUA 3AUKA 3T35A 5K6AC 2N47A 3THRA 1AGNA 2X1VA 4O2LA 1HYHA 2RIRA 3KFXA 4GM1A 1UOPA 4P1ZA 3GNLA 4BB9A 1SOUA 2QQEA 1VPWA 2C97A 4JR1A 2EW1A 5EIBC 5EMHA 3T3IA 2J7KA 1VC2A 2F3TA 4I1IA 2HDHA 1KQPA 1OXBB 3ESXA 3JRNA 3KB8A 1FBNA 3GDWA 3GEEA 2X86A 4M9ZA 4EX6A 3IE1A 2QT9A 3ND6A 3IIJA 1Y63A 3VU9B 1Z9BA 4I1VA 1IY0A 1BKSB 2VCHA 2EWVA 5CDGA 4HDNB 1NVEA 1PO7A 1SVSA 3EDQA 1U80A 2ZJ0A 1K5DA 3DD5A 4KDFA 1TLTA 3I5MA 1ZCJA 5DNEA 1F5SA 3K16A 3PQ6A 4M37A 3C7KA 2X77A 1H5NA 1TEZA 2G9RA 3RT1A 3ODPA 3AU8A 1P5ZB 1OA1A 4TTJA 4QGSA 1N4AA 3NHUA 4GXTA 3HKDB 4ZEOA 2HXSA 3D4OA 1GQRA 3AHFA 3Q6IA 4KSBA 3ZV4A 1NMSA 4JI2B 1UPUA 1E6CA 1ZD1A 4FFVA 3IEMA 4Q4AB 4JVMA 1WRBA 1EQUA 1VE9A 5JE8A 4N4AA 2BFMA 2H00A 3DDHA 4E15A 3OA0A 4J2TA 5A06A 1XA0A 4A2PA 2XE8A 4P84A 1V37A 2Z5LA 4PFQA 1VMEA 3CF2A 2WMYA 2VDLB 1OWPA 3RC3A 1ODCA 1TUIA 2W6PA 2XTJA 1SJ9A 3GCGA 4FD3A 3TEMA 1R4ZA 1OFUA 1C0PA 2OZKA 4AJNA 5DDIP 5AVVA 3TRIA 1JJAA 1O96B 3GXBA 2J85A 4BCCA 4KRFA 1V2GA 1JXMA 1V1JA 3JCZA 3H4IA 2Z8ZA 1F5NA 4YUXA 4OQDA 4S04A 4NH0A 2YUIA 2PQMA 4LJYA 1M2NA 1U2SA 4A8PA 4Z9FA 2CYCA 3RQSA 1GTZA 2Q2QA 4IGFA 4LYYA 5BW8A 2RHCA 5F9HA 2P5YA 2FLVA 1DAEA 1NXVA 4E94A 4YMWA 5GV8A 2PAFA 1SU8A 3AHJA 3D8UA 1VM6A 4RMHA 5NULA 4EFLA 3KYDB 4NNOA 4EI2A 3EJ6A 4WZBA 2I8LA 4O59O 3W8EA 1W9MA 4F9FA 1DADA 3O31A 4JY7A 4Y7CA 2WIBA 2IQIA 3GOHA 5FWAA 2ISQA 3D6VA 4HCJA 3LUDA 4HJRA 4N5LA 4JI5B 3RNLA 3URKA 3ANYB 5K0BA 1O0CA 3FD8A 1U8FO 1WA5A 1JG2A 1TZ2A 4RSRA 4W63A 3IUBA 4MMZB 1AK1A 3NW9A 3S8EA 2HLHA 2ODAA 4YB8A 4EGQA 2EARA 4BYGA 1F2UA 1LPOA 1AGXA 1T8SA 5HMMA 5KBYA 3H7IA 4MLPA 2R4QA 2A67A 4XJVA 4B3TB 2OUKA 1YCDA 4QU9A 5GWXA 3G2LA 3C7DB 1ACJA 1KIAA 4NEGA 2WF9A 4PICA 4Q9JA 4J1QA 3W4JA 1PJ4A 2VWHA 4OA8A 3IRUA 4F6LA 2G1KA 7YASA 4BFSA 3Q72A 3MIIA 3UXEA 2Y9MB 1QQBA 5LCXA 1UK9A 1GTL1 3V97A 4DWVA 2ZWMA 1XZQA 5G0UA 5GAJA 1HDYA 8GPBA 2QJRA 1U2GA 4AO6A 3IXLA 1RYEA 1U7PA 2C4WA 3OCVA 2WNSA 1DZ3A 2AD1A 4BFYA 5KKCA 3Q8KA 4CM9D 1DAPA 3SZ3A 2B36A 1A7UA 2MSNA 3EQZA 5I7UA 4XSHA 4BO6A 2JFUA 4UEJA 4MGEA 4R68A 1DQPA 1I24A 4CHGA 1LLFA 2JIZA 3VZQA 1Q14A 1XZMA 3W2IA 2P9QA 1Q0QA 1WCXA 2OOKA 3T1NA 3CLVA 3R0JA 3GBPA 4PG6A 3MRSA 1A77A 1DJNA 1F8YA 4YY3B 4ZYZA 4B17A 3UVEA 3NYQA 3EPJA 1KIFA 3U7HB 3CZ5A 7MHTA 1XL1A 5ULLA 4OUDB 2AR7A 2JGAA 4QXPA 5JLAA 4G07A 3C43A 3HA2A 3LX5A 1YNSA 2IUEA 4O2AA 1NQUA 3SDBA 3ND8A 4BTLA 3U16A 3O4JA 1OSNA 2D0IA 2VZEA 2JF0A 3ZJVA 1TA0A 4LMPA 8LDHA 4AN1A 4PCVA 2MSLA 4O08A 5I47A 2VRBA 2X2EA 2GZ1A 2YV3A 5AK3A 4XD2A 3H5LA 3G23A 1S7GA 1Q0RA 1UIRA 5JO0A 1GJRA 1V7PC 2QTHA 1F8FA 3PF8A 1DBWA 5DB4A 1KRXA 1IAQA 3FPJA 3WRYC 3O21A 2H5EA 2VQ6A 1G0NA 2Y4OA 2J4CA 2WJ6A 4GMXA 2ZTMA 4PZDA 4QG7A 4C0QC 1OB2A 2HCTA 5JG7A 3EISA 4Z2YA 3VOBA 1Y3IA 2AFRA 3O0DA 3Q2IA 5TC4A 3ZD9A 5BV2P 2P3LA 2AN9A 4KLCA 4G6ZA 4G5OA 4DFDA 3ANTA 4LQ4A 2VTEA 4WZAE 2XLCA 4MMYB 1NQAO 2BMFA 5JFTA 2XB9A 1R66A 5EHXA 3QENA 3SF8A 3G8DA 4MV4A 3GFTA 3UANA 4YMVA 1GZDA 3GT0A 2YV2A 3FB4A 3ZGNA 4CEIA 3E82A 4KQGA 3TSZA 2VKQA 4UCXA 3WE7A 1MGOA 4QUJA 2A5JA 4OJNA 4TQ9A 3U4AA 4IOKA 2HSDA 4TT8A 3DFMA 3JAKB 3KAPA 2OFOA 3O82A 4H1TA 4RTQA 5K7SA 3H84A 1U02A 1PNQA 4LJRA 4AKSA 2GA8A 3ISVA 4M0LA 1V8ZA 4TRJA 2PUGA 3D6JA 1CDZA 3DMYA 1QAOA 4LHYA 4H08A 3WQBA 5TLSA 1I7DA 3VX4A 1Z74A 4Q6BA 4EP1A 5A1TA 3UOAB 4GM0A 2QAJA 4LSWA 4Y2UA 4YJ3B 5AR1A 5F3DA 1UJ4A 1GGKA 5BYAA 2AC4A 2ZYSA 3FR8A 4FYPA 4KQHA 1SQSA 4BLPA 4MKFA 4RV4A 4IUCS 5BQFA 1GG9A 4KO4S 3W5JA 1WD7A 3ZXUB 1A97A 2LR0A 1QR2A 3L01A 1IOVA 3DBRA 3SAJA 8ABPA 3DL4A 2QVXX 3QM1A 1NVMB 4NK4A 1CJBA 5JJKA 2EIHA 5F73A 3GA0A 3R3SA 4Q4HB 4NCBA 3H2ZA 2O8DA 4HNRA 2JFYA 1TYEB 5JI2E 3VPFA 4X1YA 2IYVA 3KXIA 1NUTA 2G25A 1Z4KA 4N0QA 1CUDA 3ABIA 3FKQA 4FE4A 3EDOA 4F6CA 1IQRA 4MX8A 3QG5A 2VP5A 2ZT6A 4KAFA 2OB1A 2BGIA 4ESOA 4YJFB 3VAYA 1Z39A 3TAXA 3AYZB 5JHGB 1K88A 4EKEA 5DVZA 3K35A 3KJQA 2BONA 4TRRA 3ZS8A 1IJEA 1F60A 3PFFA 4EA8A 2ADOA 2XWPA 1VL5A 2XOKA 4MP8A 3FKJA 3OO0A 4O4LF 1XCBA 1YDEA 4JI0B 2Y1LA 1HNNA 2GHQA 1EVIA 2IHVA 5DYGA 2YW2A 2Z5FA 4Z3DA 3H2JA 5EXSA 3TNDA 5L95A 2Y9PB 3Q3EA 4IDOA 2ZB3A 5J43A 4MZDA 5EJ7A 3ITDA 1UBHS 1PBTA 4HDMA 1NVUQ 1I0ZA 1N7HA 4FW9A 1B1AA 1GRVA 5D1NA 4CUKA 3B51X 3DTYA 2WFAA 2ZDGA 5D1HA 3RBXA 2FZ4A 1Y37A 2QQ0A 4KGDA 1BCSB 4EUSA 5BXQC 4N5IX 4ENRA 2WMDA 1SVLA 5KMGA 1XMIA 3ONFA 2Q27A 3P4XA 3WL3A 2ZT7A 4BP9A 1SU7A 4E21A 5A4DA 2B25A 1EAMA 1Q1EA 3HSSA 2B21A 1Z08A 1ILWA 1MJHA 5G2OA 3EPKA 3PUXA 5HKBA 1P2GA 4RVCA 4ZAVA 1TIKA 1W6UA 4F45A 1QFZA 4Q3AA 1SOAA 3TX6A 1CY4A 3UMGA 3MCZA 1BN7A 2XH8A 2Z6VA 4HLUA 4XD7D 5GPBA 3SYLA 3WBBA 5K45A 2Z2JA 4QU5A 4WSOA 3VNBA 2ZJBA 2UUBB 3RS9A 3N2IA 1GTRA 1GCAA 4JSTA 4MUEA 1U2ZA 4C6TB 2JKVA 3L7NA 3HBMA 3IJPA 2RKBA 3D81A 4DLLA 3L1HA 1NBEA 1V71A 1OY1A 4P80A 5EKXA 3ZHUA 1GFSA 1Q0PA 1X70A 2RHJA 4TN1A 1U6JA 4HAWA 2G1UA 1GNTA 1L7MA 1WG8A 2IEYA 4KWTA 1S8FA 2M6LA 3QV2A 1T8PA 4K9QA 3DQPA 4F9EA 3QXJA 3CXRA 3VH4A 3OPXA 1LB1B 4V0MA 2C04A 4MS1A 2EF1A 1LVGA 3V1YA 4OQMA 3LDGA 4GXQA 4ZJZA 5CA0A 4QPPA 4N0EA 5A02A 3JQGB 3COWA 5BYKA 5C34B 7AT1A 4TL9A 5JROA 3E27A 3JW8A 3N0RA 4UMDA 4RQAA 2IPNA 3G2QA 4XTCS 1Y42X 4MPRA 4OK6A 1UBRS 4MO2A 5LQUA 4JC5A 3PC2A 4QRHA 3VV2A 2K7ZA 3LLSA 4AAYA 4I4NA 3I5AA 1WCIA 4W9MC 4RD3A 4HRYA 3FLMA 4CKYA 4D46A 1X8LA 1M76A 4MS4A 3WGLA 4KXNA 1KSHA 1V3UA 1Y5RA 3H2IA 1SWVA 5D85A 2RHLA 2JS7A 1QYIA 4TKUB 4PIPA 3UFXB 4EKDA 5REQA 1PK7A 3ANNA 3DO8A 2EZUA 3OZCA 5F33A 5CRIA 1HRKA 1TLLA 5U4QA 3U6BA 3KZOA 5BR8B 4E1BA 4FB5A 4PYJA 1U1IA 3F1LA 3UMBA 5I7RA 5L6LB 2H1FA 4PYRA 4N6NA 3R5KA 2AOUB 1Z5OA 2GN8A 1E4EB 1XMPA 2D7JA 1LF5A 3HJBA 2NTNA 2Z1NA 4FEYA 5C2JB 2F00A 4LWZA 3MWFA 5GGXA 1N6HA 5CDFA 4ZYTA 5AW4A 4IRMA 3GLKA 3OZSA 3OZTA 4H7KA 3TG8A 4RV9A 4G1BA 4E5NA 4GOJA 4M21A 1CIPA 1L7PA 4P31A 1KBOA 2GH1A 1UPTA 4L15A 3RU3A 2H2WA 3WNQA 1IQ0A 2B3TA 3N7TA 4ZU1X 5CU7A 1BFKA 1SIUA 4B09A 2M6RA 4K8OA 9LDBA 4W5HA 1KFCB 3N0WA 4TROA 1M7GA 5JU6A 4XYMA 4OYYA 1AKTA 5CA1B 3NTLA 1EFTA 3Q8MA 3L8ZA 2F1RA 2H0QA 5CTJA 4ZDWA 1FYVA 1NFQA 5EQDA 4WIAA 3WIVA 1QO0D 1QIDA 1R5JA 2VSXA 4UZFA 3DWFA 4BP1A 1EUCB 3CN7A 2QI9C 5K9ZA 5KZMB 2XKJE 1DAGA 3ISJA 1L3BA 2NZYA 1RPNA 4LYJA 3ZCPA 2YJTD 2NM0A 1KOGA 2I99A 4UU1A 2D2EA 4RKEA 2VYQA 3X1XA 2RGBA 2QTTA 2C1XA 1E4OA 4EAQA 3AFOA 3GJXC 3QA3E 2P35A 3FDJA 3D4BA 5AKLA 1II0A 4X61A 4YRRA 3MWJA 4Z7OB 3RYTC 4M86A 1YA6A 4KPUB 2PCLA 1IY1A 1IULA 3OKAA 4XR4A 3KJFA 3N70A 4BWFB 4D74A 4QT4A 4V0LA 4URXR 3GGDA 1U6IA 1KMCA 1JAYA 2XT0A 1A9SA 3D8RA 1YQUA 3TOCA 4A6EA 1N5IA 4YMUA 4RXMA 3RRNA 3K1YA 3TRFA 3TD9A 4FDMA 4LYHA 1MAHA 4IUBS 3P2OA 3FSJX 2FG5A 3GBSA 4RXTA 3UZUA 1E96A 1L7DA 1AX9A 3EBOA 3QLVC 2ZRGA 3DBHB 3OCCA 1RABA 4BIMA 1AK2A 3FPKA 1GAEO 4B85A 4YAGA 1Q50A 1IU9A 3FNRA 2FX3A 4B4VA 1JJ7A 1FDOA 1P7VA 4DV0B 1KO7A 1EWYA 2VEDA 3AUJB 2FUEA 2L42A 5GOZA 1C8KA 1Y4DE 2ZWIA 4J1TA 3SJAA 2WICA 3SVTA 5EWJB 2NQ8A 3H2HA 3EEOA 2NSJA 4TX1A 2ZJOA 1F17A 3UJDA 4EY6A 3KQHA 1R0ZA 2Z8XA 3VMFA 5FUQA 4DLZA 3ZK8A 1DCFA 1JDSA 3AFHA 1MV5A 2AVDA 2F43A 1MVOA 1T0BA 3KE8A 2EDAA 2OG1A 3U3JA 3UXMA 3CHYA 3D59A 4G81A 1W4LA 3T1HB 3QFTA 3LO5A 2ONJA 4JJZA 3C6YA 3LGAA 4MVJP 4OFBA 4D9MA 3CNEA 2JFGA 1G4UR 2XYVA 3LE8A 1LW6E 2SKCA 4RPLA 4XTRA 1TRKA 2XUDA 2GTPA 4F3YA 3AR8A 4YQFA 3TB4A 4LX0A 4XCVA 3U3DA 4S05A 1GU7A 2AOVA 5LA6F 5BSMA 5LMUB 2VDRB 4QYWA 3RF7A 4LQLA 1FP4A 3P1JA 2AW3A 4BO7A 4DWJA 2HU5A 2YWXA 1GYQA 2GAOA 4XFDA 2C7PA 2GM4A 3OQBA 3IESA 3EUWA 5H82A 4EG1A 5I9NA 1XR3A 4JHXA 4KQ9A 2BBTA 3MTJA 1EHCA 3QEMB 4G4SP 1CLEA 4W1PA 1GYRA 4B6SA 1Z36A 1RWXA 2DHRA 2FN7A 3BMOA 4GMKA 3PQ4A 2HADA 3RKRA 2N75A 3R0VA 2XKBA 4WNAA 5C8YB 4G97A 2OA0A 2CMDA 2F7SA 1LSUA 2I5PO 1HFKA 4F4JA 3P9QA 2HWUA 4PLFA 4IHJB 2AN1A 2VWGA 3K9QO 2BUCA 4RD4A 2XOXA 5HOQA 4V38A 2WZDA 2XQGA 4ARIA 5I01A 3HDGA 5CURA 4JLSA 5CCXA 3H7AA 4XJXA 4OFXA 3A4IA 1Z29A 1UBLS 3GFFA 4EYGA 1F48A 1P7YA 3HJHA 2J9RA 5CVCA 2BFFA 4GU5A 4ARZB 5FUXA 5EIAA 2ZRCA 2FR1A 4R5MA 3T7DA 1UJ6A 4UMFA 1L7RA 3DLAA 2OQIA 1Y9EA 3GJSA 1JL3A 1HDCA 1FXWF 4GUAA 2VUIB 4KGXA 1D2CA 3K0KA 4PC1A 3S2GA 2LIPA 4GBED 3NHJA 4JLPA 3UQYS 2OBNA 3ZV3A 1TO1E 2BGTA 2MSDB 2VQSA 1KE2A 4W5NA 5AKGA 3LXMA 4CF7A 4NHEA 5F78A 5JRDS 2XY4A 3D31A 4Z3KA 1T8RA 1XD2A 1J7KA 4QOJA 2RSLA 4PZ0A 2QE6A 4KX5A 3AY3A 1LJLA 1ZI6A 4P3OA 1JKXA 2ZBFA 4CGZA 4F8YA 3BOSA 4F12A 3G5UA 4N82A 4JLMA 5D51S 2FEKA 3S44A 4AY5A 4DYHA 5EE9A 2WSLA 1Z4NA 5DBOA 1ULBA 2JFPA 2YV1A 2RDMA 3HG7A 1S2IA 4LZPA 4LAFA 4AF8A 4CMIA 4D45A 5FBLB 5BNWA 2YRXA 3ELYA 1UDWA 2GO7A 3PZBA 5TJHA 2JVKA 2B8JA 4PLTA 3G2MA 2BGJA 2BH9A 1Z8NA 1XEXA 3B2QA 4P3PA 3W04A 4ZMSA 4EH1A 2MMGA 2QQFA 2WWHA 2A6PA 1BX3A 4X8LA 2YMQA 3EFOA 1XCMA 1B73A 1XZCA 2GK3A 2WNHA 2ATXA 1Y1PA 2NO6A 4HAOA 1KOLA 3T38A 1Q0TA 3IQDB 2DB3A 1CVLA 1DKUA 4ALNA 1C5KA 4BO9A 4LTNA 3V2UA 3W9SA 5CLFA 3REFA 2WBLC 3SEAA 1IUOA 1PFKA 1YT5A 5DN6D 4AIIA 2PXXA 2BHRA 4BNGA 1ADBA 5BVGB 4CODB 3TUJC 3T5GA 4CLEA 1CFJA 1U04A 1K08A 3PWKA 3VPBA 1B14A 3H8WA 2ZDHA 3E18A 1WDLA 3VHQA 2JI4A 4WN9A 5J5AA 1G1AA 5CB4F 3K94A 3A8TA 1AB5A 1DC4A 1T13A 4MW2A 3QBDA 1U0NA 2C61A 2PZLA 4D26A 2WD7A 1IM2A 5K01A 1HEYA 3PG5A 1F7UA 2B69A 3WC4A 2VCYA 1C9DB 5ALLA 4GZ3A 4DSOA 4EOGA 1MG5A 2CYBA 4G36A 3ZKWA 4C06A 3R0IA 2LCQA 2O2EA 2R60A 2PH5A 2IPMA 4JLNA 4ETMA 3LWNA 1M2JA 1YZQA 4K1XA 5KX5A 3CONA 4KEAA 5LQNA 1QHSA 2FJ0A 4HQNA 4OP3A 2EXXA 3ZDXB 3FOZA 2G3YA 1ZR2A 3SHVA 4JQZA 4UTXA 5I3CA 1KI7A 2C3UA 4QBFA 4U2GA 3WLHA 1JECA 2Q2VA 1R8XA 3SSNA 1OUMA 2JB9A 3FJ1A 4E13A 3O83A 1RYNA 4MYDA 1SCKA 4RK0A 3NU1A 4CL2A 1RAFA 4LGVA 5CEJA 1Z7WA 3AL2A 4JROA 2JJMA 1GQOA 4FLFA 1QHHB 1L5YA 5DGTA 1AMNA 1R4NB 1T8TA 1NUPA 1YRLA 3L1UA 3TBFA 4V0NA 4Z9BA 5IM4A 1OFVA 1QHGA 3TZQA 4M99A 1CDOA 3BCUA 5NLLA 1V3TA 1X0VA 2DSTA 4PWYA 1M2FA 1DU4A 1WW2A 2CWDA 2I71A 5ALMA 2QIOA 2J9GA 1GPH1 3UUEA 5EUMA 3RRBA 2IEZA 1YL7A 4UM7A 2VHUA 5T67A 1J0EA 3CISA 4WFQA 4ALMA 1GUDA 3E03A 1K7CA 3MOIA 2OUIA 3Q8WA 1XZHA 3R1IA 3RYFA 3LLCA 3GRCA 3I9MA 3PFWO 3AUYA 2IUFA 3P0FA 2IHKA 1BJRE 4HX9A 4LHXA 4GYWA 2WF6A 5MN5A 4KR2A 2XW6A 4KLNA 4BFWA 1X80A 5F7JA 3IB6A 1HPLA 5BT8A 3JQRA 4V03A 3NVKI 1G5TA 5IKMA 2VQEB 4OFZA 1OIWA 2XE7A 5E9AA 1GV1A 1ONBA 2P2CA 2I67A 4DE5A 1QPZA 2C8VA 1XNGA 2GVDC 5JNUA 2PUCA 2PT5A 3TUZC 3FAKA 3IVRA 4MS3B 3CM0A 1PR5A 4R05A 1XJ0A 2NX2A 3BTUA 2WVGA 1RHQA 3ZCTA 4BMZA 5C8DA 1Z0KA 4TVBA 4DF3A 2Q6VA 1OLXA 1KO1A 3L0IB 3TDMA 2H8KA 3RRFA 5JYCA 2P5UA 2VP4A 4PSDA 4R6XA 5FLYA 2JFNA 4ICIA 1AIPA 2P69A 3LKZA 1CZLA 1ZD3A 3E5RA 3QKTA 3VV3A 4OU4A 4RIIA 5A6SB 3KBBA 3ZGOA 1U0RA 2AYZA 1EWRA 5CBKA 3A6KA 2D54A 5DT9A 2A5LA 3CY6A 3IP6A 3KZKA 4BX3A 2CVQA 1V43A 2GUWA 1GIAA 1W52X 3A6FA 1VCMA 2QRZA 2VOJA 4YRGA 1DC6A 1LBHA 1EDBA 1X7GA 1MT0A 4CEHA 4UCQA 1GG5A 4UQOA 1M1ZA 2ZJZA 1A9RA 3FXAA 1NW9B 5T41A 4DC0A 1C4XA 4BNTA 1NFRA 3MQ4A 4QVIA 3OCZA 4DEXA 3ZV5A 1FVFA 1FA9A 1V95A 1JVBA 2A5DA 3HWRA 2M2IA 4MOWA 4CQMB 4KG7A 1YE3A 4B81A 2GJAA 3GZJA 3IAFA 2WK1A 3NP7A 2C0PA 1IY2A 3CRZA 3EXFA 4CKBA 1M1UA 5E6RA 2H48A 3GAFA 2NU8A 1UCFA 1T2EA 1E2PA 1JDPA 1XRMA 1YR2A 2OP1A 2VSNA 5DNVA 2BFAA 2YHSA 3I3SR 3F6RA 3W5DA 2UVDA 1JKMA 1XNHA 4R1UA 2PKEA 3R3ZA 1KSFX 3T1TA 3W5IA 4BNWA 1JSCA 1SKYB 5E4YA 3HVIA 3IT1A 5K3CA 3WLPA 1IG3A 4GI1A 1BE6A 1H2ZA 3K0EA 3FYUC 4K6GA 5DHPA 2IQ5A 2OYSA 3IMGA 2EAUA 2QTCA 4ISCA 3KKQA 5LC1A 3VU0A 1P31A 2BLLA 4O8CA 1F38A 5SZJA 1N2ZA 3K6SA 4N40A 2AOWA 2B92A 4JIMA 3O1JC 3IILA 1MRNA 1D8TA 5DIZA 2XRZA 1VSUA 2XHEA 3HCDA 1G9TA 4FZVA 4YRFA 3T7JA 3EW9A 4HUJA 1R3UA 3VPGA 4F84A 1T15A 4AKHA 4CMEC 4RAQA 5KDOA 1PR0A 2MSWA 3H1PA 1WSDA 2PL5A 3PFGA 4IAOA 1RCFA 4NDZA 3MT8A 5JYEA 1B6RA 4MYTA 4RBNA 1BDIA 2GERA 4WAUA 1JJBA 1KZ7B 2H4ZA 1E0SA 1GKIA 3M8KA 5KNCD 4XM2A 5LDDC 4YK7A 1N75A 3ZV6A 1NQTA 2CLSA 3L7CA 4UHDA 3QGMA 1DP4A 2BRUA 2DUJA 1JG6A 2V6JA 1CRLA 4B71A 3TS1A 1E2BA 4Q24A 4ZAXA 1C1DB 2A84A 4MV0A 4NCAA 3FM9A 4DCNA 1F6DA 1QK3A 4BQQA 4OMFG 2FAXA 1PS9A 3Q12A 1ZUHA 3HKCB 4M0KA 5FTMA 4AO8A 4ATNA 4LYAA 3BX1A 5CFMA 1N5MA 4NZPA 3FHCB 5L40A 3GJ3A 1EVQA 1X1TA 2CJYA 2E55A 1YV9A 2RBKA 1YC2A 3AR9A 3HVJA 2FOLA 4YECA 2IYNA 4ZT7A 4I9UA 4YACA 3SS8A 3RVPA 3WOHA 3FROA 5CLJA 2G8NA 4DBVO 2A1TS 2OG2A 4DLTA 4I55A 4R51A 4UASA 1GD1O 5K2MA 4P4NA 2L69A 4KRGA 1SK8A 4JR0A 2JEOA 3L8MA 2D3WA 4HAVA 4X5OA 4U7TB 3UJPA 3ZHVA 4YDHB 3H83A 3A4MA 4NARA 3ADOA 4ZT2A 2Y0EA 3NMUF 1U0LA 1J0AA 5EERA 3ZHTA 1K6XA 2VJQA 1T2CA 2VFAA 3OH8A 4TYNA 2HA3A 5DXJA 5E1MA 2YIMA 4W7IA 3N6RA 4U6NA 4YJ2F 2WY2D 5ALNA 1HLPA 3MMSA 5FNVA 3SDSA 3STVA 2VSFA 5AK5A 4BLQA 3BRCA 1SXJC 2HWXA 3R3XA 4IHQA 3JD0A 2VA9A 1OKKD 1NOIA 1DIGA 2WSSA 2ZBDA 3BBLA 3L7KA 4OB6A 5DF1A 5IVIA 2NYRA 2QWXA 2DOKA 2ILVA 1A5ZA 2JJ2D 3NDJA 4KXLA 4OI0A 2PBZA 2VDQB 1PK9A 2OFWA 2XSZA 3DJFA 3EIQA 4PLCA 1V1RA 3CT6A 3CS3A 5GJVC 3TGWA 4GF5A 1USIA 2QT0A 1XE3A 1YR1A 3Q11A 4PAQA 4QLAA 5EIBD 1KEVA 2F59A 4KP7A 3NYIA 5JR3A 1ZHOA 3KFVA 4CDGA 1VRVA 5B1HA 2NP6A 3F4BA 3O8LA 3PEUA 2IXEA 2JEZA 4BC1A 3H5IA 2DTEA 3L4BA 2GOYA 4PAOA 4GPBA 4BN0A 5HQTA 4P5PA 4U7PB 2I62A 3AJ8A 3TW6A 5EP2A 2QD1A 4PLHA 5FUWA 2O2SA 1UPXA 1HI9A 1HDRA 5FQOA 2QNIA 3VU9A 1XN4A 3ZKAA 2NU6B 5DWQA 4HFJA 4HDNA 3WLLA 4BBPA 1K3FA 3VVCA 5JXJA 1OLUB 2I2XB 1I9CA 1ETUA 1LY1A 1W8IA 3JVDA 5DLYA 5F76A 4DA0A 1WSAA 4I6EA 3UKJA 1II8B 4MVJG 3DFIA 3ZDCA 2W6NA 3IPXA 2V0NA 4Q16A 3UT0A 4RD1A 3EUEA 3KT6A 2HEIA 2P9ZA 4BXOB 4HWKA 1GNLA 2HSJA 2H8GA 1P81A 2OV1A 1H6BA 2CUZA 4R2JA 3L6UA 3K0HA 3B1XA 3VUFA 5GJCA 1TQDA 5JEDA 1N0HA 2GM5A 5EE1A 4YAIA 1E1RA 1MENA 3PLRA 3L02A 2F48A 4LOHA 3TW4A 2FYTA 1AE1A 3EFEA 5JFOA 3WMEA 3QXSA 4TLLB 1XTRA 4ZAFA 1N6KA 2DWPA 4UZSA 5B4VA 3OQMA 3P4YA 2OQVA 1O96A 1Z5NA 2RD2A 3WFIA 5HKKD 2PXAA 3T5TA 4RVOA 4OI2A 1KYTA 3Q7SA 3AF5A 3H2SA 1SHLA 1RACA 2VRCD 2EP7A 3BFXA 5DIFA 4AG3A 1XTBA 3ABRB 5JMWA 3G02A 2WIKA 5FR2A 3ZY3A 1EDOA 5J2UF 3JWGA 3WGHA 2HA4A 5CCDA 1DBQA 4Y1RB 4IKOA 1ECFA 3K9LA 3WYNA 2NPFA 3ZHZA 1JA1A 4NMXB 2NUAB 2O2CA 3RAPR 2XZPA 3B48A 3ZU5A 3FNQA 2XTMA 1H85A 3SYMA 2F4VB 4IS2A 4FFOA 4Q66C 1SC1A 4AYXA 1HWYA 2NZ2A 2OK8A 3PGJA 4I4TB 3MGCA 3FWNA 3E2PA 4OXIA 3DEAA 4NV3A 2M98A 3WX0A 4QUEA 4D4IA 1OYOA 1THMA 3TD2A 4QRDA 2D0PB 1FJGB 4EGSA 4C6RA 2ATCA 3GP3A 3LVFO 3RABA 5HZKA 1N78A 5EE5B 1U7UA 1H8HA 2PGNA 2PIDA 3PEFA 4IO0A 2IHNA 5C5EA 4OQFA 4DEYA 2BHNA 1IIRA 1B6TA 1S2LA 3HY4A 5FUBA 1JIXA 3RFUA 3GUUA 4L5IA 4MV9A 3PGA1 4MW5A 1PX2A 1YF3A 1RYDA 1KH1A 1L7OA 4MAAA 3G59A 4RHYA 3D4LA 3Q2KA 4WOCA 4DB2A 3ZE8A 3AY6A 4YLEA 5C53B 1UJBA 2ZITA 1U2GC 1RRFA 4TLMB 5FTNA 3SKYA 1OBOA 3K1AA 2ZQYA 2ZYWX 2GLUA 5A0VA 4CMJA 2WUEA 3MPOA 3OX3A 1NI4B 3ZW9A 1VI5A 2G9VA 2XZTA 4QUGA 2PX2A 2Y67A 1UWKA 3CEHA 3W4KA 4EELA 2Q62A 1VL0A 4EA6A 1GAJA 3CE9A 3N9IA 4OM8A 4ZHSA 1JZTA 3LUJA 3OY7A 4LOLA 5B6JA 4LSGA 3BF8A 3IV9A 5F9MA 4CT0A 1V3QE 4Y2JA 2WT9A 1YQWA 5ALPA 5EAIA 1XPOA 4QTUB 2FPPB 4EHNA 1N0UA 3OVMA 1UMDB 4PYLA 1M8PA 1BH2A 3KKOA 4IIJF 3UEOA 4DUGA 1MX5A 2QSUA 4REMA 4YFYA 3R8CA 9ATCA 2A7QA 3KELA 2ZS8A 4K0KB 1CY7A 3C8ZA 4MP3A 3WL6A 3VHRA 3U7JA 4UE3S 1UODA 4TXMA 4EHFA 1TFRA 2ZUEA 4OUDA 3ORFA 1W0JA 1D9ZA 2QMOA 3O1IC 1W0CA 4FXOA 2P90A 4TKMA 4HNTA 4IKEA 4MVYA 1L7AA 3MAJA 4PXAA 3HZRA 3I8XA 1ULAA 1Y5NA 4EHKA 1FBTA 3GGOA 3JR3A 3O4FA 5AOBA 3AJAA 4R83A 4Y6OA 1C2YA 4IXWA 2WSBA 2AFHB 4J29A 5DM70 4RKFA 3H9BA 3EBLA 1JTEA 2J3DA 4C4RA 3QJ5A 6LDHA 3AP1A 4L0CA 2UZAA 4IX1A 3GJZA 4MGYR 4QA9A 3FWYA 2D8MA 5TMPA 1PEDA 2GPYA 4MWOA 4RD2A 1EE2A 1FTGA 2WV7A 4ND7A 4K03A 4MWEA 5CAEA 4J3JA 4UTNA 2XUHA 1NRIA 2B7BA 4N01A 4FKMA 1VXOA 3IO5A 1TI7A 3TJZA 1D04A 3GLHB 2O5RA 1TQ4A 2XB4A 3AJ9A 1VP3A 3ESDA 1WMAA 4JT9A 3AJDA 4Z4EA 1S2GA 2QLLA 3MTDA 5JALA 5GINE 4RTMA 1G7SA 3RODA 3M4YA 1U4NA 4DCTA 5KSWB 3OPYI 4K05A 3TX2A 1F8GA 5A4MS 4GKKB 3O3NB 4M1TA 2AFHE 3GGCA 4QJ4A 3PHLA 4XQGA 5LXTB 3OCWA 3NIWA 2OHJA 1QOPB 1ZC3A 2PYIA 4WDRA 4ZQGA 4DA7A 1PS0A 3E15A 3VZBA 1Z2DA 4DJ5X 2C07A 2VZ9A 1OILA 4TV8B 4AZ3A 2CHUA 3GX1A 3QIVA 3OTHA 3AI1A 3B5JA 3L07A 4J07A 5K09A 2BM0A 4BJ3A 2J87A 4IXDA 1NW8A 5E0KB 4DKXA 1QIIA 2Q2OA 5KSOA 1E6UA 3GLHE 1BDJA 3B89A 4IPTA 1N2JA 5DLDA 5JWOA 3RU7A 2PGLA 2CLHB 4LRQA 4NS1A 3LUFA 4YAOA 3I64A 4NBUA 1EGHA 3PSAA 2QK4A 2ZRAA 4MQEB 2Z9DA 3K1ZA 2O8EB 1S3FA 1ZKDA 3LPDA 4MRSA 1R0WA 3AP2A 3CXUA 1G59A 1S02A 5BN5A 2H06A 3G1TA 4NPCA 5CDTA 4M1SA 2JCVA 3L8CA 1ISHA 1NRWA 5BV7A 1JPJA 2AQHA 1XRRA 3QJGA 3RROA 1A5TA 2ZSUA 1WWKA 4LJ6A 4GC9A 4Y7DA 3RIHA 1BE8A 3K0AB 2QL7A 3T34A 2JH9A 2AWNA 2BTQA 2HJGA 5SYNA 1SQ0A 2RAVA 4GKBA 4ND6A 3NT4A 1H65A 4YJFA 4BQOA 4EPRA 3E58A 1ZOOA 1JDTA 1H69A 3HSKA 3AT1A 4KE8A 5AMXA 4UM5A 1UMBB 3VOAA 4KU4A 4IDBA 16PKA 3A3KA 3KEGA 5GQSA 4C0SA 1KVQA 4FJ0A 5KTSA 1RCTE 4QFDA 4CFZA 4YP5A 1Z7GA 3EGXA 4D9HA 1NF2A 2GTHA 5J3JA 4IP0A 5L7WA 3K05A 4UHCA 3K4QA 1C81A 4GSYA 1B0UA 3D3JA 4EEXA 1AMUA 5KJEA 3TTXA 4Z51A 1EBUA 3ORQA 3PKJA 2I03A 2QXYA 4HQ6A 5CG2A 2DHQA 2CV0A 1L5ZA 5A05A 1Z2EA 2OD7A 1T6XA 1X7ZB 2F17A 5C81A 3OU2A 1BCSA 5I7VA 3ONNA 1FTSA 4JHLA 4UOZA 4CLRA 5DOVA 2I66A 3PUHA 2O8CB 3N87A 3PICA 1J0XO 5A3SA 4DR5B 1T9GS 5C52B 2HGZA 5JZBA 4WW0A 1W5FA 1SEVA 2CMFA 4TKVB 3QNUA 1FFYA 1KZYC 1FP1D 3T0GA 4DQUA 3DAFA 4HLUC 1X1CA 4MQMA 4WACA 1DL5A 1EFRD 5IK2A 3DHYA 4Q12A 3L8DA 1F4PA 4EL5A 4NG4A 3DOJA 5HQ3B 4GVPA 3DAGA 2Y3IA 1WSBA 1N6OA 2H1HA 2I2CA 1BMFD 1R8SA 3CLRC 3P0RA 1B3RA 5B6IA 1HFEL 2D4HA 4QDTA 2WYOA 1PJ8A 4U8GA 4U5XA 3QVJA 4R40A 3WIUA 5A7HA 3SXUA 2WC1A 3DHWC 3JASA 3K72B 4ZO8A 3ZX4A 3P9KA 4V3CA 2XMZA 1VLMA 1ZWKA 2MSKA 3MAAC 1N3YA 3BE8A 1VHJA 1Q84A 2YWDA 3EVBA 3QE2A 2QY9A 2WKPA 3WMFA 3UPTA 1TLFA 1AH2A 4BNDA 2A1UB 1YB1A 4PYIA 1ZVKA 5L3RA 1XJ5A 1SUAA 2REQB 1ZN8A 3T7EA 3OFNA