2I6JA

Crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphate ion
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
161
structure length
161
Chain Sequence
MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGLQPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHCVGGIGRTGTILASYLILTEGLEVESAIDEVRLVRPGAVQTYEQEMFLLRVEGMRKSWLKNIYSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme-substrate interactions revealed by the crystal structures of the archaeal Sulfolobus PTP-fold phosphatase and its phosphopeptide complexes
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Sulfolobus solfataricus protein tyrosine phosphatase
total genus 64
structure length 161
sequence length 161
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2i6jA00
5I6VA 4BJOA 3OMHA 4BPCA 2OOQA 2C46A 4GE5A 2QBSA 1OHDA 1YPTA 5K9WA 4NWFA 1C88A 3QCEA 2CNGA 4JBCA 2P4DA 2VEVA 1ZCKA 2QBQA 1U26A 4GRZA 4NNDA 5EHRA 2I75A 2QEPA 4KI9A 2PT0A 2NZ6A 2B4SA 4NX8A 5BUGA 1BZCA 1J4XA 1Q6MA 1M3GA 3F81A 4QUMA 2CFVA 5HDEA 1PA9A 2YDUA 4R30A 4KYRA 2H03A 2BGEA 4ZI4A 3I36A 3QCMA 1G7GA 1PTVA 4GE6A 5LXQB 2I6JA 1Q6JA 2NLKA 1X24A 1ZCLA 4AZ1A 2CMCA 2BIJA 2I6PA 3AWGA 4QAHA 2B49A 4GFUA 3NMEA 3V0EA 2QDMA 4JMJA 1BZHA 2CMBA 4QBEA 2CM7A 2WGPA 1AAXA 4RH5A 5IBMA 1T4JA 2I4HA 2I4GA 2I6IA 3D44A 3O4UA 2FJNA 2DXPA 4D3PA 1YZ4A 4D3QA 1LARA 2AHSA 2VEUA 4R0SA 2I5XA 1G4US 4NWGA 3CM3A 1Q6NA 2F6FA 3F99A 2HC1A 5KA3A 3O5XA 5KADA 2PQ5A 3F9BA 1EEOA 2G6ZA 5M43A 3V0IA 5J8RA 2GWOA 3EMUA 3V0DA 5KABA 4H34A 5KA4A 4QUNA 1ECVA 4RHGA 4QBWA 4B04A 1L8KA 1WRMA 2BGDA 4Y2EA 2H4KA 1YWFA 4YR8B 2CM2A 3O4SA 5BZXA 3H2XA 2HC2A 2GP0A 4YAAA 4HJQA 3RZ2A 1T49A 3EB1A 2F6TA 1V3AA 1YTSA 1XXVA 2PI7A 2QCTA 3EZZA 2F6YA 1G1FA 3V0FA 3D1HA 1NZ7A 3ZM1A 3AWFA 5KA9A 1PA1A 3I7ZA 4WOHA 4OHLA 4JNBA 2CMAA 2VEXA 2MBCA 4RDDA 5KA2A 2AZRA 5K22A 4H1OA 3QKPA 2CM3A 2QDPA 2I1YA 3EU0A 4WU3A 2CJZA 1XXPA 3V0JA 2I6MA 4I8NA 1WCHA 3O4TA 3I80A 4TVVA 3LJ8A 2A8BA 2B4PA 2F6ZA 4OHEA 1ZZWA 3MOZA 1VHRA 1Q6TA 3ZMQA 3F41A 1U24A 2JJDA 1OETA 2QCJA 4GWFA 1NNYA 1XRIA 1I9TA 1G7FA 1U25A 3ZM3A 1QZ0A 2FJMA 3CWEA 4JMKA 4ICZA 2BV5A 1ZC0A 3SMEA 2F71A 1OESA 2Q05A 1R6HA 1A5YA 4RKKA 5BZZA 4RH9A 2PSZA 3AWEA 2I6OA 3QCFA 3RO1A 1NO6A 1PH0A 1G1GA 2BZLA 2VEYA 3S3FA 1I9SA 1G1HA 4WTYA 4OHIA 3QCDA 5K23A 4OHDA 1LQFA 3F9AA 1OHEA 2OZ5A 3EAXA 4GRYA 1PXHA 2F70A 2HNQA 3S3KA 2I42A 1JLNA 3QCHA 2F46A 3OLRA 3D9CA 5AWXA 1C83A 1LYVA 1FPZA 2ZMMA 4OHHA 1GWZA 2B07A 5KA8A 2NT2A 2HB1A 1RPMA 2CNFA 3RGQA 1PTUA 3D1QA 4RI4A 1OEMX 3BLTA 1L8GA 2HVLA 2E0TA 1OEUA 3S4EA 1C84A 5KA7A 2QBRA 1C87A 3QKQA 5K25A 3S3EA 1OEVA 5KACA 2GJTA 1Q6PA 4GFVA 4QAPA 2Q47A 4IKCA 2Y2FA 2ESBA 4ZRTA 1YN9A 3QCBA 1FPRA 2H02A 2NV5A 2FH7A 2PA5A 1RXDA 2J16A 1GFYA 2OUDA 1FQ1A 1JF7A 3GXHA 3V0HA 3ZM2A 3ZV2A 3ZMPA 1YGRA 2F6VA 1KAVA 2I3RA 4RI5A 4R0TA 3QCKA 2IMGA 2J16B 3A5JA 3D1OA 4KYQA 4GS0A 1SUGA 1T48A 5BX1A 3QCGA 1YTNA 5GTJA 1P15A 1QXKA 5EHPA 2B4UA 2R0BA 3PS5A 5K24A 2CNIA 2P6XA 3RGOA 2HNPA 3ZM0A 3MMJA 2B3OA 4S0GA 2C7SA 1Q6SA 2VEWA 4PVGA 1PTYA 3SR9A 2HXPA 3B7OA 3S4OA 1ONYA 1BZJA 1OEOX 2Y96A 1NWLA 2RF6A 1Q1MA 2ZN7A 1NL9A 4DGPA 5KAAA 3M4UA 2NT7A 2OC3A 2SHPA 2I4EA 1PTTA 3QCCA 2A3KA 4HRFA 2CNEA 2J17A 3QCJA 1YFOA 4HJPA 3S3HA 1NWEA 1XBOA 2CNHA 1G4WR 1C85A 1EENA 3A5KA 4ZN5A 1OHCA 4MBBA 5K9VA 3O3LA 4PYHA 1KAKA 1WAXA 3BM8A 3MOWA 1MKPA 3V0GA 4ERCA 4Z6BA 3BLUA 5IBSA 4D3RA 4J51A 1I57A 1ONZA 5MMZB 4WU2A 3GXGA 3BRHA 1PYNA 4GE2A 2G59A 4Y14A 3QCNA 2M3VA 3D42A 5KA0A 2H4GA 5KA1A 2HY3A 4NYHA 2H4VA 1XM2A 2QDCA 2F6WA 2QBPA 1D5RA 2H04A 2NTAA 3QCLA 1YTWA 2B4OA 2CM8A 1C86A 3U96A 3QCIA 2HCMA 4DGXA 1YGUA 3N0AA 2PBNA 2I3UA
chains in the Genus database with same CATH superfamily
5I6VA 1GG4A 4BJOA 5A5FA 3UAGA 3OMHA 4BPCA 2OOQA 2C46A 4GE5A 2QBSA 1OHDA 1YPTA 5K9WA 2F00A 4NWFA 1C88A 3QCEA 2CNGA 4JBCA 2P4DA 2VEVA 2UUOA 1ZCKA 2QBQA 1U26A 4GRZA 4NNDA 5EHRA 2I75A 2QEPA 4KI9A 2PT0A 2NZ6A 2B4SA 1P31A 4NX8A 5BUGA 1BZCA 2AM1A 1J4XA 1Q6MA 4HV4A 5A5EA 1M3GA 3F81A 4QUMA 2CFVA 5HDEA 3ZL8A 1W7KA 1PA9A 2UUPA 2YDUA 4R30A 4KYRA 2H03A 2BGEA 4ZI4A 3I36A 3QCMA 1G7GA 4CVLA 1PTVA 4GE6A 5LXQB 2I6JA 1Q6JA 2NLKA 1X24A 1ZCLA 2GC6A 4AZ1A 2CMCA 2BIJA 2I6PA 3AWGA 4QAHA 2B49A 4GFUA 3NMEA 3V0EA 2QDMA 4JMJA 1BZHA 2CMBA 4QBEA 2CM7A 2WGPA 1AAXA 4RH5A 5IBMA 1EEHA 1T4JA 2I4HA 2I4GA 3O4UA 3D44A 2I6IA 2FJNA 4ZIYA 1O5ZA 2DXPA 4D3PA 1YZ4A 4D3QA 1LARA 2AHSA 2VEUA 4R0SA 2I5XA 1G4US 4NWGA 3CM3A 2X5OA 1Q6NA 2F6FA 3F99A 2HC1A 5KA3A 3O5XA 5KADA 2PQ5A 3F9BA 1EEOA 2G6ZA 2Y66A 5M43A 3V0IA 5J8RA 2GWOA 1UAGA 3EMUA 3V0DA 5KABA 4H34A 5KA4A 4QUNA 1ECVA 4RHGA 4QBWA 1E0DA 4B04A 1L8KA 1WRMA 2BGDA 4Y2EA 3HN7A 2H4KA 1YWFA 4YR8B 2CM2A 4CVMA 3N2AA 3O4SA 5BZXA 3H2XA 2HC2A 1P3DA 2GP0A 4YAAA 4HJQA 3RZ2A 1T49A 3EB1A 2F6TA 1V3AA 1YTSA 1XXVA 2PI7A 2XJAA 2QCTA 3EZZA 2F6YA 1G1FA 3V0FA 3D1HA 1NZ7A 2WTZA 3ZM1A 3AWFA 5KA9A 1PA1A 3I7ZA 4WOHA 4OHLA 4JNBA 2CMAA 2VEXA 2MBCA 4RDDA 5KA2A 2AZRA 5K22A 4H1OA 3QKPA 2CM3A 2QDPA 2I1YA 3EU0A 4WU3A 2CJZA 1XXPA 3V0JA 2I6MA 4I8NA 1WCHA 3O4TA 3I80A 4TVVA 3LJ8A 2GCAA 2A8BA 2AM2A 2B4PA 2F6ZA 4OHEA 1ZZWA 3MOZA 1VHRA 1Q6TA 3ZMQA 3F41A 1U24A 2JJDA 1OETA 2QCJA 4GWFA 1NNYA 1XRIA 1I9TA 2GCBA 1G7FA 1U25A 3ZM3A 1QZ0A 2FJMA 1E8CA 3CWEA 4JMKA 4ICZA 2BV5A 3ZM5A 1ZC0A 3SMEA 2F71A 1OESA 2Q05A 4BUBA 1JBVA 1R6HA 1A5YA 4RKKA 5BZZA 4RH9A 2PSZA 3AWEA 2I6OA 3QCFA 3MVNA 3RO1A 1NO6A 1PH0A 1G1GA 2BZLA 2VEYA 3S3FA 1I9SA 1G1HA 4WTYA 4OHIA 3QCDA 2XPCA 5K23A 4OHDA 1LQFA 3F9AA 1OHEA 3PYZA 2OZ5A 3EAXA 4GRYA 1PXHA 2F70A 2GC5A 2HNQA 3S3KA 2Y1OA 2I42A 1JLNA 3QCHA 2F46A 3OLRA 3D9CA 5AWXA 1C83A 1LYVA 1JBWA 1FPZA 2ZMMA 4OHHA 1GWZA 2B07A 5KA8A 2NT2A 2HB1A 1RPMA 2CNFA 3RGQA 1GQYA 1PTUA 3D1QA 4RI4A 4C12A 1OEMX 3BLTA 1L8GA 2HVLA 2E0TA 1OEUA 3S4EA 1C84A 2JFFA 2UAGA 5KA7A 2QBRA 1C87A 3QKQA 5K25A 4BUCA 3S3EA 1OEVA 5KACA 2GJTA 1Q6PA 4GFVA 4QAPA 2Q47A 4IKCA 2Y2FA 2WJPA 2ESBA 4ZRTA 1YN9A 3QCBA 1FPRA 2H02A 2NV5A 2FH7A 2PA5A 1RXDA 2J16A 1GFYA 2OUDA 1FQ1A 1JF7A 3GXHA 3V0HA 3ZM2A 3ZV2A 1W78A 3ZMPA 1YGRA 2F6VA 1KAVA 2VTDA 2I3RA 4RI5A 4R0TA 3QCKA 2IMGA 2J16B 3A5JA 4CVKA 3D1OA 4KYQA 4GS0A 1SUGA 1T48A 5BX1A 3QCGA 1YTNA 3NRSA 5GTJA 1P15A 1QXKA 5EHPA 2B4UA 2R0BA 3PS5A 3LK7A 5K24A 2CNIA 2P6XA 4QDIA 3RGOA 2HNPA 3ZM0A 3MMJA 2B3OA 4S0GA 2C7SA 1Q6SA 2VEWA 2Y68A 4PVGA 1PTYA 3SR9A 2HXPA 3B7OA 3S4OA 1ONYA 1BZJA 1OEOX 4C13A 2Y96A 1NWLA 2RF6A 3ZM6A 1Q1MA 2ZN7A 1NL9A 1GQQA 4DGPA 5KAAA 3M4UA 2NT7A 2OC3A 2SHPA 2I4EA 1J6UA 1PTTA 3QCCA 2A3KA 4HRFA 2CNEA 2J17A 3QCJA 1YFOA 4HJPA 3S3HA 3QCZA 1NWEA 4QF5A 1XBOA 2CNHA 1G4WR 1C85A 1EENA 2VORA 3A5KA 1OHCA 4MBBA 4ZN5A 2VTEA 5K9VA 3O3LA 4PYHA 1KAKA 1WAXA 3BM8A 3MOWA 1MKPA 3V0GA 4ERCA 4Z6BA 3BLUA 5IBSA 4D3RA 4J51A 1I57A 1ONZA 5MMZB 4WU2A 3GXGA 3BRHA 1PYNA 4GE2A 2G59A 4Y14A 4UAGA 3QCNA 2M3VA 3D42A 5KA0A 2H4GA 5KA1A 2HY3A 4NYHA 2H4VA 1XM2A 2QDCA 2F6WA 2QBPA 2JFGA 2VOSA 1D5RA 2H04A 2NTAA 2B4OA 1YTWA 3QCLA 2CM8A 1C86A 3U96A 2Y67A 3QCIA 2HCMA 2JFHA 4DGXA 1FGSA 1YGUA 3N0AA 2PBNA 2I3UA
chains in the Genus database with same CATH topology
5I6VA 4BJOA 3OMHA 4BPCA 2OOQA 2C46A 4GE5A 2QBSA 1OHDA 1YPTA 5K9WA 4NWFA 1C88A 3QCEA 2CNGA 4JBCA 2P4DA 2VEVA 1ZCKA 2QBQA 1U26A 4GRZA 4NNDA 5EHRA 2I75A 2QEPA 4KI9A 2PT0A 2NZ6A 2B4SA 4NX8A 5BUGA 1BZCA 1J4XA 1Q6MA 1M3GA 3F81A 4QUMA 2CFVA 5HDEA 1PA9A 2YDUA 4R30A 4KYRA 2H03A 2BGEA 4ZI4A 3I36A 3QCMA 1G7GA 1PTVA 4GE6A 5LXQB 2I6JA 1Q6JA 2NLKA 1X24A 1ZCLA 4AZ1A 2CMCA 2BIJA 2I6PA 3AWGA 4QAHA 2B49A 4GFUA 3NMEA 3V0EA 2QDMA 4JMJA 1BZHA 2CMBA 4QBEA 2CM7A 2WGPA 1AAXA 4RH5A 5IBMA 1T4JA 2I4HA 2I4GA 2I6IA 3D44A 3O4UA 2FJNA 2DXPA 4D3PA 1YZ4A 4D3QA 1LARA 2AHSA 2VEUA 4R0SA 2I5XA 1G4US 4NWGA 3CM3A 1Q6NA 2F6FA 3F99A 2HC1A 5KA3A 3O5XA 5KADA 2PQ5A 3F9BA 1EEOA 2G6ZA 5M43A 3V0IA 5J8RA 2GWOA 3EMUA 3V0DA 5KABA 4H34A 5KA4A 4QUNA 1ECVA 4RHGA 4QBWA 4B04A 1L8KA 1WRMA 2BGDA 4Y2EA 2H4KA 1YWFA 4YR8B 2CM2A 3O4SA 5BZXA 3H2XA 2HC2A 2GP0A 4YAAA 4HJQA 3RZ2A 1T49A 3EB1A 2F6TA 1V3AA 1YTSA 1XXVA 2PI7A 2QCTA 3EZZA 2F6YA 1G1FA 3V0FA 3D1HA 1NZ7A 3ZM1A 3AWFA 5KA9A 1PA1A 3I7ZA 4WOHA 4OHLA 4JNBA 2CMAA 2VEXA 2MBCA 4RDDA 5KA2A 2AZRA 5K22A 4H1OA 3QKPA 2CM3A 2QDPA 2I1YA 3EU0A 4WU3A 2CJZA 1XXPA 3V0JA 2I6MA 4I8NA 1WCHA 3O4TA 3I80A 4TVVA 3LJ8A 2A8BA 2B4PA 2F6ZA 4OHEA 1ZZWA 3MOZA 1VHRA 1Q6TA 3ZMQA 3F41A 1U24A 2JJDA 1OETA 2QCJA 4GWFA 1NNYA 1XRIA 1I9TA 1G7FA 1U25A 3ZM3A 1QZ0A 2FJMA 3CWEA 4JMKA 4ICZA 2BV5A 1ZC0A 3SMEA 2F71A 1OESA 2Q05A 1R6HA 1A5YA 4RKKA 5BZZA 4RH9A 2PSZA 3AWEA 2I6OA 3QCFA 3RO1A 1NO6A 1PH0A 1G1GA 2BZLA 2VEYA 3S3FA 1I9SA 1G1HA 4WTYA 4OHIA 3QCDA 5K23A 4OHDA 1LQFA 3F9AA 1OHEA 2OZ5A 3EAXA 4GRYA 1PXHA 2F70A 2HNQA 3S3KA 2I42A 1JLNA 3QCHA 2F46A 3OLRA 3D9CA 5AWXA 1C83A 1LYVA 1FPZA 2ZMMA 4OHHA 1GWZA 2B07A 5KA8A 2NT2A 2HB1A 1RPMA 2CNFA 3RGQA 1PTUA 3D1QA 4RI4A 1OEMX 3BLTA 1L8GA 2HVLA 2E0TA 1OEUA 3S4EA 1C84A 5KA7A 2QBRA 1C87A 3QKQA 5K25A 3S3EA 1OEVA 5KACA 2GJTA 1Q6PA 4GFVA 4QAPA 2Q47A 4IKCA 2Y2FA 2ESBA 4ZRTA 1YN9A 3QCBA 1FPRA 2H02A 2NV5A 2FH7A 2PA5A 1RXDA 2J16A 1GFYA 2OUDA 1FQ1A 1JF7A 3GXHA 3V0HA 3ZM2A 3ZV2A 3ZMPA 1YGRA 2F6VA 1KAVA 2I3RA 4RI5A 4R0TA 3QCKA 2IMGA 2J16B 3A5JA 3D1OA 4KYQA 4GS0A 1SUGA 1T48A 5BX1A 3QCGA 1YTNA 5GTJA 1P15A 1QXKA 5EHPA 2B4UA 2R0BA 3PS5A 5K24A 2CNIA 2P6XA 3RGOA 2HNPA 3ZM0A 3MMJA 2B3OA 4S0GA 2C7SA 1Q6SA 2VEWA 4PVGA 1PTYA 3SR9A 2HXPA 3B7OA 3S4OA 1ONYA 1BZJA 1OEOX 2Y96A 1NWLA 2RF6A 1Q1MA 2ZN7A 1NL9A 4DGPA 5KAAA 3M4UA 2NT7A 2OC3A 2SHPA 2I4EA 1PTTA 3QCCA 2A3KA 4HRFA 2CNEA 2J17A 3QCJA 1YFOA 4HJPA 3S3HA 1NWEA 1XBOA 2CNHA 1G4WR 1C85A 1EENA 3A5KA 4ZN5A 1OHCA 4MBBA 5K9VA 3O3LA 4PYHA 1KAKA 1WAXA 3BM8A 3MOWA 1MKPA 3V0GA 4ERCA 4Z6BA 3BLUA 5IBSA 4D3RA 4J51A 1I57A 1ONZA 5MMZB 4WU2A 3GXGA 3BRHA 1PYNA 4GE2A 2G59A 4Y14A 3QCNA 2M3VA 3D42A 5KA0A 2H4GA 5KA1A 2HY3A 4NYHA 2H4VA 1XM2A 2QDCA 2F6WA 2QBPA 1D5RA 2H04A 2NTAA 3QCLA 1YTWA 2B4OA 2CM8A 1C86A 3U96A 3QCIA 2HCMA 4DGXA 1YGUA 3N0AA 2PBNA 2I3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I6V A;  4BJO A;  3OMH A;  4BPC A;  2OOQ A;  2C46 A;  4GE5 A;  2QBS A;  1OHD A;  1YPT A;  5K9W A;  4NWF A;  1C88 A;  3QCE A;  2CNG A;  4JBC A;  2P4D A;  2VEV A;  1ZCK A;  2QBQ A;  1U26 A;  4GRZ A;  4NND A;  5EHR A;  2I75 A;  2QEP A;  4KI9 A;  2PT0 A;  2NZ6 A;  2B4S A;  4NX8 A;  5BUG A;  1BZC A;  1J4X A;  1Q6M A;  1M3G A;  3F81 A;  4QUM A;  2CFV A;  5HDE A;  1PA9 A;  2YDU A;  4R30 A;  4KYR A;  2H03 A;  2BGE A;  4ZI4 A;  3I36 A;  3QCM A;  1G7G A;  1PTV A;  4GE6 A;  5LXQ B;  2I6J A;  1Q6J A;  2NLK A;  1X24 A;  1ZCL A;  4AZ1 A;  2CMC A;  2BIJ A;  2I6P A;  3AWG A;  4QAH A;  2B49 A;  4GFU A;  3NME A;  3V0E A;  2QDM A;  4JMJ A;  1BZH A;  2CMB A;  4QBE A;  2CM7 A;  2WGP A;  1AAX A;  4RH5 A;  5IBM A;  1T4J A;  2I4H A;  2I4G A;  2I6I A;  3D44 A;  3O4U A;  2FJN A;  2DXP A;  4D3P A;  1YZ4 A;  4D3Q A;  1LAR A;  2AHS A;  2VEU A;  4R0S A;  2I5X A;  1G4U S;  4NWG A;  3CM3 A;  1Q6N A;  2F6F A;  3F99 A;  2HC1 A;  5KA3 A;  3O5X A;  5KAD A;  2PQ5 A;  3F9B A;  1EEO A;  2G6Z A;  5M43 A;  3V0I A;  5J8R A;  2GWO A;  3EMU A;  3V0D A;  5KAB A;  4H34 A;  5KA4 A;  4QUN A;  1ECV A;  4RHG A;  4QBW A;  4B04 A;  1L8K A;  1WRM A;  2BGD A;  4Y2E A;  2H4K A;  1YWF A;  4YR8 B;  2CM2 A;  3O4S A;  5BZX A;  3H2X A;  2HC2 A;  2GP0 A;  4YAA A;  4HJQ A;  3RZ2 A;  1T49 A;  3EB1 A;  2F6T A;  1V3A A;  1YTS A;  1XXV A;  2PI7 A;  2QCT A;  3EZZ A;  2F6Y A;  1G1F A;  3V0F A;  3D1H A;  1NZ7 A;  3ZM1 A;  3AWF A;  5KA9 A;  1PA1 A;  3I7Z A;  4WOH A;  4OHL A;  4JNB A;  2CMA A;  2VEX A;  2MBC A;  4RDD A;  5KA2 A;  2AZR A;  5K22 A;  4H1O A;  3QKP A;  2CM3 A;  2QDP A;  2I1Y A;  3EU0 A;  4WU3 A;  2CJZ A;  1XXP A;  3V0J A;  2I6M A;  4I8N A;  1WCH A;  3O4T A;  3I80 A;  4TVV A;  3LJ8 A;  2A8B A;  2B4P A;  2F6Z A;  4OHE A;  1ZZW A;  3MOZ A;  1VHR A;  1Q6T A;  3ZMQ A;  3F41 A;  1U24 A;  2JJD A;  1OET A;  2QCJ A;  4GWF A;  1NNY A;  1XRI A;  1I9T A;  1G7F A;  1U25 A;  3ZM3 A;  1QZ0 A;  2FJM A;  3CWE A;  4JMK A;  4ICZ A;  2BV5 A;  1ZC0 A;  3SME A;  2F71 A;  1OES A;  2Q05 A;  1R6H A;  1A5Y A;  4RKK A;  5BZZ A;  4RH9 A;  2PSZ A;  3AWE A;  2I6O A;  3QCF A;  3RO1 A;  1NO6 A;  1PH0 A;  1G1G A;  2BZL A;  2VEY A;  3S3F A;  1I9S A;  1G1H A;  4WTY A;  4OHI A;  3QCD A;  5K23 A;  4OHD A;  1LQF A;  3F9A A;  1OHE A;  2OZ5 A;  3EAX A;  4GRY A;  1PXH A;  2F70 A;  2HNQ A;  3S3K A;  2I42 A;  1JLN A;  3QCH A;  2F46 A;  3OLR A;  3D9C A;  5AWX A;  1C83 A;  1LYV A;  1FPZ A;  2ZMM A;  4OHH A;  1GWZ A;  2B07 A;  5KA8 A;  2NT2 A;  2HB1 A;  1RPM A;  2CNF A;  3RGQ A;  1PTU A;  3D1Q A;  4RI4 A;  1OEM X;  3BLT A;  1L8G A;  2HVL A;  2E0T A;  1OEU A;  3S4E A;  1C84 A;  5KA7 A;  2QBR A;  1C87 A;  3QKQ A;  5K25 A;  3S3E A;  1OEV A;  5KAC A;  2GJT A;  1Q6P A;  4GFV A;  4QAP A;  2Q47 A;  4IKC A;  2Y2F A;  2ESB A;  4ZRT A;  1YN9 A;  3QCB A;  1FPR A;  2H02 A;  2NV5 A;  2FH7 A;  2PA5 A;  1RXD A;  2J16 A;  1GFY A;  2OUD A;  1FQ1 A;  1JF7 A;  3GXH A;  3V0H A;  3ZM2 A;  3ZV2 A;  3ZMP A;  1YGR A;  2F6V A;  1KAV A;  2I3R A;  4RI5 A;  4R0T A;  3QCK A;  2IMG A;  2J16 B;  3A5J A;  3D1O A;  4KYQ A;  4GS0 A;  1SUG A;  1T48 A;  5BX1 A;  3QCG A;  1YTN A;  5GTJ A;  1P15 A;  1QXK A;  5EHP A;  2B4U A;  2R0B A;  3PS5 A;  5K24 A;  2CNI A;  2P6X A;  3RGO A;  2HNP A;  3ZM0 A;  3MMJ A;  2B3O A;  4S0G A;  2C7S A;  1Q6S A;  2VEW A;  4PVG A;  1PTY A;  3SR9 A;  2HXP A;  3B7O A;  3S4O A;  1ONY A;  1BZJ A;  1OEO X;  2Y96 A;  1NWL A;  2RF6 A;  1Q1M A;  2ZN7 A;  1NL9 A;  4DGP A;  5KAA A;  3M4U A;  2NT7 A;  2OC3 A;  2SHP A;  2I4E A;  1PTT A;  3QCC A;  2A3K A;  4HRF A;  2CNE A;  2J17 A;  3QCJ A;  1YFO A;  4HJP A;  3S3H A;  1NWE A;  1XBO A;  2CNH A;  1G4W R;  1C85 A;  1EEN A;  3A5K A;  4ZN5 A;  1OHC A;  4MBB A;  5K9V A;  3O3L A;  4PYH A;  1KAK A;  1WAX A;  3BM8 A;  3MOW A;  1MKP A;  3V0G A;  4ERC A;  4Z6B A;  3BLU A;  5IBS A;  4D3R A;  4J51 A;  1I57 A;  1ONZ A;  5MMZ B;  4WU2 A;  3GXG A;  3BRH A;  1PYN A;  4GE2 A;  2G59 A;  4Y14 A;  3QCN A;  2M3V A;  3D42 A;  5KA0 A;  2H4G A;  5KA1 A;  2HY3 A;  4NYH A;  2H4V A;  1XM2 A;  2QDC A;  2F6W A;  2QBP A;  1D5R A;  2H04 A;  2NTA A;  3QCL A;  1YTW A;  2B4O A;  2CM8 A;  1C86 A;  3U96 A;  3QCI A;  2HCM A;  4DGX A;  1YGU A;  3N0A A;  2PBN A;  2I3U A; 
#chains in the Genus database with same CATH topology
 5I6V A;  1GG4 A;  4BJO A;  5A5F A;  3UAG A;  3OMH A;  4BPC A;  2OOQ A;  2C46 A;  4GE5 A;  2QBS A;  1OHD A;  1YPT A;  5K9W A;  2F00 A;  4NWF A;  1C88 A;  3QCE A;  2CNG A;  4JBC A;  2P4D A;  2VEV A;  2UUO A;  1ZCK A;  2QBQ A;  1U26 A;  4GRZ A;  4NND A;  5EHR A;  2I75 A;  2QEP A;  4KI9 A;  2PT0 A;  2NZ6 A;  2B4S A;  1P31 A;  4NX8 A;  5BUG A;  1BZC A;  2AM1 A;  1J4X A;  1Q6M A;  4HV4 A;  5A5E A;  1M3G A;  3F81 A;  4QUM A;  2CFV A;  5HDE A;  3ZL8 A;  1W7K A;  1PA9 A;  2UUP A;  2YDU A;  4R30 A;  4KYR A;  2H03 A;  2BGE A;  4ZI4 A;  3I36 A;  3QCM A;  1G7G A;  4CVL A;  1PTV A;  4GE6 A;  5LXQ B;  2I6J A;  1Q6J A;  2NLK A;  1X24 A;  1ZCL A;  2GC6 A;  4AZ1 A;  2CMC A;  2BIJ A;  2I6P A;  3AWG A;  4QAH A;  2B49 A;  4GFU A;  3NME A;  3V0E A;  2QDM A;  4JMJ A;  1BZH A;  2CMB A;  4QBE A;  2CM7 A;  2WGP A;  1AAX A;  4RH5 A;  5IBM A;  1EEH A;  1T4J A;  2I4H A;  2I4G A;  3O4U A;  3D44 A;  2I6I A;  2FJN A;  4ZIY A;  1O5Z A;  2DXP A;  4D3P A;  1YZ4 A;  4D3Q A;  1LAR A;  2AHS A;  2VEU A;  4R0S A;  2I5X A;  1G4U S;  4NWG A;  3CM3 A;  2X5O A;  1Q6N A;  2F6F A;  3F99 A;  2HC1 A;  5KA3 A;  3O5X A;  5KAD A;  2PQ5 A;  3F9B A;  1EEO A;  2G6Z A;  2Y66 A;  5M43 A;  3V0I A;  5J8R A;  2GWO A;  1UAG A;  3EMU A;  3V0D A;  5KAB A;  4H34 A;  5KA4 A;  4QUN A;  1ECV A;  4RHG A;  4QBW A;  1E0D A;  4B04 A;  1L8K A;  1WRM A;  2BGD A;  4Y2E A;  3HN7 A;  2H4K A;  1YWF A;  4YR8 B;  2CM2 A;  4CVM A;  3N2A A;  3O4S A;  5BZX A;  3H2X A;  2HC2 A;  1P3D A;  2GP0 A;  4YAA A;  4HJQ A;  3RZ2 A;  1T49 A;  3EB1 A;  2F6T A;  1V3A A;  1YTS A;  1XXV A;  2PI7 A;  2XJA A;  2QCT A;  3EZZ A;  2F6Y A;  1G1F A;  3V0F A;  3D1H A;  1NZ7 A;  2WTZ A;  3ZM1 A;  3AWF A;  5KA9 A;  1PA1 A;  3I7Z A;  4WOH A;  4OHL A;  4JNB A;  2CMA A;  2VEX A;  2MBC A;  4RDD A;  5KA2 A;  2AZR A;  5K22 A;  4H1O A;  3QKP A;  2CM3 A;  2QDP A;  2I1Y A;  3EU0 A;  4WU3 A;  2CJZ A;  1XXP A;  3V0J A;  2I6M A;  4I8N A;  1WCH A;  3O4T A;  3I80 A;  4TVV A;  3LJ8 A;  2GCA A;  2A8B A;  2AM2 A;  2B4P A;  2F6Z A;  4OHE A;  1ZZW A;  3MOZ A;  1VHR A;  1Q6T A;  3ZMQ A;  3F41 A;  1U24 A;  2JJD A;  1OET A;  2QCJ A;  4GWF A;  1NNY A;  1XRI A;  1I9T A;  2GCB A;  1G7F A;  1U25 A;  3ZM3 A;  1QZ0 A;  2FJM A;  1E8C A;  3CWE A;  4JMK A;  4ICZ A;  2BV5 A;  3ZM5 A;  1ZC0 A;  3SME A;  2F71 A;  1OES A;  2Q05 A;  4BUB A;  1JBV A;  1R6H A;  1A5Y A;  4RKK A;  5BZZ A;  4RH9 A;  2PSZ A;  3AWE A;  2I6O A;  3QCF A;  3MVN A;  3RO1 A;  1NO6 A;  1PH0 A;  1G1G A;  2BZL A;  2VEY A;  3S3F A;  1I9S A;  1G1H A;  4WTY A;  4OHI A;  3QCD A;  2XPC A;  5K23 A;  4OHD A;  1LQF A;  3F9A A;  1OHE A;  3PYZ A;  2OZ5 A;  3EAX A;  4GRY A;  1PXH A;  2F70 A;  2GC5 A;  2HNQ A;  3S3K A;  2Y1O A;  2I42 A;  1JLN A;  3QCH A;  2F46 A;  3OLR A;  3D9C A;  5AWX A;  1C83 A;  1LYV A;  1JBW A;  1FPZ A;  2ZMM A;  4OHH A;  1GWZ A;  2B07 A;  5KA8 A;  2NT2 A;  2HB1 A;  1RPM A;  2CNF A;  3RGQ A;  1GQY A;  1PTU A;  3D1Q A;  4RI4 A;  4C12 A;  1OEM X;  3BLT A;  1L8G A;  2HVL A;  2E0T A;  1OEU A;  3S4E A;  1C84 A;  2JFF A;  2UAG A;  5KA7 A;  2QBR A;  1C87 A;  3QKQ A;  5K25 A;  4BUC A;  3S3E A;  1OEV A;  5KAC A;  2GJT A;  1Q6P A;  4GFV A;  4QAP A;  2Q47 A;  4IKC A;  2Y2F A;  2WJP A;  2ESB A;  4ZRT A;  1YN9 A;  3QCB A;  1FPR A;  2H02 A;  2NV5 A;  2FH7 A;  2PA5 A;  1RXD A;  2J16 A;  1GFY A;  2OUD A;  1FQ1 A;  1JF7 A;  3GXH A;  3V0H A;  3ZM2 A;  3ZV2 A;  1W78 A;  3ZMP A;  1YGR A;  2F6V A;  1KAV A;  2VTD A;  2I3R A;  4RI5 A;  4R0T A;  3QCK A;  2IMG A;  2J16 B;  3A5J A;  4CVK A;  3D1O A;  4KYQ A;  4GS0 A;  1SUG A;  1T48 A;  5BX1 A;  3QCG A;  1YTN A;  3NRS A;  5GTJ A;  1P15 A;  1QXK A;  5EHP A;  2B4U A;  2R0B A;  3PS5 A;  3LK7 A;  5K24 A;  2CNI A;  2P6X A;  4QDI A;  3RGO A;  2HNP A;  3ZM0 A;  3MMJ A;  2B3O A;  4S0G A;  2C7S A;  1Q6S A;  2VEW A;  2Y68 A;  4PVG A;  1PTY A;  3SR9 A;  2HXP A;  3B7O A;  3S4O A;  1ONY A;  1BZJ A;  1OEO X;  4C13 A;  2Y96 A;  1NWL A;  2RF6 A;  3ZM6 A;  1Q1M A;  2ZN7 A;  1NL9 A;  1GQQ A;  4DGP A;  5KAA A;  3M4U A;  2NT7 A;  2OC3 A;  2SHP A;  2I4E A;  1J6U A;  1PTT A;  3QCC A;  2A3K A;  4HRF A;  2CNE A;  2J17 A;  3QCJ A;  1YFO A;  4HJP A;  3S3H A;  3QCZ A;  1NWE A;  4QF5 A;  1XBO A;  2CNH A;  1G4W R;  1C85 A;  1EEN A;  2VOR A;  3A5K A;  1OHC A;  4MBB A;  4ZN5 A;  2VTE A;  5K9V A;  3O3L A;  4PYH A;  1KAK A;  1WAX A;  3BM8 A;  3MOW A;  1MKP A;  3V0G A;  4ERC A;  4Z6B A;  3BLU A;  5IBS A;  4D3R A;  4J51 A;  1I57 A;  1ONZ A;  5MMZ B;  4WU2 A;  3GXG A;  3BRH A;  1PYN A;  4GE2 A;  2G59 A;  4Y14 A;  4UAG A;  3QCN A;  2M3V A;  3D42 A;  5KA0 A;  2H4G A;  5KA1 A;  2HY3 A;  4NYH A;  2H4V A;  1XM2 A;  2QDC A;  2F6W A;  2QBP A;  2JFG A;  2VOS A;  1D5R A;  2H04 A;  2NTA A;  2B4O A;  1YTW A;  3QCL A;  2CM8 A;  1C86 A;  3U96 A;  2Y67 A;  3QCI A;  2HCM A;  2JFH A;  4DGX A;  1FGS A;  1YGU A;  3N0A A;  2PBN A;  2I3U A; 
#chains in the Genus database with same CATH homology
 5I6V A;  4BJO A;  3OMH A;  4BPC A;  2OOQ A;  2C46 A;  4GE5 A;  2QBS A;  1OHD A;  1YPT A;  5K9W A;  4NWF A;  1C88 A;  3QCE A;  2CNG A;  4JBC A;  2P4D A;  2VEV A;  1ZCK A;  2QBQ A;  1U26 A;  4GRZ A;  4NND A;  5EHR A;  2I75 A;  2QEP A;  4KI9 A;  2PT0 A;  2NZ6 A;  2B4S A;  4NX8 A;  5BUG A;  1BZC A;  1J4X A;  1Q6M A;  1M3G A;  3F81 A;  4QUM A;  2CFV A;  5HDE A;  1PA9 A;  2YDU A;  4R30 A;  4KYR A;  2H03 A;  2BGE A;  4ZI4 A;  3I36 A;  3QCM A;  1G7G A;  1PTV A;  4GE6 A;  5LXQ B;  2I6J A;  1Q6J A;  2NLK A;  1X24 A;  1ZCL A;  4AZ1 A;  2CMC A;  2BIJ A;  2I6P A;  3AWG A;  4QAH A;  2B49 A;  4GFU A;  3NME A;  3V0E A;  2QDM A;  4JMJ A;  1BZH A;  2CMB A;  4QBE A;  2CM7 A;  2WGP A;  1AAX A;  4RH5 A;  5IBM A;  1T4J A;  2I4H A;  2I4G A;  2I6I A;  3D44 A;  3O4U A;  2FJN A;  2DXP A;  4D3P A;  1YZ4 A;  4D3Q A;  1LAR A;  2AHS A;  2VEU A;  4R0S A;  2I5X A;  1G4U S;  4NWG A;  3CM3 A;  1Q6N A;  2F6F A;  3F99 A;  2HC1 A;  5KA3 A;  3O5X A;  5KAD A;  2PQ5 A;  3F9B A;  1EEO A;  2G6Z A;  5M43 A;  3V0I A;  5J8R A;  2GWO A;  3EMU A;  3V0D A;  5KAB A;  4H34 A;  5KA4 A;  4QUN A;  1ECV A;  4RHG A;  4QBW A;  4B04 A;  1L8K A;  1WRM A;  2BGD A;  4Y2E A;  2H4K A;  1YWF A;  4YR8 B;  2CM2 A;  3O4S A;  5BZX A;  3H2X A;  2HC2 A;  2GP0 A;  4YAA A;  4HJQ A;  3RZ2 A;  1T49 A;  3EB1 A;  2F6T A;  1V3A A;  1YTS A;  1XXV A;  2PI7 A;  2QCT A;  3EZZ A;  2F6Y A;  1G1F A;  3V0F A;  3D1H A;  1NZ7 A;  3ZM1 A;  3AWF A;  5KA9 A;  1PA1 A;  3I7Z A;  4WOH A;  4OHL A;  4JNB A;  2CMA A;  2VEX A;  2MBC A;  4RDD A;  5KA2 A;  2AZR A;  5K22 A;  4H1O A;  3QKP A;  2CM3 A;  2QDP A;  2I1Y A;  3EU0 A;  4WU3 A;  2CJZ A;  1XXP A;  3V0J A;  2I6M A;  4I8N A;  1WCH A;  3O4T A;  3I80 A;  4TVV A;  3LJ8 A;  2A8B A;  2B4P A;  2F6Z A;  4OHE A;  1ZZW A;  3MOZ A;  1VHR A;  1Q6T A;  3ZMQ A;  3F41 A;  1U24 A;  2JJD A;  1OET A;  2QCJ A;  4GWF A;  1NNY A;  1XRI A;  1I9T A;  1G7F A;  1U25 A;  3ZM3 A;  1QZ0 A;  2FJM A;  3CWE A;  4JMK A;  4ICZ A;  2BV5 A;  1ZC0 A;  3SME A;  2F71 A;  1OES A;  2Q05 A;  1R6H A;  1A5Y A;  4RKK A;  5BZZ A;  4RH9 A;  2PSZ A;  3AWE A;  2I6O A;  3QCF A;  3RO1 A;  1NO6 A;  1PH0 A;  1G1G A;  2BZL A;  2VEY A;  3S3F A;  1I9S A;  1G1H A;  4WTY A;  4OHI A;  3QCD A;  5K23 A;  4OHD A;  1LQF A;  3F9A A;  1OHE A;  2OZ5 A;  3EAX A;  4GRY A;  1PXH A;  2F70 A;  2HNQ A;  3S3K A;  2I42 A;  1JLN A;  3QCH A;  2F46 A;  3OLR A;  3D9C A;  5AWX A;  1C83 A;  1LYV A;  1FPZ A;  2ZMM A;  4OHH A;  1GWZ A;  2B07 A;  5KA8 A;  2NT2 A;  2HB1 A;  1RPM A;  2CNF A;  3RGQ A;  1PTU A;  3D1Q A;  4RI4 A;  1OEM X;  3BLT A;  1L8G A;  2HVL A;  2E0T A;  1OEU A;  3S4E A;  1C84 A;  5KA7 A;  2QBR A;  1C87 A;  3QKQ A;  5K25 A;  3S3E A;  1OEV A;  5KAC A;  2GJT A;  1Q6P A;  4GFV A;  4QAP A;  2Q47 A;  4IKC A;  2Y2F A;  2ESB A;  4ZRT A;  1YN9 A;  3QCB A;  1FPR A;  2H02 A;  2NV5 A;  2FH7 A;  2PA5 A;  1RXD A;  2J16 A;  1GFY A;  2OUD A;  1FQ1 A;  1JF7 A;  3GXH A;  3V0H A;  3ZM2 A;  3ZV2 A;  3ZMP A;  1YGR A;  2F6V A;  1KAV A;  2I3R A;  4RI5 A;  4R0T A;  3QCK A;  2IMG A;  2J16 B;  3A5J A;  3D1O A;  4KYQ A;  4GS0 A;  1SUG A;  1T48 A;  5BX1 A;  3QCG A;  1YTN A;  5GTJ A;  1P15 A;  1QXK A;  5EHP A;  2B4U A;  2R0B A;  3PS5 A;  5K24 A;  2CNI A;  2P6X A;  3RGO A;  2HNP A;  3ZM0 A;  3MMJ A;  2B3O A;  4S0G A;  2C7S A;  1Q6S A;  2VEW A;  4PVG A;  1PTY A;  3SR9 A;  2HXP A;  3B7O A;  3S4O A;  1ONY A;  1BZJ A;  1OEO X;  2Y96 A;  1NWL A;  2RF6 A;  1Q1M A;  2ZN7 A;  1NL9 A;  4DGP A;  5KAA A;  3M4U A;  2NT7 A;  2OC3 A;  2SHP A;  2I4E A;  1PTT A;  3QCC A;  2A3K A;  4HRF A;  2CNE A;  2J17 A;  3QCJ A;  1YFO A;  4HJP A;  3S3H A;  1NWE A;  1XBO A;  2CNH A;  1G4W R;  1C85 A;  1EEN A;  3A5K A;  4ZN5 A;  1OHC A;  4MBB A;  5K9V A;  3O3L A;  4PYH A;  1KAK A;  1WAX A;  3BM8 A;  3MOW A;  1MKP A;  3V0G A;  4ERC A;  4Z6B A;  3BLU A;  5IBS A;  4D3R A;  4J51 A;  1I57 A;  1ONZ A;  5MMZ B;  4WU2 A;  3GXG A;  3BRH A;  1PYN A;  4GE2 A;  2G59 A;  4Y14 A;  3QCN A;  2M3V A;  3D42 A;  5KA0 A;  2H4G A;  5KA1 A;  2HY3 A;  4NYH A;  2H4V A;  1XM2 A;  2QDC A;  2F6W A;  2QBP A;  1D5R A;  2H04 A;  2NTA A;  3QCL A;  1YTW A;  2B4O A;  2CM8 A;  1C86 A;  3U96 A;  3QCI A;  2HCM A;  4DGX A;  1YGU A;  3N0A A;  2PBN A;  2I3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...