2I6XA

The structure of a predicted had-like family hydrolase from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
205
Chain Sequence
b'AMIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRFLPSGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLLREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title The structure of a predicted HAD-like family hydrolase from Porphyromonas gingivalis. (CASP Target)
rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
total genus 73
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2006-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2i6xA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i6xA01
2B1RA 5AM1A 5ALLA 2HOQA 2HX1A 3IJ5A 2FEAA 3DAOA 4F72A 2EARA 3EF1A 4KX5A 2WF8A 1RMTA 2PQ0A 3UMGA 3CNHA 1Q91A 2QYHA 1EK2A 5FP0A 2WF9A 4UAVA 1U2TA 3GYGA 3I6BA 2R8EA 2G1AA 4NWIA 1CR6A 1ZJJA 2YMQA 2AMYA 3WK8A 3QXGA 1QQ5A 3L1VA 3OCVA 1ZS9A 1Z4MA 2WF6A 3RF6A 3UMCA 2WHEA 3IB6A 4HGRA 3OTQA 3SMVA 4UASA 3F9RA 1WR8A 4KNWA 3L5KA 3OCXA 3NAMA 3L8GA 1N9KA 3KZXA 4BNDB 3OPXA 3FZQA 3KDPA 4DCCA 3QUQA 5IS2A 3UM9A 1NF2A 5ALJA 1T9ZA 2DQSA 3NANA 4KNVA 3ZX5A 5ALHA 3SKYA 5AHXA 2G09A 4BBJA 4Y2VA 2IYEA 4RETA 3RFUA 3OCWA 4UMVA 3L8EA 4UMDA 3ET4A 4OD0A 3NALA 2OBBA 5AI8A 1CQZA 3QX7A 2MU1A 2VKQA 2BDUA 2YJ5A 1ZD5A 4EZEA 5A3RA 2FPSA 2JAOA 1O03A 4KN8A 4HGPA 4FE3A 3WK5A 3AR9A 2NYVA 2B8JA 4CE6A 2MU2A 1J97A 1QYIA 1SU4A 3E81A 4JDPA 3QUCA 5AI6A 3WK9A 4C4RA 3E84A 3SD7A 3AR2A 3N8GA 3L7YA 2HCFA 5AW5A 2IOHA 3B9BA 3FM9A 2PR7A 4EELA 3A1CA 3L8FA 1YMQA 1EK1A 1ZD2P 2QLTA 4OFZA 4ZEWA 5AKYA 1U7PA 4L6CA 3WKCA 4ZEXA 2Q4TA 2W11A 5AKLA 4XE5A 1X42A 3BA6A 3I1YA 4UAUA 5AI5A 4CF3A 2AGVA 2I33A 3PDWA 5ALPA 4RESA 3I28A 4Y2XA 5AM5A 2I34A 1ZD4A 5ALIA 3KOOA 4YCLA 5AVRA 2Q5EA 5AI0A 2WFAA 3WGVA 4I9GA 1FEZA 3KBBA 3QU2A 1Z4PX 1WPGA 3ZVMA 3MMZA 1RMYA 3W5CA 1YNSA 5AW9A 2OA0A 3W5DA 1IWOA 4XQ0A 3D6JA 1RMQA 3U7HB 5AK6A 1RLOA 1YDFA 3U13A 5AVYA 3W5AA 5AI4A 2C88A 1Z4IA 4YCMA 2YJ6A 5AVQA 5AKXA 3ZWKA 1Z4OA 3MN1A 2B8EA 5AVSA 1T5TA 3NASA 1PW5A 2GHQA 4H1WA 2B82A 3HYCA 4NAVA 2P27A 2D2VA 2C8KA 5AVXA 2I7DA 4Y2SA 3DV9A 3QU7A 2JGAA 5ALTA 4C4TA 4F71A 2GFHA 2HSZA 1L8LA 2FPWA 2ZBEA 3B8EA 4HGNA 2W43A 1S8OA 2RB5A 3ZW7A 3NUQA 2GO7A 3QUBA 4DW8A 2FPXA 3PCTA 2NO4A 2G08A 4HGQA 3AR8A 4EX7A 5ALYA 3IRUA 3A1DA 5A3QA 4GIBA 1KYTA 3SHQA 2WF5A 2G0AA 3OCYA 4UM5A 1XPJA 4YGYA 5ALRA 5ALDA 3QU5A 5ALGA 1ZRNA 3U26A 5AVTA 1ZRMA 1NNLA 1YV9A 3ZTYA 5AVZA 1RC8A 3SLRA 2YMLA 4ZEVA 4HYTA 2JAWA 2P69A 3E8MA 2R8XA 5ALSA 3QUTA 1VFPA 3WKAA 3OCZA 2I54A 1VJRA 4FYPA 2CFRA 5AVUA 2JAUA 4UM7A 3ESRA 2W4MA 3L0YA 5AKKA 5AIBA 1LVHA 4BX2A 2HF7A 2WM8A 1S2OA 5AW6A 5AVVA 3QU9A 2HEGA 5AICA 5AM4A 3L0CA 3KD3A 5AKEA 3ZU6A 2YMPA 4NFLA 4CNQA 2B30A 1RKVA 4AS2A 5AW4A 2B0CA 3FVVA 3L8HA 3WKEA 4YCNA 4Y2RA 2YJ4A 3L1UA 1Z4JA 2FDRA 1QH9A 5AKHA 1TJ4A 1L8OA 4KX3A 5AESA 2IA5A 5ALEA 1Z5GA 2MSNA 2R8YA 3N28A 2CFTA 4AS3A 5AW7A 1MH9A 2EATA 3ZUPA 4DFDA 5AKIA 2NO5A 4I9FA 2FPRA 3ZVNA 5ALMA 2HF2A 1RQLA 5ALNA 5A3SA 1YS9A 4Y2UA 5AW1A 5AK5A 5AK4A 2I55A 1K1EA 3E58A 4UU0A 3SF0A 1WVIA 4FFDA 2G06A 1QQ6A 3S6JA 3EF0A 2O9JA 5AW3A 2ZBGA 3U7EB 3R09A 4BKMA 1AQ6A 4BNDA 4Y2TA 2YBDA 5T41A 1Y8AA 2G80A 3WK7A 5ALZA 4HGOA 3HLTA 4GXTA 1NRWA 3P96A 3WK4A 3U7GA 4PNHA 1U7OA 1Z4LA 1T5SA 4UATA 5E0OA 1SWWA 5AW2A 3WKBA 3ZVLA 2YJ3A 1Z4QA 1Z4KA 1XP5A 4YIHA 3A1EA 3W5BA 4Y2QA 1TJ3A 5AW8A 3N5KA 1JUDA 1QQ7A 2ZOSA 3ZX4A 1RKQA 3R9KA 2P9JA 4EX6A 2B1QA 5AVWA 3R4CA 5IT4A 2C8LA 5ALVA 1ZOLA 3WK6A 5AM2A 4KYTA 3EWIA 4Y3UA 3NRJA 4UW9A 1RPZA 4Y2PA 3ZTWA 2R8ZA 1O08A 1Z5UA 3ESQA 4UU1A 5IT0A 3WGUA 3M9LA 4MWOA 1L6RA 4E88A 3KC2A 1L7NA 4B6JA 2HDOA 3U19A 3QYPA 1U02A 4XOUA 3L0BA 3VAYA 2YMMA 4XPZA 2FPUA 2BDEA 3BWVA 3QLEA 1J8DA 1RKUA 2GMWA 3PGVA 2ZG6A 2PKEA 3FPBA 3ZWDA 3A3YA 3M1YA 5AKJA 4OCZA 1TE2A 2FUCA 3I76A 5AK3A 2HO4A 5AKZA 1ZD3A 4G63A 4BEVA 2WF7A 1L7PA 5ALFA 4NV0A 2EAUA 5AKGA 1LTQA 5ALKA 4AP9A 4CF4A 1L7OA 4YIKA 1TA0A 2G07A 2HHLA 3B9RA 3QGMA 2HI0A 3QU4A 2BY4A 2GHTA 5AI9A 2FUEA 4IFTA 5ALUA 2ZXEA 2CFSA 2IOFA 4YH1A 5JJBA 2YN4A 3J7TA 3OCUA 3FPSA 1N8NA 1WZCA 4O8CA 2C9MA 2Q4RA 2X4DA 5ALWA 4J2TA 3ZI4A 5AW0A 3K1ZA 4UARA 1RDFA 1U2SA 1Z88A 4C4SA 2ZBFA 2CN1A 3AR7A 4QJBA 3DNPA 2ZBDA 3CZ4A 2IOFK 3FGOA 1RQNA 4HAIA 5ALXA 1XVIA 4L57A 1RLTA 3NIWA 2OYCA 3UMBA 4EENA 4QQFA 1TJ5A 2RARA 4UMEA 3WKDA 1Z4NA 2RAVA 1RLMA 3ET5A 3EPRA 2JARA 4BEWA 4NABA 1VJ5A 3AR6A 5AM3A 2P11A 2RBKA 5AM0A 2ODAA 4UMFA 2YY6A 1YJ5A 3DDHA 3ED5A 4Y2JA 3AR5A 2I6XA 2O2XA 4IG4A 3SKXA 1SWVA 1Q92A 2YFYA 4EEKA 3TLMA 4BYGA 5AIAA 3PGLA 4DWOA 4G9BA 2AUTA 4BX0A 3U7FB 3N07A 4MUMA 4Y2YA 3N1UA 3AR3A 4BX3A 3QNMA 2OM6A 2AH5A 1RRCA 1F5SA 1L7MA 4OHFA 5ALQA 4J03A 4L6AA 5ALOA 4JB3A 3AR4A 3ONNA 2C4NA 4CF5A 2FI1A 3MPOA 3MC1A
chains in the Genus database with same CATH superfamily
2P91A 3WIDA 4Z7OB 1UINA 1IXKA 4AY6A 5AO9A 5CJ7A 1U2TA 1WSWA 2DR3A 1MHPA 3IVRA 2VTVA 5A6VA 2H63A 3GFVA 2GXSA 2XE7A 1WR8A 1PK7A 2ZW9A 1WZIA 3C8HA 3V8PA 4DAOA 1T3ZA 4M2YA 3T95A 1PEDA 4GT1A 2HW8A 1MVLA 1XZJA 5DGDA 3MFQA 4KLEA 3E9YA 2Z5GA 2FR0A 2G09A 4BBJA 4JXZA 1FK8A 3GH1A 3PIRA 4NARA 3UY4A 1CE8B 3H3FA 1H42A 3AG6A 3WLPA 1GL3A 3FNRA 3AT1A 1HFJA 1KMQA 2FPIA 3U4DA 4HB3A 1MF7A 3VVMA 5K03A 2VIXA 2ZLBA 1KJZA 4HLUC 5KFDA 1DAKA 3L49A 3U48A 4QHYA 1P2UA 2Z1NA 4Y9UA 4QU5A 4DSJA 4V3BA 1Y4UA 1Y9ZA 3TRJA 1DWPA 4I2DA 1SVLA 3EZ7A 2I9PA 1G8GA 5HCNA 1OLUB 2FW8A 4AG6A 5K05A 3EIOA 2JDIA 3UFBA 5DDIP 1MO6A 2QL5A 3TI9A 3GMIA 4NK5A 4FYHA 3FHOA 4K5QA 3KSDO 1DGSA 5FIUA 2IZZA 2CLKB 1NVDA 2WAOA 1AKQA 1EFPA 4UB6U 5AKXA 2XMQA 1TU3A 1YT5A 3M6UA 1G6OA 4IUYA 1UJ2A 4XSVA 2ZSDA 5CFQA 2W3RA 3OJOA 4B3IA 1O6GA 1QSSA 2IT1A 3N76A 3SV4A 4J0HA 3ETCA 1YR6A 2DF8A 4GM0A 2MTBA 3V1TC 1GEEA 2ZE5A 3RT7A 4DMUB 5L3ZA 1BD4A 1NRXA 4QPZA 1VRVA 2IY8A 4E7OA 3KHKA 1QR2A 2C7GA 3RSSA 2L2QA 3EWNA 2BSQA 1VG9B 4NNOA 1HT3A 1USIA 1P5JA 1EUDA 1R0YA 3JASB 3TLEA 5C2JB 4PX9A 2PAFA 2B5OA 1UDXA 3HVRA 2W6JA 2CFTA 1E5QA 3HA5A 4FN5A 2BZ1A 2CYCA 4NCXA 3JQRA 3RCBA 4O1MA 1EVIA 4XYGA 1DB3A 1EESA 1WCLA 2Q3DA 2FSVA 2XGJA 4E5DA 5T41A 3HLTA 2WIFA 3AINA 2CSUA 4MDFA 3LV8A 3UCEA 3JQ7A 2CL7X 1XVUA 2AJBA 4MIOA 4F93B 1T2UA 4LN1A 5AW8A 4FS1A 4KVFA 4XKJA 3TNJA 1LBEA 1EVQA 3M4ZA 5JSQA 5TT0A 1O8CA 4O3SA 3OG9A 3TJMA 4MW4A 4LISA 3KJQA 2OZLB 1QX4A 5EYPB 1WZNA 3EWIA 4ZI7A 3O4JA 1ZIOA 3V48A 4GEKA 2Y1KA 1JWBB 2NWQA 2YCLA 3ZE6A 3EARA 3HK2A 4YRMA 1UC8A 3NAGA 2EEZA 4ARSA 4WNYA 2ZTUA 3G89A 3AQIA 5FWYB 5KAMA 3H1EA 5E4TA 4NJEA 3L0IB 2FKAA 9ABPA 2XCUA 1L7PA 4ROTA 4N0EA 4QLBA 1QPBA 1E6KA 3CW8X 3FPLA 1K7CA 3DZHA 4KG7A 3FKJA 3S0JA 3ZJUA 5ALWA 4G5RA 3B1JA 1U5BA 2VQ6A 3EGEA 1EP3B 2Q8NA 2EL7A 1JROA 4KJZA 3CR3C 2IBKA 2WFMA 3IP5A 5A7GA 3OM0A 2ZUWA 5FTWA 4MVJM 4AG5A 3L8YA 3WNZA 1A2BA 1I4TD 4E4TA 4UHCA 3QY0A 3MJHA 3G82C 4JL5A 1KI6A 1ZN7A 5JDIC 2IXBA 1H4QA 3WB9A 3PFNA 4K9DA 2Q9AA 3CPJB 2G5IB 1GUZA 3TW8A 2D06A 2PJZA 3NHFA 3UK0A 2IW1A 1HM5A 5FLYA 3ENQA 3IAS6 4ZU3A 1MW9X 1E2QA 3K0SA 3KX2A 4B82A 5C37A 5JTIA 3AL2A 3SI7A 4IV0A 3VJRA 4YAEA 2JEJA 5DKWA 3RS5A 3CA8A 3WIUA 4AJ2A 3ZZUA 1CJTC 2IKSA 1L1FA 5IH3A 4RNDB 3BPSA 1X3SA 4RHXA 3PHJA 1VTKA 4GM4A 1J24A 3DT8A 2ETVA 4LBZA 3L7KA 4IDOA 5DV9A 2WRZA 4UVGA 3B1XA 1ZQ9A 3EFEA 1A7JA 3BREA 4Q03A 4Q9HA 3TQHA 5DK4A 1C5KA 3O93A 2F00A 1BMDA 2Y0EA 4PSCA 1XZNA 2QLNA 4BQFA 2NU6B 1CF2O 1WW8A 2NSLA 3JAKA 2HC9A 4OYYA 3FOWA 5GQSA 4QA9A 3U4MA 1KVRA 4JXJA 2AFHB 4MQLA 2HZBA 5AVRA 4E22A 3L06A 3IUMA 3NC1C 1NQ5A 3OQMA 2X6TA 2B99A 3ZGNA 5H81A 4F04A 4FMPA 1W87A 4ESHA 5CFOA 5CH3A 1J0DA 2EIXA 2WWTA 4ZFNA 3NBFA 3OZXA 3FPKA 3NASA 3DC2A 5EKUA 3ZDYB 2NZWA 1RJGA 2JIBA 1SUFA 1EFHA 3KNZA 1JZTA 2R1TA 3U1VA 4X7PA 4TMVA 4RORA 1OU0A 1ZCBA 1Y3DE 4WCFA 5CLIA 3AEXA 2Z8YA 1J2RA 2G0AA 1HDCA 4GLFA 1NVTA 2H59A 3EEBA 5TPZD 2GLEA 4COOA 2XMRA 4V0OA 4AJOA 3UENA 4C7OA 3PDHA 5GMOA 1RACA 1F5NA 2XBLA 1BH2A 1CUDA 1FX0A 3I32A 4BX2A 1J1IA 2HEGA 2IYOA 2J6IA 1YQEA 1T5HX 5KJ6A 4HSEA 2UVWA 1RLUA 1I6WA 1MO2A 1U0LA 2H1FA 2RKWA 3ILXA 5EUBA 4YAKA 1TRKA 4IIVA 3A6JA 1KE1A 4GOXA 3OWHA 4FFDA 2GEBA 2F1HA 2AMLA 3UAXA 4H0NA 4PLFA 3D8TA 2VDWA 5L7WA 1BX1A 3GCDA 4Z9AA 3SDBA 3ZV6A 1D8AA 3SVTA 1TF2A 3IMEA 4RDCA 2FPIB 3TLXA 2ETXA 3LLSA 1E3JA 4IJWA 3ZX4A 2WTEA 4PLCA 3GPDG 4UCQA 5BQFA 4KSBA 4Y18A 2LM4A 4FZJA 4YXWA 3TE7A 1DQNA 2YZNA 1R0LA 4G1MB 5EY5B 1IM2A 3AXSA 2BGWA 2YVUA 3THVA 4HKTA 2FWJA 2NPFA 1GSOA 1TLTA 1CDEA 3LYUA 1DC5A 4LJLA 2ZRPA 2DLNA 2O8DB 1JNYA 4GGPA 2HA0A 3WLFA 1V96A 5DXJA 4NCBA 1UM8A 2ZIVA 5EVJA 5HDBB 4HMOA 4QTUB 3P9YA 4LGYA 3EXHC 2PZLA 1EFPB 3KE9A 3ENVA 1CY2A 1BEEA 3X2SA 4NYJR 5M29A 2R68A 1QKKA 4BRSA 4YH1A 4KO8A 5B30A 4BRWA 3BGVA 3CRNA 2X4DA 5HEKA 1H85A 5CR9A 2CN1A 4YFKA 1I4EB 5HXAA 4Q3AA 3L46A 1E5LA 4I8XA 4Q4CA 1YDMA 3EWAA 2C2GA 3FOFC 3GLUA 5ED4A 1T2AA 2GXQA 3OM9A 1A4UA 4NXZA 3H18A 2ZUFA 3BORA 4D0RA 1QSGA 4C5BA 1U49A 3UH0A 2BISA 3VZPA 5KFRA 1EUDB 1J8VA 4TWAA 5ALOA 4RTLA 1J5EB 1I1NA 5H2FU 1PR3A 5L4LA 9ICVA 4OX9B 2P8JA 3HCEA 3GFSA 4NZPA 1KWGA 2LTAA 4DL5A 3FYUC 3PEYA 3N0TA 3LL7A 5KFXA 1NV8A 5HKAA 4KHZA 4LHYA 4MV7A 3I04A 4JJGA 1THTA 2G36A 3B6KA 3RF7A 2E8NA 3JQ7B 3ZQKA 4MUIA 2DSNA 4JOQA 2ZTHA 2COUA 4FBTA 2EAMA 5AUNB 3WHLA 2VT7A 2BDUA 3RJGA 4HXGA 1JMSA 3B6JA 4GRAA 4ZQIA 3GLGA 4ZI7B 4OJYA 4LJXA 4IIJF 1MQ3A 4UXHA 5KHLB 1GQ2A 1UKYA 2CKMA 2YWHA 2R62A 2XCPA 3M5DA 2AUMA 4UAGA 1WULS 1T1GA 3UT6A 3V6HA 2HDWA 4Q7EA 4XSGA 1IOLA 2HJWA 5MHTA 4DCNA 2H1HA 3PNKA 3Q2KA 3PUWA 5FUVA 2QUAA 1O6CA 1QIEA 4AX8A 3WDSA 3MGAA 4I2GA 2DT8A 2W8LA 1Z17A 3NGLA 4GRDA 5C8ZA 2X0RA 3K4PA 3AF0A 4EKEA 1TTHA 3SAFA 5IX8A 1U5BB 1T5BA 2B8EA 3V9AA 2HMYB 4HEHA 2J30A 4WY2A 2O1XA 2VWGA 2D7CA 4C4TA 2HSZA 4QZHA 4KDFA 1TM4E 3GUHA 2NACA 4II2A 3TNDA 1V97A 3RNOA 3RAQA 2HIMA 2OV1A 1SKYB 3BE8A 5G0SA 1Q1ZA 3IT1A 4BO8A 1AV7A 5IABA 1GQQA 4MWDA 4ALIA 4N9WA 2V55B 3AKCA 3TW8B 4AG3A 1FDIA 1M33A 4FYWA 1LBQA 4C6RA 4OIFA 2WZDA 4L3WA 2CXNA 1EJBA 3KP1A 4XVUA 4RHEA 3EYZA 2ZR8A 1GIAA 3O73A 2LUOA 1Z0JA 3ZUPA 1YCDA 1YVPA 4CDGA 3A4NA 4XSHA 1E6LA 4BLTA 1PG5A 5JJ5A 9ICOA 1O2DA 3SLGA 4JGIA 3RSQA 2XXAA 2PXHA 2ZBGA 5BNIA 1D9ZA 1M2FA 3SXJA 4ZYLA 2PFKA 3PNCA 5BSVA 4IGAA 4QT4A 1PEYA 1K7EB 1Z4QA 2YV1A 3K1TA 5G2OA 1SR8A 4DWJA 3WWZA 3AUYA 3E48A 5LMNB 2AR9A 4P32A 5FPPA 5ITVA 1W8IA 3NRJA 4Q93A 3FF1A 1PUZA 4A0QA 1NUPA 2RGNA 3JAKB 3S2IA 1V4NA 2QNBA 5BSRA 4RY9A 4P38A 4RHTA 4I6JA 3JQDA 4ECRA 1RHKA 3PJGA 1TAGA 4KH0A 4J4TA 5HZHA 1O3YA 3JPRA 4KPYA 3QU4A 4MICA 4R71A 2CNOA 4PH5A 1B8VA 2DCMA 2R1TB 2C2XA 1RXVA 3MFIA 3HEMA 3QVXA 4WCFB 1NV9A 5BO5A 3P19A 4GSLA 2QRLA 1Y3BE 4KAFA 3UAYA 3OY7A 2H1LA 4C7OB 6REQA 3PQ4A 4WLOA 4DCTA 2IHKA 3VPGA 4OKIA 2QY9A 1V39A 3KLNA 3M6AA 3VHLB 3HYTA 4W6QA 3ZY5A 3CRRA 2JVJA 4EF4A 1DV2A 4CV3A 3MOIA 4POAA 4OFXA 2WTMA 5J59A 4QHSA 2A1UA 1FDSA 4E5NA 5FWXA 4BQSA 4MQBA 3AP1A 3TZ6A 4ZOBA 1V7CA 1JEQA 1XD9A 2BF7A 3NVMB 3UWOA 5A9SA 2HV9A 1QGOA 2VDWB 2O07A 1G4HA 3KKZA 3V4ZA 1E3SA 3MRSA 1UBNA 1P0IA 3ADPA 4R4JA 2J9YB 3BRQA 5FFFA 1SG9A 1WBDA 3GP3A 1ZHOA 4PZPA 4BC1A 4N3GA 3OC6A 3AHIA 4TQRA 4XA5A 2XODA 4U00A 4Q9DA 4MV6A 2ESRA 1PLKA 3B13B 2JKZA 4WNIA 4C0XA 3AI7A 2WKQA 2O7QA 4BIIA 1G9SA 1U7UA 2WVHA 2VQEB 1OV6A 3I1YA 4BBAA 4Q48A 3DXFA 2ZIVB 3MBIA 3MJCA 3EFOA 3PPXA 3O90A 3RH0A 1I80A 4EVRA 5HA5A 3P9IA 4C21A 3TBHA 3TR0A 2WYHA 1W48A 3EDMA 2GH1A 3WGVA 4CYMA 4YJGA 2CMGA 2XOKD 2FSFA 4AJKA 5EHIA 1P80A 2XOXA 1E3TA 4DTCA 1L2TA 1YA8A 3G8BA 3MMSA 2XGSA 3EBPA 3G2MA 5HGJA 2CD9A 2CXSA 2DHDA 2VH5R 3JXEA 1KVQA 4CG0A 4IWYA 4QEZA 1IAQA 2I7DA 4Y6OA 1IDOA 4KKVA 1XRQA 4IIDA 4J49A 2E0IA 2HWKA 2FPXA 1IFXA 2UZ0A 2RG7A 3HTXA 4WD3A 2YTZA 5JAZA 2JEIA 1XRMA 3CU5A 2C4KA 3DF9A 4ND2A 4FGZA 3LX4A 1U8YA 4YRKA 5A3VA 2WZBA 3I5XA 4ENWA 2GCIA 1JECA 5JAMA 4NVRA 5KTPA 4H6WA 3PTZA 2AG6A 4GBGA 2HTFA 3NDIA 3FDJA 3H1BA 4OSPA 1XN4A 2GUWA 5CFZA 4H35A 3UJPA 1COWA 4ZVOA 5I4BA 4QDXA 3H2KA 3LQYA 2BFPA 3RR2A 4BTEA 3P71T 3JYLA 4MHOA 1KEUA 2TRSB 3RODA 3K70D 3LP6A 2HHQA 3TZCA 2VAPA 2I55A 1CDZA 4MMYB 2VJDA 8ICNA 2FMKA 3HCNA 3RJEA 4RENA 1JXAA 2WIAA 3SQDA 3RF9A 1YZNA 4BFUA 4G6ZA 3KQHA 4K0KB 4WACA 3E4DA 3M4NA 3HX0A 5CVDA 1U48A 2YVAA 2QT0A 1C30A 4IIFA 4CTOA 1UBUS 3H2ZA 4UNQA 3INYA 2GI4A 2YNMC 4FZLA 5KKNB 2OP1A 3Q8KA 5HG0A 4YMWA 5LZ9A 1RI1A 4UFOA 4PN7A 2IUSA 2B2XA 5KEIA 4B1FA 2JJ8A 2JBAA 4C7XA 3PIIA 1N5WA 3AUXA 2NG1A 4B84A 5FUBA 2JZCA 4NBRA 4BEJA 1RKUA 5BP7A 3HRIA 2OFPA 2JGRA 2HZ7A 1EE2A 2RHTA 3VPFA 2PY6A 3EXG1 4DEXA 4S1PA 4TT3A 2VNHA 4DEYA 4FW9A 3I9NA 1JKJB 4I1VA 4LYHA 3RK0A 4EO9A 1CLUA 2E5LB 4LV5B 4J07A 1OZFA 4GXIA 4DV1B 3HCRA 4UDYX 4EWLA 3PEEA 4HFRA 3Q7RA 2ZK7A 1CERA 4XR9A 4R2JA 3N87A 5AFSA 3L4PA 3VSAA 3ND5A 3E1GA 1JHVA 4J16A 1OXTA 1JQBA 4OB7A 3CISA 3E9EA 5K8VA 4II3A 4RLQA 4JJ8A 1IPEA 4IJKA 4Y1GA 3G0IA 2QZZA 1UP4A 1DQRA 5CMLA 5D86A 1Y98A 2O8CA 3R6LA 2DWCA 3ANMA 4EECA 3NTUA 4KSCA 2Q1SA 1NVFA 4XIIA 2FWRA 2WFLA 4D5GA 1UPTA 3IB6A 2XXAB 3H0CA 1HNWB 1SBTA 2I3ZA 3G59A 4MYCA 3GBVA 1GUAA 1R5JA 4QBTA 1Q0SA 2I4RA 2X76A 1XT6A 2EHJA 2W9BA 3MGCA 1ZVKA 3UJ9A 3V1LA 2J3DA 4PZ9A 1U9IA 4S1TA 1EXMA 2ZR7A 4LX8A 1DQPA 3LLCA 1JPVA 1CG6A 3G6VA 4XQCA 4W9NC 1DJPA 3LPNA 4Q7JB 2WIJA 2F6RA 4P2GA 5D3QA 4YRPA 1B6RA 5DIZA 3D3QA 3HM2A 2C2OA 4JV2A 3S55A 3B8HA 3GJQA 1BE1A 4HF7A 5MGNA 2P9YA 3QX8A 3C28A 3PDIA 2CL6X 1ZK1A 1KJIA 3WGLA 4UUMA 3R7SA 3M8SA 1K86A 3IVCA 4WRRA 1GSIA 3BH0A 3IHQB 5ELLA 4EW1A 5CTAA 2WU4A 2A5GA 2J7PD 4RZHA 4MR7A 2Y4OA 3W77A 1CUJA 1BYUA 4J4BA 2OC4A 4U7WA 4CIAA 1X7DA 2FE1A 2V0NA 4FQ8A 3WNBA 3HVUA 1ZKMA 4Y2SA 1YJQA 3U62A 3N2GB 1QWOA 2PUFA 4C7YA 3ZCRA 3IJEB 5G1OA 4UOQA 1D7AA 1V5FA 1YKGA 4W63A 1B2LA 2E3TA 4UNNA 4DE5A 1R8XA 3IAAA 4N5HX 4O2AA 3P9RA 2X9QA 2PFOA 2QTVB 2R8IA 3HC7A 1PEAA 1U99A 5AKKA 5F2EA 2FZGA 3SFVA 4KLDA 1CYDA 3C1YA 3JWIA 3FCOA 3CGGA 4U7TB 2A1UB 2PU5A 5FWXB 3PL5A 1LPPA 2BR3A 2AW3A 4Y2RA 2VVTA 1VI6A 3C6QA 1D4FA 4KQMA 1BFDA 4RYLA 4QSHA 2E49A 1AC5A 3CW2C 4F4KA 3SZ2A 5B1HA 2EBUA 4BY9E 1XDBA 1UWLA 4Y0NA 2QZSA 3LW8A 2VANA 4MEAA 4LW8A 5DB9A 7GPBA 1BS2A 2FMPA 3MWGA 3WK7A 1I3NA 1NXTA 2ECFA 2REBA 4TYQA 4RZRA 4QDKA 1W0JA 3VNRA 3OZDA 3NYIA 4CIVA 1JUDA 4GBMA 3QELA 5IT4A 3M33A 4P4NA 2Z2XA 2PZJA 1MGOA 4QWBA 2ID7A 1A8PA 4DEZA 1YE3A 2IIQA 4PJ0U 1NK8A 3EFOB 2CXUA 4YJ3F 5EJMA 2CW5A 1M1UA 1MX3A 2CD7A 3R8XA 3ZWNA 4YJGB 3TADA 2DBRA 3OT1A 1KDVA 3JQGA 3I76A 3DC7A 5FNVA 4QBGB 1MU0A 4R63A 1GUYA 4P8RA 1B00A 4N3BA 3KR1A 3U09A 1YDGA 3RIYA 3K1RB 3ZHXA 1H0SA 2QA5A 3F6SA 1FP2A 3UB4A 1KGDA 3C5FA 4IHJF 3VSDA 1WQ4A 1ZPDA 1JQLB 3IDQA 2IXTA 3F71A 2OCIA 5LZ4A 3AHCA 4QAJA 5IWAB 5K51A 3UMBA 4D4KA 1CB0A 4Z3KA 1PJSA 4Z53A 1GCUA 3L7OA 1BMTA 1N5KA 4ENTA 3ES9A 4YLYA 2ZIGA 2C9CA 4MB2A 2PZAA 4MF8A 1Y1PA 3G5TA 2X0FA 3M34A 1GA1A 2ZDHA 3NFRA 9ICPA 3JD0A 3UUWA 2ACKA 3JARA 3J81k 4AY2A 1X40A 2UYQA 3GLFB 4ZODA 1COOA 2BTOA 1UDBA 5LVAA 3PFKA 3R9IA 2J9ZB 2O57A 1EJ0A 4G8JA 4RZQA 2WABA 3GPBA 2ZATA 4HQOA 4HWGA 3WYGA 2VKTA 2HA4A 2L18A 1HLPA 1K97A 3WJ2A 1OE0A 1SBCA 2G1PA 3BS5A 3QA9A 3GVXA 3CVUA 5FWDA 2HU5A 5I5GA 4PC3A 2ZIZA 4IV5A 4BWGA 4MWCA 4GH5A 5JTUA 3JQAD 4RD2A 3LYHA 4UFPA 5J0PA 3B53X 3DBIA 2ZIUB 2NYAA 4ZU1X 4J9OA 1C30B 1QG4A 4F5RA 2VF2A 1QHYA 1CQXA 5AI8A 3IAFA 1RAEA 1FUKA 1KFCB 3JPSA 4RNNA 1S01A 1PVQA 5K0TA 2DWUA 3A9SA 5C8VA 1NNEA 2FWMX 2A4MA 1TYDE 3HBFA 1ABEA 4OREX 2N1MA 3FCYA 1EK1A 1OQAA 4QKQA 2J3IA 5BNTA 2I66A 3EVGA 4U6SA 4WXYB 2GO1A 1HE8B 3L0OA 1SBZA 2A33A 3U4AA 4M0MA 4FFBA 1X1AA 4MTCA 3WGZA 5KHOC 3OC0A 2W8KA 1GSHA 2Q9CA 5E7IA 4CLOB 4COKA 2BCSA 1QVWA 4ZN6A 2HU2A 3W5CA 3VKHA 4AZ3A 3KZIU 3AM4A 4TQUS 4YVFA 2BGMA 5TQJA 1FY2A 1CZRA 2OGUA 5IH7A 4JEMA 1CUEA 4FIZA 3HYCA 4Q1CA 3AESA 3SS8A 5EJGA 1GSAA 3OA2A 4HGNA 1FJHA 4CCAA 1DFGA 1BCSB 1FYVA 2GYVA 3PF8A 1CZLA 1NZBA 5EEHA 3QW2A 2CJFA 4EW2A 1SL0A 3OUZA 1BRMA 2QUZA 3VDNB 3TN7A 4I2EA 1PR4A 3SX0A 3M2PA 2RGEA 3U44B 3BSYA 3GBSA 4B6SA 1JTEA 1P1BA 3DDNA 4H9GA 1COKA 3TEJA 2Q3HA 2E1EA 3K0CC 3PNOA 3SHFA 2QN2A 3HL4A 2P9ZA 3Q41A 4RJJA 3O8DA 1A27A 3BB3A 5EMMA 3TW6A 2WFLB 1ULBA 2JIOA 2R8JA 1MBZA 1Y1TA 5J4HA 4EKGA 3WMEA 1IEVA 4CDRA 4YFYA 3K71B 1YB6A 4W7HA 4RGQA 4D7AA 1O94C 4PZDA 2DPGA 2CV2A 2W9BB 1XK7A 5FOTA 2JI4A 2PUJA 4I2FA 2XDWA 3DTTA 3F3YA 1IQRA 4D9NA 3VSBA 3E3NA 2H6EA 2P9TA 3L0DA 3OEWA 1WVMA 4R05A 3RRJA 1XU4A 2QU7A 1SWWA 2PBFA 4PLWA 1UPBA 4FI3F 3LDUA 1Y3IA 4M1QA 1EX1A 1IONA 1TQ4A 1T13A 3Q98A 1N2IA 2GAIA 1VKJA 4JYCA 2Y68A 2JL1A 4FCVA 1PWZA 1JX4A 5T4HA 3JALA 2CBGA 1F8YA 1ORHA 1GNVA 3PDIB 4A92A 2GLUA 1PWXA 4LF4B 1UF9A 4YJFA 4UBKA 4URVR 1NXQA 4YX9A 4CVNA 5IFKA 4WKNA 4UBMA 5KFHA 2GVZC 4JVOA 4KYVA 2QRKA 2PYDA 3OIGA 2YL2A 3T12A 4Q4AA 4MR7B 4EUSA 2C4WA 5KYKA 3BTSA 3DOOA 2V0GA 2VOJA 2NM0A 1V85A 5JNUA 4P0TA 3KWJA 1Q44A 3IMFA 4U02A 2BOVA 1JKIA 3BS7A 3IPYA 4QZVA 3VR3D 5KDLA 1TMYA 4O2AB 4RQBA 4XWOA 4G4GA 2PH1A 1G63A 2PR2A 1UT8A 3HCWA 2M9MA 1SXPA 1XCBA 3HR4A 3DHWC 4MX8A 2IHZA 4RKWA 3D2NA 2P3QA 5C81A 3JSXA 4KLRA 5LMUB 1H8HD 1JU9A 4DWOA 4HG2A 5KG4A 4IDPA 1UPFA 4MA5A 2JLBA 5JW6A 4KAJA 4MK4A 2JEOA 4OHFA 3D4PA 3AEUB 3T4XA 8ICHA 3N0WA 2A58A 2GA8A 3OEHD 4C14A 1CLEA 3C41J 2I7VA 3ESCA 3HP1A 4PPQA 1M7HA 4F11A 3ZLVA 1Z0FA 4DLKA 3RJJA 4IUCS 2EYQA 3ZDRA 4DJ5X 1R0WA 4F46A 3KCNA 3VH2A 1N6HA 2RHRA 4L07A 3C3XA 1KTIA 1RXIA 2YXBA 1KFBB 2CJWB 3W6ZA 3FMGA 4CM1A 2QENA 1QX3A 1LBTA 2OZKA 7ABPA 5KTMA 2Z4RA 1XZ8A 1QHNA 4QASA 5IJ9A 3QELB 4XLLA 4RFSA 1NN1A 4Y9TA 5K0FA 1UXIA 5E1BA 4UAYA 3UMSA 1NVMB 1DTEA 1TQ8A 5BQ5A 1O58A 2H0AA 3TFQA 4XWKA 3A9TA 3LBHA 1HTBA 2AEMA 1CJMA 5A4AA 4DLEA 3WOHA 2AI3A 3LP8A 3K5WA 5IEJA 2RH9B 5AKLA 2Y4NA 2C83A 3BE4A 1JSRA 3EF3A 3DW1X 3PHGA 1NU6A 3C7AA 1B8NA 3W1VA 1YB2A 5FNVB 2XCLA 3KKAC 1CRQA 4WXPA 2MMGA 3D8HA 3PNLA 2PVCA 3LS2A 3W7AA 2YHIA 4G5QA 5HR5A 2K8CB 2IZ6A 3RC2A 1I2MA 4BMDA 4LHWA 5KG1A 3ZGVA 3USZA 5D3MB 2QUJA 4IVRA 3VPDA 2P1ZA 3CS3A 5JWHA 5M5BA 4RCZA 3I9KA 4OAOA 2W6NA 1YVUA 4DT1B 3CR7A 1UPHA 1BFKA 4X61A 1TQDA 2ODEA 4NI5A 5AWFC 3ZDXB 2G08A 5TGTA 4X63A 3A14A 2D8CA 4GUDA 3JARB 3W5HA 2I3DA 2UZ3A 2XF2A 3IUQA 1RE0A 3SLKA 3PS9A 5JWRA 1N6PA 2ODTX 5HHTA 4EP1A 1JLKA 3L0CA 3KD3A 2AXQA 4NATA 9ICQA 2PS0A 3E1SA 5GTIU 2Q7XA 8AT1A 3FKQA 4MRAA 3LHDA 3HO8A 4J1NA 5F35A 3K6RA 5JG7A 1P72A 3OKAA 1ADFA 3BS5B 4FLEA 4DKJA 3NVKI 4CCYA 3NWOA 1H1TA 1NI4A 1W1IA 1Z08A 2ZYUX 5EN4A 2XB2A 4PG6A 4A10A 3DLHA 3L84A 2C7VA 4FNMA 3O92A 3IP7A 3SF0A 2O14A 3GT0A 5JD5A 5ICMA 2AN3A 3G8CA 4OSEA 4XDHA 3FMFA 4EY3A 2YW9A 3ZS9A 5KFLA 1O89A 1P3Y1 4YIHA 3FCUB 1G3IA 4CW7A 1HT1E 3S2EA 4DF3A 1NFQA 2C58A 4UHHA 4V0ME 4EFDA 4YP1A 4EG7A 3HCPA 4V0SA 3VV2A 2NAFA 1ISHA 4E3ZA 1IPHA 3IT3A 4L95C 3AL3A 4OJQA 1XB2A 2WU0A 2P4QA 4XRHA 3CCCA 2ZFUA 1ORTA 2WB1C 3QLEA 1MFPA 2POCA 4N8SA 4AZ3B 1AK9A 1RBYA 2OB2A 1VSTA 3VMMA 4F5QA 3EQ6A 2F9MA 1BA2A 1K6JA 1JYEA 2P65A 1P19A 2X1MA 1B26A 4H59A 3TLAA 2ATVA 1QIGA 3AESB 3WNDA 2W00A 3ZDBA 1FFYA 4JLNA 3L6UA 8ICIA 5BWOA 2C5HA 3HMKA 2J0SA 4GXRA 3D3WA 4K3UA 1UWKA 5IKOA 4IKEA 1K08A 4LDJA 2C9BA 3OZGA 1WDKA 2OQVA 2H1OA 4V0KA 9GPBA 3MCZA 5J1SB 5FBHA 5IVKA 4CGYA 1R9JA 5KC8A 1IY9A 1S2NA 4ZAVA 1NLUA 3S8MA 1SCUA 1FDRA 3EHDA 4KLJA 2CV1A 4UDOA 2DY0A 4FDAA 3EW7A 2JGEA 2FQQA 3A37A 2R1ZA 3Q88A 3OIDA 2QTRA 1U3FA 3W5JA 4D80A 5DG8A 3ILHA 1FJ2A 1E89A 3DD5A 5IU6A 4TMTA 4TS4A 1EA5A 3G5UA 2QG6A 4C6TB 2JG3A 3B20A 1KIMA 4EA6A 2V0CA 3TLZA 3M6XA 2X3FA 2PD3A 4DCPA 1MOQA 1U45A 1P9LA 2IYSA 2X6RA 2EJUA 3TL6A 4Q7MB 4ZXFA 3CT4A 3KB1A 1GD1O 2RGBA 4LJ7A 4KLLA 2XUKA 1T4DA 5IYZA 2PGAA 4NZOA 2ZTMA 1BDJA 1MRSA 2W6MA 1F6DA 1S97A 1QMPA 2XGOA 3HWTA 4MUNA 3AR2A 3OURA 4QZIA 1SUWA 4UUOA 1GZ5A 1T3SA 2A4KA 4I4TF 5GOZA 2K89A 3RV4A 1ZL2A 1I10A 3HFJA 1JJAA 3DTVD 5HIJA 1FVXA 1R6VA 5L9XA 1VDMA 1QK5A 4Q4AB 2OTCA 4FFVA 3DHYA 1VL6A 4NCNA 4DMMA 3L7LA 1AS2A 3H83A 4K26A 1N5RA 1B0UA 4MW7A 3UK2A 2VHYA 2YCBA 3DMDA 5LWQA 3DBRA 1RWWA 5JH7F 4P4GA 1QXSA 2JJ1D 1AF7A 2OHHA 1ECCA 1EUCA 2P77A 4LOLA 8ICJA 1OGJA 1RWXA 1N7GA 4CM8B 4BO0A 3QU5A 4NMWA 2X22A 1ETHA 4ZEVA 2ZJ3A 5KQMA 3NHBA 3OEEA 2H11A 1Y4ZA 3R75A 1GRQA 5MF6A 2ZKLA 4N5LA 3CRMA 2XQJA 2Z3ZA 3QLVC 3FE2A 2EP5A 3Q3IA 4WK0B 2PQ6A 1R15A 3H05A 5B37A 5FBWB 1RI3A 4ZH4A 1YR2A 4FJ2A 3A28A 2BQUA 2R8YA 1LQUA 3HZRA 4AS3A 4M7WA 2LKDA 1JIUA 1VJ0A 1RQLA 5A5EA 1XJ0A 1CJSA 5TXGA 1XAIA 3N2NA 2QD3A 2VQSA 3GNLA 1P2SA 4W8HA 4TOIA 3RVNA 5IJ9B 4EGQA 4RFSB 5ALZA 4XX0A 2PEZA 2O7SA 4MEJA 3TW4A 2D2EA 2AHOB 4RD0A 3CPSA 4A0HA 5M04A 3HCBA 1A8UA 1EG7A 3AFMA 3WC4A 2B1QA 3B2QA 1QFXA 3H0EA 4JLSA 5F76A 1O4WA 1Y3AA 3UF0A 2MSLA 3VNVA 2QB5A 3A4MA 4S1VA 2JCBA 3PUIA 2UUOA 3P0HA 1DAMA 5DULA 1RM5A 5KT6A 5AXCA 4HNUA 4RFLA 2ZBVA 5C1DA 5EC8A 1IG0A 4MKFA 4HUJA 1IXZA 1RAHA 1DMSA 2YHIB 2VUTA 1E92A 4KXFB 2HHHB 1U3CA 4CKXA 2Z8YM 1VHJA 4XA8A 4EKIA 4ZHQB 2OCBA 1F0PA 2G82A 3M6WA 2GNOA 2RJNA 3ANLA 3USES 3NW9A 1QE3A 5BW6B 2BY4A 4NDAA 2CE2X 2KZZA 3EGCA 4A91A 2O20A 2HWUA 3OLZA 3AQFA 2JVKA 3VBEA 1KSFX 2ZRNA 4PYMA 4LZOA 4B8YA 4LCEA 4AO8A 3FWNA 4A1OA 3SS7X 4J7UA 2EQAA 2QIOA 1I14A 3VX4A 1SQ6A 3HR7A 4BMXA 2R79A 2VP3A 3ET5A 1JLLA 2E8MA 3I2IA 2EAOA 2AC2A 1IU9A 4RS4A 3DDHA 3KS9A 1S89A 3GH3A 3ZHQA 3GFPA 1FNNA 4IG4A 4YS6A 5I8PA 1S2LA 2EKZA 4YRFA 5F7XA 1KL9A 4PRYA 4FHGA 5IZ4A 1TFRA 3PLAE 5J0XA 4DLPA 4DS5A 3WJ1A 4TSRA 1Z63A 1N3YA 4LMPA 3AR4A 4XIFA 2X40A 1V25A 4DLBA 3JX9A 2HOQA 3G5LA 2HX1A 5EJIA 3IJ5A 2IEBA 1XZLA 4CCYB 4Q7QA 1OFTA 1NI4B 1Q0PA 5H70A 2MCFA 2UAGA 3HG7A 3RJ5A 1M54A 4G24A 2FDXA 3CC8A 3OZAA 1VMEA 3I4CA 4EHFA 4O5AA 3NQ41 2WTNA 3AC0A 1GZVA 2JFXA 4JBHA 3EOBI 1ILWA 2B5VA 5CGQB 3C5CA 5IC4A 5FOQA 3CUWA 2B69A 4XUSA 3DDSA 2OLEA 5J0TA 4Q12A 4TSFA 4YMLA 5JD6A 3IQXA 3RFUA 1F3LA 3OX4A 2HUNA 3VO1A 2MU1A 4D97A 3ZDQA 4JB2A 4YYEA 3QG5A 4ZAFA 5HSGA 2EP8A 3GRZA 1W6RA 1FXSA 1OT3A 4D9MA 3DAPA 2JAPA 1S5PA 2E9SA 3JPQA 4CEJA 4RJLA 8ICBA 2H0QA 3B9BA 4R01A 1TJYA 3ZXSA 1Y8RA 3DEEA 1H65A 3OOEA 1NJ5A 1SHTX 3EBOA 3KVRA 3KVVA 1SHKA 1PYGA 5J29A 1XWWA 3KAQA 3UGQA 2EFJA 1N8SA 2KLHA 2RMKA 1B76A 2A59A 1NFFA 1IWOA 3ITEA 2JD2A 4I50F 2GCPA 1T5TA 1Y80A 1PW5A 1GUDA 1YU6A 3D3WB 5LDHA 1QGYA 1DEXA 1EXWA 5ALTA 3PT9A 3MLBA 4MB0A 3SOPA 1FTNA 3LCJA 1TW2A 2QTNA 5DWQA 3SSNA 5KG5A 2VNKA 1CTQA 3EG5A 3HDJA 2HHXA 3VR4A 3V80A 2F3UA 4KFSA 1PQYA 2GILA 5AJWA 1NUUA 3TOCA 1FSFA 5FV4A 2W3SA 1KS2A 2E8OA 5I7AA 4OSOA 2A1TR 3ENKA 2CLFB 3IA2A 4IS2A 4R6XA 2GBPA 3PNPA 4OHXA 1JL3A 3I04M 3PQFA 4XUGB 1JXMA 5T3UA 1V16A 2HF7A 1NTRA 3HJAA 5ICSA 5CURA 3OTHA 4OYHA 5KL1B 3LLUA 3ANSA 3ZJ5A 3BE6A 4HVLA 2OYYA 2YHSA 1SIBE 2VQFB 3I5MA 3BDAA 3AFIA 4A8JC 2XIQA 4J3NA 1U8AA 2YXLA 3RSHA 1YQGA 3N74A 1NVAA 1W76A 1GAEO 3OWOA 2BGRA 4PHPA 3H5NA 1S76D 3I64A 3WK4A 2H4HA 5IYZB 4C03A 8ICKA 2C84A 2QLBA 5SYNA 2ISPA 2R11A 4Y2QA 1XZFA 2QKQA 1G5PA 1JZSA 4OXQA 4QNMA 3S40A 2I4IA 4C3VA 1LB2B 3IHWA 1M10A 4MS4A 4RACA 2OYRA 3HADA 3N7PD 4R1UA 4Y2PA 2PV0A 4K7JA 3WL8A 4DTIA 3HWSA 3FFXA 4FMDB 2ORWA 3AFHA 4F86A 1GRNA 3OX3A 2MSCB 3ZLTA 1AUXA 4ZCQA 4AUNA 2GMWA 3GT7A 2BGNA 1PT8A 5HTOA 3N7AA 1FNMA 4U2GA 1RBZA 1NSFA 1JBKA 2F1IA 2I6SA 1JMKC 1TEXA 3HGMA 1V6CA 2E4XA 3CLSD 4G37A 4YLEA 3DBRB 4JGBA 1T1SA 2WNSA 4ZO6A 1EUCB 5ERXA 4MMZB 1I1HA 4D9KA 3C15C 4M1KA 1P0MA 4OHBA 4A16A 2WUWE 4RZ3A 3TRFA 3GAFA 2PSEA 1ZMTA 3LX5A 4JQSA 4Q7KA 4YBRA 5H8WA 2OGTA 3O0DA 2GPJA 4ZYXA 521PA 3VX3A 3SN6A 1ZGAA 5DGXA 4LZPA 3I6ZA 3EDQA 4NJEB 4G0QA 2PSHA 3CUTA 1RQRA 2VYCA 2AUTA 5H68A 2EJCA 3JAWA 2XUIA 4FONA 4TTAA 2WKWA 3CSUA 3LQQA 4M76B 4AJEA 1C4WA 2FEAA 1GCOA 1RMTA 2W9AA 4AWXA 1CR6A 3IBFA 1WXQA 4YAGA 3QX3A 4PHGA 2GN6A 1FFCA 3AW8A 3FWZA 3A3PA 2RDMA 1YRHA 3H0KA 5IJXA 5K3EA 1E9SA 2JXJA 4XX0B 2VP4A 1KI6B 4IIHA 3PU6A 2D3DA 3D5EA 3WLNA 4DGSA 1LNQA 4FB5A 2EQ5A 2XCQA 1OXVA 4YVZA 1QV9A 3EEYA 3VZRA 4E5MA 2HREA 2QRHA 1U2DC 3RHSA 1SGGA 1M0EA 3WSWA 3QUCA 1RC0A 2ADOA 5DM60 5GPBA 4XGRA 1SOUA 5CDUA 4EELA 1UK8A 2V6MA 3FBGA 2VI5A 4L9WA 2YC2C 1XC7A 3FX2A 3GZNA 4JYZA 3G0HA 4NYIQ 1GDDA 2R1UA 4J0CA 1K7XB 2PCJA 3B3JA 3VR4H 1X2EA 1G8YA 1BRTA 3LKZA 1NRIA 4NCKA 3R3SA 5J58A 3GEHA 1SB9A 3EOAI 2O7RA 5AVQA 4BKQA 2FEWB 3WGTA 1NBME 4FYXA 1DUVG 3F8TA 1CY8A 2VDJA 1UCVA 2OILA 2QTFA 1RQPA 5JNTA 3FNEA 2J0VA 4MWBA 2JGAA 1KMMA 1ZNYA 1RD4A 3AKZA 2GFHA 2HBYA 1JLMA 1GPUA 1JLLB 3AHFA 4WY5A 2ZSUA 3DXZA 5H5JA 3KU4A 3AR8A 3RVDA 3F1LA 1PKXA 5T8KC 1POXA 1J8FA 4GC9A 4FYVA 5FTJA 4TKMA 1DRKA 2O3RA 5BR1A 1W9MA 3C3CA 1G2PA 4MV4A 4HTFA 1FJGB 2VRCA 4X1KA 4LC0A 1XQ9A 3I9LA 1KOLA 1SURA 3G2KA 2E4WA 1Z73A 3QPAA 1BN7A 4QULA 3MGKA 3F5MA 2ZCVA 3R7NA 4D3XA 2XYPA 3PXGA 3HSSA 4EZBA 1RE1A 2MSKA 4PM4A 3HUDA 1U2GC 4P7BA 1U8EA 1SVOA 1F12A 1Z5ZA 4TTVA 2KE7A 1G59A 4X54A 1SUEA 1EVYA 3W90A 1P2GA 4DF4A 5DE3A 3HXLA 1SBHA 3AMZA 1YR8A 1YK0A 1FX0B 2ERXA 2BCJQ 2I4NA 1ST3A 4WEOA 2EJVA 4TRJA 3KIPA 1KJ8A 5HF5A 1YQQA 3I4LA 4CEJB 5CDGA 1NA5A 3GOQA 1KQOA 5DTIA 1JIXA 2PXAA 1YWGO 3DUWA 1Y8RB 1CFJA 1IJBA 1VIMA 5CXSA 3LKVA 2FZKA 2H1IA 4LK3A 1Q83A 4YDHB 4EHKA 2HSDA 3CCFA 2GJ8A 1WUIS 2I7XA 2IH5A 1BNPA 2NZVG 2NAPA 1ECWA 1YDEA 2XZDA 1YZ6A 2I1VB 3TAUA 4BCDA 1Z3EB 3Q8WA 2GBCA 2PBRA 2ZBUA 2WF7A 4HQ0A 4LSMA 5AKGA 4YMVA 4TL7A 1SXJD 4IS7A 4KRGA 2DJIA 2PFSA 1Q2XA 5A4DA 9ICNA 5BY2A 1GGNA 1UJ5A 1OH8A 4MKIA 3DKPA 1JJVA 3EUB2 4QEDA 2D5LA 2QSYA 1W36D 3DQPA 2X9GA 1QM5A 2ZTEA 1J56A 3ZXIA 2PXIA 3RIHA 4YP5A 3O26A 4U7HA 5CA0A 1V16B 3WQBA 3CNQS 1AM4D 4MLDA 5DNWA 2Z3VA 1NJYA 2ZPAA 3VVBA 2E37A 2WQZA 2QQGA 2WV7A 3CVJA 5ALLA 3MGHA 4MWGA 1LV7A 4FHEA 5CDHA 3EWSA 2OGWA 3JVUA 2VAXA 1JHZA 4D46A 2Q6IA 3N0VA 2IHTA 4LVNA 4HNSA 4IM7A 4KTVE 1RXYA 1EWVA 1GEGA 1FYXA 2W48A 3A6PC 1HUOA 2X1HA 3RRHA 2GWHA 2QTAA 3WGQA 3TI0A 3NANA 1AKEA 2WHYA 3HN6A 4L8VA 3H2IA 1ZAKA 3VTAA 5IM4F 3RSCA 2OCPA 5F52A 5ILGA 1KZYC 1J2UA 3QQPA 1N34B 2CFIA 2W4QA 2EGUA 3OIFA 2ONCA 1Z5NA 1QTMA 3E81A 1SU4A 3CSSA 4MS4B 3IIIA 3THYA 5D7BA 3T7SA 2GBLC 1EUZA 1PJBA 3QTBA 1F14A 3I5UA 4CM9D 3PXEA 4WADA 1U7PA 3ZG6A 2O6LA 1YULA 2JH3A 2C61A 4KP7A 1E2BA 1OW3B 5AMXA 2A9OA 2WAQC 4Q4DA 2I76A 3KEOA 4L5AA 3BIXA 4FUQA 4E15A 2YIMA 4D26A 5JZMA 2BGUA 4EOGA 4LTNA 5IBPA 5FA6A 2WSMA 2VK1A 4R41A 3GRAA 1KS9A 5INTA 1GZUA 1GZ7A 4Q3EA 2DHEA 3M5CA 5KIAA 3GLGB 1PGQA 1N63A 4PYIA 1Q14A 4PLPA 3V4RA 3N2YA 4Y6SA 2PJUA 2PVSA 5EGNA 1XNJA 2IBSA 1V8DA 2H7VA 3ESBA 3KXLA 3DZBA 2FPKA 2RB5A 2IE0A 2YZGA 1OIVA 2GTPA 1KYTA 3LK7A 5CD9A 1STOA 2KYRA 2C2ZA 2X7HA 2YJZA 3WP1B 5FR2A 5JRJA 3PFGA 4ICIA 2BMVA 2XTMA 1ZI8A 1JEDA 3RSFA 2YFQA 1YBAA 3K92A 3JAWB 1M6WA 1WJGA 2HHWA 3OHSX 1J6UA 4ALJA 5AVVA 3DV2A 2IBMA 3DAFA 2WYVA 4YI3A 5JUMA 1SQFA 1XMPA 4W8OA 1CWUA 4D25A 4XYLA 2RAUA 5DT9A 2V7WA 3SYMA 2QL7A 2OCYC 1BX3A 1CD5A 1BVUA 3DLCA 4I4NA 3U5TA 2FSPA 2QNIA 3PEFA 1XEFA 5KYNA 5EHGA 1P45A 3NGMA 4FMCB 3PEUA 1H5UA 5JRZA 2XZLA 3RYIA 4RQAA 1SRRA 5AW3A 5CB6A 1YRYE 1Z5VA 4KREA 1E3LA 3I2FA 2KV2A 3WMXA 3IVMA 3U3JA 5EJEA 4PYOA 3EQ7A 2C5BA 4OHMA 1PJLA 2HLHA 2PS9A 4IWNA 5TT1A 3BYZA 3I0ZA 4JX8A 1DQZA 1H93A 4QWWA 4YMOA 2DFVA 3CH4B 1SXGA 2WU1A 2UVRA 2ENUA 1TLFA 3T3MB 1PQUA 5ADHA 5B6JA 4BJ1A 3W6UA 3A0BU 4HDCA 2H2DA 3JWJA 3GQVA 4GGMX 2CLMB 4ED7A 3IM1A 3STXA 5T57A 3M2TA 4M89A 2VJYA 4JUCA 1JXQA 4ZOHC 3PPVA 4IEFB 3IVXA 4YWJA 4DUZB 3PX4A 2V7PA 4K3VA 2QQEA 1RJ9A 2Q2WA 4DV4B 4ZYWA 4D98A 3I5YA 1VZ3A 3WY9A 1EM8A 5L7YA 2PX8A 5KYXA 1W2GA 4C43A 3GEPA 4HMPA 2B8NA 3QVSA 4RGVA 3K9WA 1QF6A 5ALXA 1EUQA 1V35A 3A1FA 3BQNB 4YJ2A 1I2AA 4PG8A 1GGMA 4MUFA 1DKLA 3IOMA 2J3LA 1KO5A 4DA9A 5AM3A 1ZK2A 3OZBA 4ENUA 1IBCA 3BK1A 3GDOA 5HR6A 4OJMX 2P4HX 4HTFB 2BC9A 2OWDA 5F7OA 8ICTA 4X1KB 1GG5A 2ZZMA 2OBYA 4UQPA 1M5RA 4HWTA 1F7UA 2IHBA 4JI0B 5ALQA 4QGSA 4IKPA 1NBEA 1E18A 3HFSA 3CZRA 4F3YA 1XWFA 5K0ZA 4DRYA 4W6ZA 2OT3B 3LXXA 3ISJA 5HF9A 1UDRA 3OTQA 1UZMA 4KNWA 4E94A 1ODLA 4C5AA 3WAJA 6REQB 2V5UA 3HBAA 5KNCA 4CM6A 4DNOA 3QUQA 4DUPA 2Y0SC 1H2BA 4LAFA 1SUSA 2ORVA 3LJKA 2HLNA 1IXRC 4QWDA 1NN5A 4A26A 4IYRA 4CG1A 4FGUA 2A84A 2XNDA 4WZ6A 1XDZA 4YMGA 3BGSA 2I2AA 2NUPA 4BNXA 2D1TA 3T8YA 1OAKA 4HDNA 3H5IA 2X9VA 3ET4A 3H04A 4HD8A 4PFJA 5JHGB 2PMBA 1DEHA 1MAWA 4UVHA 1H0KA 2GF2A 4JROA 4I8DA 2DPHA 2IU6A 3MCVA 3JQBA 3MA0A 1JEQB 4CIXA 2WJ4A 4ETIA 5K0SA 3RDPA 3D54D 3P1JA 2QRJA 1BPDA 5FADA 5A9SB 2GZRA 3WQSB 3F6CA 1PTJC 3O9ZA 3O38A 3LX6A 4QBIA 1K98A 5CVVA 2DECA 5KHAA 3ST7A 3RFVA 4ZVTA 2B9VA 4LOAA 4LWZA 5EZYA 3QIVA 1L4MA 3QVOA 4OQMA 5EWGA 4YV1A 2DX7A 4XUDA 2X0DA 2HSGA 4PXAA 1Y4DE 5A4FS 3SFZA 1E7YA 3VDQA 7ICEA 2QI9C 1WOMA 2QM7A 1QORA 2E48A 3PK0A 3OLYA 4LKOA 1WB9A 7ICGA 5TB5A 4NYMR 1TC1A 1JR3D 1Z0IA 2GPYA 2CDAA 2WYUA 2BUCA 1DDGA 5FX2A 5A02A 3U40A 3S1LA 3F5QA 1G7RA 3C7KA 4KL8S 1AZTA 2K4IA 3ZH2A 2JRLA 1CUBA 3H86A 4ECTA 1YQWA 1T34A 2JAWA 4A5OA 1A8QA 1X92A 1N5DA 3N8IA 3AJAA 4IUBS 5EERA 3CNEA 3PNQA 4P82A 5B3LA 2BR5A 5B58C 3WVNA 5G02A 5FTLA 2PV7A 2IU4A 2BBWA 2JGJA 1NM5A 1RFLA 4O9MA 1E1LA 5CIYA 4QZGA 4DSUA 2OUIA 1EFDN 4DPMA 1E7RA 4Y2UA 4YP3A 2K4HA 3OY2A 4B0PA 4O5OA 3FOBA 2ECPA 1H2XA 4HGOA 3TQFA 1NRWA 3ANTA 1JEOA 1V41E 2ZRGA 5BN4A 1U7OA 4JBLA 1Q5PA 3OU6A 1PJ8A 4WDRA 2C77A 2ARKA 2P6PA 1EVKA 1LW7A 4NBSA 1CFZA 4G0XA 3D7SA 1EZZA 3UHJA 2Z1MA 3K35A 3EQZA 1PVRA 3T7TA 5A1TA 5F33A 4GMFA 3FVQA 5AM2A 5JJLA 3BHNA 2FQ1A 1BKYA 1QP4A 3J81j 3F73A 3QE0A 3N9IA 5ARCA 2VJNA 1F0NA 2Y9UA 1GA6A 2QD2A 2G9ZA 1XSEA 3T3FA 4I9UA 5BSGA 1DXHA 3VU9A 2O6HA 5LD2B 3RH6A 1LVUA 5ULLA 4DDHA 2VLIA 3TIGA 4G2NA 1TI7A 4NMMA 5KT7A 1UWVA 1U2SA 3L82B 4QIHA 2JBAB 2PH3A 4QQFA 4LJ6A 4W5HA 3U3MA 4HLNA 2IU3A 2BRUA 2VYFA 1DKQA 5IMBA 4LYYA 4KUGA 1ZVVA 3AR5A 4I1PA 3KJNA 1X1TA 4BV8A 5KNCH 3A05A 5C4GB 1SC1A 4IRDA 5LA6F 2IFTA 1U3TA 5DBCA 4NV1A 4E1VA 5C9ZA 3I4FA 2OBLA 1C0KA 1QANA 2BPOA 5H59A 3EULA 1QHEA 2YZMA 4MCHA 1PNOA 4BGVA 2R4TA 4Q1DA 1D2AA 3D6TB 5JXHA 3M9NB 1DKMA 4BNWA 1CZUA 1VGVA 1KZ7B 1DKPA 2FZCA 2BCEA 3JD1A 3QYAA 3H84A 2OO7A 3UXMA 3RYIB 4U6NA 1X7HA 1N1GA 2QX6A 1MT0A 4L73A 4TZ6A 5IG2A 3A6EA 1H2WA 1ISMA 1ZHFA 2CNKA 3UUFA 3VDXA 2B4RO 3F46A 2R8KA 2H3VA 5K3SA 5C8XA 3G2PA 4F21A 2ZROA 4OD0A 3QVVA 2XW6A 3IEXA 3EX7C 2O8CB 4OJ5A 1V8OA 7ICMA 3WK5A 4ZV4A 3O0FA 4HPWA 1Z1VA 2V9CA 2QV7A 3MW8A 1JA9A 3BB1A 1HXHA 4GECA 4C0HA 3IR5A 1K1QA 3QWHA 1J09A 2XCRB 2C59A 1MX1A 3Q40A 1RJ9B 1JYFA 3H9GA 3EQ2A 1AGYA 1R6XA 1CQJA 5KFJA 5A6SA 1SU8A 4J3FA 1EM8B 2H9IA 5IIMA 5FEMA 1EAYA 1NE7A 5C1BA 5KYXB 4DR4B 5HIKA 4S3MA 5CG1A 4B33A 4YJ2B 1U98A 3RS3A 2G25A 2JATA 3V4PB 2WSLA 1E59A 4JWMA 2F2AB 4KLUA 4AN0A 3R9WA 1M1NA 4KPEC 3KPYA 4DJTA 2Q0XA 4IRKA 4CEHA 3CX8A 4DNFA 5KFSA 2PMZC 2DQKA 2H1RA 1G291 1P62B 1TLLA 1T8SA 4G07A 1KKMA 2IYZA 1G17A 1QP8A 1WCYA 4UCWA 1ZWLA 5J2TA 4MVJP 1XKTA 1WF3A 3N58A 4FKBA 3FUWA 2V7EA 1IN6A 4XW2A 5ECWA 1SKBA 1ZONA 1N6KA 4MS3A 1E2LA 3QE2A 3TDNA 1RNLA 1UJNA 1QH9A 5C5CA 4RIIA 1NR7A 2ZRDA 1ULUA 4JU9A 3KXKA 5I3CA 3MR3A 4AJNA 5DPMA 3OZUA 5IEBA 2ODWA 3SENA 1N4AA 1GDTA 4QJIA 4NEQA 3WRYC 1G60A 3HBJA 1MPXA 4Y1FA 2HJSA 1T5SA 2E1PA 1AZSC 4QXMA 2Z5VA 3DSRA 1HSZA 2HF9A 2R6JA 3VPBA 2AQ8A 3CW9A 3VDRA 1QQ7A 4P5DA 3U5ZB 3CHYA 2YX8A 1GNPA 2GEFA 4O2BF 3R7LA 10MHA 5J2FA 2C8LA 2YWXA 3U56A 3PFFA 3NTQA 4Q3KA 2WU3A 1DKOA 5HE8A 4DFMA 2PANA 3ZTWA 2Q1WA 1YA4A 1H22A 4JITA 1CDOA 1WDTA 3U19A 1U8TA 1DRVA 3S28A 5EZYB 4JFAA 4NMHA 4CIYA 3KD2A 4B2YA 4M0AA 4L16A 2D74A 1C7EA 2AJCA 3NIFB 2FUCA 1FSPA 3WBBA 4Q1EA 4MI9A 1U6KA 3AUFA 1GU7A 3ISDA 5KVQA 3VUFA 5AXDA 2HIHA 2C2KA 3OZVA 5DNUA 1IE3A 2GFIA 2YYAA 2Z2IA 4FZRA 1EP2B 4NNJA 4TWJA 2LPEA 1GARA 3ID6C 2XYGA 2BVNA 1MB2A 1EK0A 3L6BA 5AUOB 2GS9A 5JYCA 1AQUA 2WP0A 4IOMA 3FWKA 1RAIA 3OSNA 1O5TA 3DMRA 3OT1B 1GKYA 5AQ1A 1KU0A 3PDJA 2V7QD 1T1EA 4IXDA 3JQGB 5J2DA 1N6RA 3GGSA 4FGWA 1VSBA 4R9SA 2QE7A 3CT6A 3E5HA 3QJYA 2JHPA 3I3SR 5EE1A 4DY6A 4LJ4A 1UBCA 1JEEA 3VZQA 1U0GA 4U7PB 2BJHA 1L5RA 4WAUA 3ABSB 4QZCA 4E4RA 3HJFA 1PSWA 4LZAA 4F2DA 5EIHA 3TXXA 3BH6A 4Q44A 4KXUA 4HGRA 4KLAA 3D3JA 5C7OO 1NR5A 3KHGA 4I08A 4YYZA 5HWSA 4FSHA 1E79D 1L4KA 2W2XA 4QXQA 4DSAA 1ECFA 1PWYE 1CUUA 1YVDA 2FMQA 2ZWIA 1NDUA 5EE9A 4ZDIA 4HK4A 1ZM4A 3NLLA 4BDSA 3ZEIA 4GVPA 4PNZA 1N4DA 3KVYA 4CE6A 3VOSA 5KSOA 1NUAA 3AO0B 2R7NA 3FTPA 3GVPA 3BG5A 2GF9A 2EDAA 1XTQA 1S0OA 2HAEA 2MWMA 4HH1A 2X9LA 5H3LA 2ONJA 4NM2A 3IR7A 3ZU5A 2EIHA 1WLYA 2XMBA 1XBTA 3UCFA 5JZBA 3ICEA 2IF0A 3OTWA 1VXOA 3OLWA 1XEXA 3IAUA 3PQ6A 4MROA 3VU9B 3ZI0A 2DB3A 4MO2A 2Y2UA 1G8KA 4R68A 1ECPA 1Z22A 2VHVA 1VG0B 4RMNA 1E9EA 3I5AA 4F2WA 2B7LA 3KM0A 5BQ3A 4Z4EA 2V5VA 5DXFA 1YI8A 1G5RA 4W1SA 3IO3A 3H2GA 3T3NA 3R0QA 4KO2S 4RJ2A 7ICIA 2BTEA 2BJVA 2EZZA 2W9MA 2VH1A 1CZKA 2IZ7A 4FFBB 4RD4A 4XVCA 4N6OA 2BCQA 5IC6A 2F17A 2ZI5A 1CUKA 2ZUBA 2QAJA 1KKLA 1VI5A 5J0QA 4TVOA 3QLTA 4UM7A 3C5WP 4QPDA 1L4UA 1VBKA 5BORA 3G7SA 4MMXB 2HT1A 2FOIA 1QVZA 1J4AA 5JOQA 2EFCB 2AN1A 4E70A 1SD2A 2D5BA 1JU3A 1GAWA 4PTYA 1R27A 1N2OA 4BFTA 1T9GS 5BWBA 2ZRIA 4FWBA 1DO8A 1SMKA 3OE7D 3DT6A 3AMVA 1EFCA 4JODA 3AVWA 1FVOA 3DFKA 1PJ2A 2OHIA 3QFSA 1IJFA 1B0ZA 4GXTA 2QJRA 1CRXA 1DUIA 2IVZA 5HBGA 5E4YA 4H7DA 5G3YA 4QL3A 5G4KA 3HCCA 3OBIA 4CDMA 9ICEA 4JWTA 5EMNA 2CRXA 1ND5A 4YMMA 4C2BA 3W2IA 1AK2A 3DL4A 1QIJA 2CBZA 3FPAA 4CG3A 5KTNA 3TQSA 6AT1A 4EGJA 4DMKA 3FZNA 4ENPA 2VDMB 3W5IA 1CQJB 3LT2A 3OPQA 3VR0A 1HX7A 2J6HA 2GVDC 2QMYA 3GLHE 5GM2A 3KUKA 4TUSA 2HOFA 1SIUA 3JALB 4TUYA 5HKLA 1M1NB 4J9MA 1FA9A 1J49A 4CEHB 1WS6A 2Q3BA 3DE6X 4Z1MA 3IURA 4YJFB 2FWAA 3B12A 4UMEA 3LZCA 5A3JA 4OQNA 4MOWA 1ZVJA 4WWHA 1V95A 4KFTA 2RDIA 5J2TB 3EH2A 2FR8A 1GL6A 2QJTA 2Y2VA 4F3RA 5TPWA 1TQ2A 1RHQA 5KQSA 4MS3B 3DKVA 2LXNA 5SY9A 3Q7TA 3UUEA 3VSCA 1XHLA 3PO5A 1YBHA 4PV7A 3MJEA 4EPWA 1ZH2A 2CNDA 4EZ9A 4YUXA 1NXXA 1ZGJA 1EVZA 1K7FB 2EFYA 3OJLA 3L1VA 1QZXA 3FBWA 3L7JA 2QN9A 4ND4A 4EPTA 4BTVA 4FEEA 2P41A 2A8YA 1KAQA 4ZT3A 2DP4E 2PBZA 3V8EA 4BFYA 3KQOA 4ENRA 3LUFA 5J0SA 5BPHA 4B7ZA 1IYZA 5A0TA 4K6HA 1W44A 5COAA 1U3WA 4W5NA 4EGSA 5KBYA 4D99A 2PWBA 4OA5A 4PGFA 4ZRNA 4MUBA 1R5OA 1R9NA 5J5AA 2WB4A 2O7VA 4UBJA 3DONA 4A3SA 4YAUA 1C9JA 4BE4A 2VT6A 3E18A 3NOXA 2KVSA 5EUCA 2GHRA 2AOTA 2KFZA 1RIFA 4LXGA 4F3OA 4QZDA 1B1CA 1VYVA 4Y2GA 5A9RA 1WU7A 5K9ZA 2IV7A 1MEEA 2ZVJA 2R8HA 3OESA 4OLJA 4Y0VA 4FJ0A 3FNGA 3VZDA 2VIIA 5KSPA 4RNOA 5AW9A 2V65A 3K96A 2NV2B 2ZXUA 2BDPA 2W0MA 3K53A 3CLHA 4GQIA 3IE1A 4UB1A 1Q3TA 4J0KA 4UB4A 2FSGA 3BHJA 2B82A 3UK1A 4GM1A 2GN2A 4LIPD 3ZGXA 1RWPA 1XNQB 3EZLA 3LUDA 3UGTA 4KH1A 1C81A 4G5SA 2V8OA 3H8MA 4EX7A 1YONA 2AFHE 1V1RA 2A35A 4U2KA 3ED1A 4E5YA 4DY4A 4O5CA 1SCKA 4JJAA 3ICPA 5JSZA 1P4JA 3LGAA 3D5QA 1E94E 3WOVA 2HSJA 6LDHA 4AI6A 2JCGA 3ZDDA 4X1YA 5L3VA 1QAOA 5DF1A 3PZRA 2G70A 1R10A 3ZU6A 5K0CA 5FHQA 3L8HA 4K9OA 5TRTA 3PQDA 4KXLA 1Z5GA 3DWIA 4M9RA 9LDBA 1ZQUA 2OHVA 3ZCXA 3ROPA 1NJSA 3QZ7A 1KFEB 1GZDA 1CUHA 1OGIA 2Z6VA 3OJEA 2QJWA 2G06A 3NEAA 2LRHA 3ENNA 4FSDA 4MW9A 1R7RA 1Y88A 2Q62A 2V6JA 1MOSA 1VLMA 3UV3A 4WZBA 4ZOLF 4OU5A 1U28A 3BICA 3ZVLA 2J67A 1GLNA 1BTOA 3A6GA 4S05A 3LO8A 4M49A 5IHXA 2HQOA 2KTQA 2Q1XA 4IIYA 1VDVA 1G8SA 1XPUA 2G0TA 2O1SA 1O54A 5C34B 3LUGA 2WKRA 4RABA 1C1HA 5AP9A 2E6UX 4UU1A 2R8BA 4EI7A 2WLTA 1NMYA 1OZHA 4AMGA 3Q7SA 1XEXB 4N8DA 2J6BA 2C0PA 1LDYA 5L45A 4J0FA 1JFLA 4OMFG 4FBGA 1T4GA 1E69A 2WFZA 4RYDA 2A3VA 4RQ4A 4A1FA 5D3KA 1CUFA 5BNWA 1NJFA 4O2RA 4ELVA 3SC3A 3P5BA 4YAJA 3J7TA 2QRUA 3OZSA 1XVVA 1HEKA 1AKNA 5DGBA 2EZ4A 4J2TA 4XJSA 5BWLA 1DCMA 3OJSA 2FJ6A 1DJQA 2M6SA 3LMKA 4RDHA 2VC2B 3NVYA 2AI1A 1PCXA 3MNFA 5BT8A 2NVOA 2BBOA 3CEHA 3I37X 5EXTA 2VZEA 3ABQB 3KJHA 2HVHA 2I6XA 5ITZA 1OXSC 4PY2A 3U80A 4RK1A 2VYNA 2LCFA 2GPNA 1Y42X 3INNA 4OQZA 3V55A 2YNMD 3WHIA 1N5JA 3WLJA 2Z5LA 4P4UA 5DI3A 4BAGA 1OH7A 2B25A 4E30A 1WDWB 1RYUA 4IRMA 3ZHOA 5DQHA 1LEHA 1PVVA 2BHNA 2HIGA 1YMUA 2QRGA 4URUR 1RLIA 2GXAA 3ETEA 4BMOB 2R8OA 4LUCA 2WHEA 3D02A 1CIJA 5LOVF 1U1IA 2D7JA 1CRPA 3C98A 4D74A 1Q1EA 3E23A 4RGBA 4AMBA 1KVTA 3PC7A 1DEKA 4NQZA 4P7FA 4EG1A 2DFTA 5G4KB 1S8NA 2ONKA 3U49A 3H9BA 5NLLA 4PG5A 2C4MA 1SCUB 3G2JA 1QZZA 2YJ5A 3ME5A 2HBRA 3AVOA 1UMBA 3DLTA 3RRNA 2HWYA 1FFSA 1KTQA 4AKTA 3L7MA 4QUJA 1ZJMA 2AI2A 7ICJA 5JNSA 4P84A 2IOHA 5KFUA 1FS4A 4ENVA 5KFOA 3PRHA 2AX3A 3QWBA 3DE0X 4CM4A 3IAM6 1YMQA 4QJFB 1ETUA 2AD5A 3OD1A 2V7BA 1TCBA 3BKWA 4ETWA 1AS0A 4Y7DA 1SBNE 1I9GA 5JY6A 3S8EA 1Q0LA 4JEHA 3Q7PA 4RPIA 4PZUA 2FXVA 3D2SA 4GSKA 3KPVA 3IESA 2A57A 3SI8A 2BFCA 2YY7A 2CXRA 7ICSA 1C3LA 1W46A 3DOEA 2EP7A 2TYSB 1NSYA 2CXXA 2RLTA 3N59A 2P3OA 2BHSA 3QLJA 5LNK6 4Z5XA 1NTOA 3FTDA 4NM1A 4H1WA 3LGXA 1ACJA 2Q6OA 3IG5A 1CQIA 2Q07A 2QL6A 1HFKA 3PXUA 4M4SA 1UXGA 4YMTA 1KQQA 4M60A 4NZMA 5HQJA 3ISVA 2ZBEA 4MV0A 2A19A 2D6FA 2WMYA 1KSHA 4CV1A 2YYZA 1NQTA 1PD1A 1EGAA 4Z99A 3U26A 3KKKA 3T3EA 2O3SA 5TPWB 2PH7A 1L0BA 4M8LA 1SOWA 4M9UA 4KPFC 3OMLA 3T7RA 1V37A 2IC5A 3G2OA 5LC1A 1JDVA 5HW0A 1U1FA 4M98A 4KW7A 3KLPX 4BUZA 4EATA 3OPNA 4CTNA 4BOYA 6PFKA 4AS2A 2ZRKA 2RHGB 4DILA 5EZ5A 1QDLB 4IW3B 3ECSA 1ZCZA 5BMVF 1Y1KE 2QD4A 1FPMA 4PGHA 3AF5A 1SKYE 3HEAA 2M6LA 5CNKA 2VYQA 1FU8A 1NP3A 5C5IA 4EPVA 4Q7LA 3MBKA 2ATXA 3DKKA 2QL9A 2DBVO 4P1ZA 4ME6A 4Y2TA 1N2GA 1T5DX 2O0MA 2XEXA 5B3AA 2XRZA 3LWBA 2F2TA 3E7FA 2W6CX 4F2HA 4KE9A 3SNKA 3M9WA 1C8VB 4ZMSA 2OK8A 2W42A 2OHJA 2AOTB 4DQQA 2V98A 3N2ZB 4REMA 3NJ4A 3LDFA 4YQYA 4GI2A 3GJXC 4J1SA 2QMZA 4TKLA 2FSVC 2WWYA 2ID4A 4EJ6A 2V96A 1SUBA 4X00A 3DP7A 3T3PB 1YKSA 2CLDX 4KWCA 4Q21A 3FTQA 2HU8A 2ZG6A 2X5NA 3K4QA 4CR7A 3GJZA 5JO0A 2B4YA 3ORYA 3R3YA 3I2JA 4P35A 3VPHA 3MUEA 4MVJE 3VM6A 1M7GA 2R87A 1PK1A 1L7OA 4KOEC 3B9RA 3NM4A 2YN4A 2PSSA 3BK2A 2NZ2A 1Z2NX 2QSUA 4G0NA 3FPJA 4PF1A 1L4EA 5C18A 4YJHA 1TKRA 1AGPA 4QJBA 1L9KA 5GGXA 2HA5A 1WDMA 4HWKA 3UANA 5IVHA 1T8YA 4FHCA 4Y1EA 4IV8A 2HJRA 5JSZB 4Q1FA 5I47A 3KELA 1FSZA 2I8AA 3V7UA 1CS4C 1JDPA 3LTNC 2C03A 4O4LA 7AT1A 4ZPXA 3VKVA 1R8YA 1JDSA 2GDZA 1KH2A 4E0DA 3ZDZB 1RJDA 1U0JA 2COKA 4HJXA 3OVMA 2J4CA 4AK9A 1QU3A 2POQX 4R9NA 1ZJ5A 5KPJA 5J2AA 5KFKA 4F4FA 5C1PA 2C29D 4QTXA 1BU8A 2I5HA 1EB9A 1T9BA 2WIGA 5DHTA 1I24A 4I46A 4K6OA 3LKDA 5KWJA 5CK5A 1QFSA 4CTKA 1I3KA 2P7HA 1ECJA 3FROA 1TKDA 3O8LA 3K2EA 4WZBB 3OD5A 4IJMA 1VP9A 3QH4A 4J0JA 1ZQCA 2VPQA 5TE9A 1ZQQA 4CIBA 3HFGA 2ZEJA 1R5NA 2O3QA 1SVNA 2FEMA 4F3CA 2ZTVA 1II0A 3OTGA 4AQYB 4LJSA 1A4XA 1I2BA 4LE2A 2ZWAA 2V9PA 5IAOA 5E2BA 4AU1A 4N0QA 1IC6A 2PL5A 3V6LA 4BX9A 1LSOA 3B36A 1NBOA 2O06A 3DMTA 3TLGA 3KBBA 4H3VA 3ROTA 3P8ZA 4ZHSA 4QODA 2WWWA 1JLHA 2ZZNA 2C3UA 3BMNA 3WICA 3C14C 1IVNA 3R7WA 3MN1A 5ANRB 4R0NA 3LYSA 2VPYA 4DR5B 4W1QA 4O3PA 2C3PA 1FE8A 1A76A 1X7YA 1L3SA 1F17A 1VE7A 2VPTA 4BKPA 4G3XA 1HL3A 1CSEE 3GY0A 1MORA 4KQHA 5ITZB 1Z3IX 2Y0CA 2Y6UA 2P9QA 1PK3A 1MJGA 4M38A 3FW1A 1NJZA 3DWFA 1T5LA 2BKUA 2XA2A 1U9CA 4IDCA 1ZZGA 5DI3B 1XL0A 4ECZA 4LNHA 2GCEA 3KB8A 3C45A 4Y98A 2AZ4A 1HL7A 3NBQA 5KOHA 2CNLA 2DFKB 2J0QA 3MYYA 1VRWA 3U17A 4WCFC 3ICOA 2O2GA 4I9FA 1U1EA 4LF5B 2X5JO 4MWEA 3QBDA 2RCNA 2VJPA 1NUHA 1Q0TA 4LXUA 4Y7CA 4RDIA 1KOGA 8ADHA 4RAOA 3K1AA 4DOCA 3LNTA 1Z2AA 5E0OA 3EZFA 4FCTA 1UMBB 4K6CA 1L5LA 2UXDB 5TGDA 1NNUA 2QX9A 4BPBA 1W5AA 3O82A 5JCOA 3O2SB 2X4GA 1BJRE 1FB5A 1M2NA 4KEAA 1DSSG 1LPNA 4CM4B 2KK0A 3N8NA 1RM6C 1NPTO 3FZYA 4P58A 2QMOA 1AKRA 5G0UA 1URJA 3FVWA 3PJFA 2R47A 1OLOA 2Z04A 4JUZA 3G2NA 3GA7A 2RDJA 3OICA 4X94A 1SK8A 4KGVA 2NSJA 5HP4A 1VG8A 2P40A 4V03A 2LKCA 2B1GA 1ISFA 2BFCB 1N61A 1CRWG 3DG9A 4E2ZA 4FD2A 4L0DA 3EFBA 5BSEA 4PZLA 1TM2A 1N7JA 3ETHA 4G63A 2FCRA 4TQGA 4EBBA 2J48A 3L0SA 3G9TA 4E11A 4W82A 3DOHA 1CF4A 2C92A 1P2DA 5IDVA 1KU6A 1J8QA 5A1JA 1HRKA 3W8RA 2X0JA 4FFWA 2JHFA 1F8FA 5L1IA 5LQMA 2V8BA 1THGA 4V02A 5LLSA 1QYRA 4AYXA 4MINA 4R2XA 3LC2O 1UA1A 1OFGA 2WW8A 4ZPJA 4EEKA 4TLLB 1ODTC 4W1PA 4RY0A 5ENVA 4WSOA 5EJ8A 2Q5HA 4RQ0A 1TAUA 4V1CA 1JE1A 5KFBA 4F5DA 1HBJA 4JR2A 4WK2B 4YN4A 4AF7A 5GTHU 4F97A 3L2OB 1DG3A 2VF4X 2P5YA 4IJ5A 2X2EA 4J1TA 4ELUA 1USWA 2ZZKA 1JX6A 3AB3A 1M72A 4UUNA 3W8NA 3QXGA 2MAXA 1P1IA 5CFNA 1Q7CA 4B35A 1P1FA 4LDNA 4IAOA 4R54A 3FHLA 4UCXA 3RIXA 1KKUA 3GRUA 2K8BB 2Z9DA 2JCXA 2YASA 4BE9A 3MTDA 3NGXA 4LZDA 3TM4A 2JFZA 5B66U 4PFSA 4BV2A 1ONOA 3MUFA 2IODA 1YC5A 4EBEA 1LPBB 3HB4X 5C51B 5KFTA 5J2HA 2ZANA 5KFEA 3SSAA 4KN8A 5CXXA 4GYKA 1MC4A 4PLHA 3AERA 5IFLA 1M5TA 1MTZA 4DUGD 4IGKA 1ZC3A 3PYXA 3KHRA 3AVUA 5J23A 3Q7IA 3KJGA 5CVJA 4P86A 3NONA 3ZY3A 4R84A 5JARA 3NH6A 5AJYA 3EDYA 4OH1A 1MR3F 2Q8QA 1PK1B 2QLLA 2O0LA 4M9HA 2VYVD 4C2AA 2BLLA 3KXPA 5EIXA 3QM1A 1ZMRA 3KV3O 3I6YA 4RIFA 5THKA 4WJZA 3FMVA 5DXAA 4Z6FA 3GB9A 1C1YA 2GM9A 4I2HA 1DVRA 1UFQA 3R5XA 3RVBA 4DR2B 3QFTA 5J4KA 4ZTUB 3PW5A 4HGQA 3GZNB 4IHAA 1LS1A 3D1JA 1ESMA 3JQ6A 5CTJA 3TLCA 5KFMA 4O4LB 5I45A 1T8EA 2R8XA 2K4PA 3CZMA 3OOWA 1D5WA 2IGBA 3HZZA 1FP4A 1QTIA 3VYUB 3L92A 4WUVA 4MCIA 3M4JA 3U7JA 3QVJA 3OOSA 2O3JA 4AZSA 3ELBA 3HI4A 3T1VA 2WEKA 2XO7A 1U8FO 3H19A 1RI5A 1Z62A 4EY8A 1KBQA 3IHTA 4AYWA 3CEJA 1QIHA 2WNIA 1X6JA 4YQEA 2WJWA 4RVFA 1D8YA 1DG9A 2O2YA 2K5UA 2AZXA 4S04A 2FFRA 2IV3A 1QQ6A 3W3AA 1PZNA 8ICAA 3VO8A 3O2NA 4IVPA 2GSDA 4MARA 3D7KA 1CBUA 4L5YA 4ZDJA 3RW9A 1XP5A 3BRCA 5DQIA 4K8OA 3BQ7A 5KSZA 4R3WA 4CUZA 3PC2A 2Q0QA 4RMGA 3STYA 4YHBA 3G23A 1X6VA 3G13A 3TDMA 5ER9A 3HWX1 4J75A 3LQFA 3NM6B 4EG6A 3P45A 2I65A 4K9NA 2AEJA 4Y6GB 3HDYA 4A8PA 4BU0A 4U9UA 5BRNA 2VTEA 5DQGA 1GAXA 1OIXA 4RFVA 3TLGB 3DE2X 2VP0A 2CJPA 1V5EA 2Z3WA 4X6YA 2QRZA 7MHTA 2Q9BA 3GV5B 3BMNB 4DABA 3LVQE 3R7WB 7MDHA 2VF7A 5JR3A 1W47A 4XZ3A 4X90A 1C7IA 1JHXA 3QGMA 2NNWB 2XRFA 2YS6A 1NW9B 3K3PA 3R7DA 2FLPA 1X7YB 3I73A 2PRYA 2DHRA 3ZWYA 1WZCA 2I4TA 4GMGA 1E3MA 1QIFA 2RGNC 4UARA 4C1BA 1N9GA 4AUEA 2J07A 4QPCA 3N2LA 1AROP 2O5CA 5C1OA 5JISA 3BD8A 1DBRA 4L0MA 1IZ7A 2O0HA 2FV8A 3M89A 4J90A 2FZ5A 1AQIA 1V26A 4RADA 2BPFA 4O25A 4KQ2A 3PXXA 3HE3A 2QPOA 1T0JB 4LBVA 3PGMA 1HEYA 3H9JA 3N07A 5TEVA 1HKUA 3RU9A 1QQTA 1SB3C 5KOHB 3QTTA 1TCCA 3MJVA 2YOFA 1CUWA 3G0BA 3LE8A 3TTSA