2I6XA

The structure of a predicted had-like family hydrolase from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
205
Chain Sequence
AMIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRFLPSGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLLREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a predicted HAD-like family hydrolase from Porphyromonas gingivalis. (CASP Target)
rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
molecule keywords Hydrolase, haloacid dehalogenase-like family
total genus 73
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2006-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2i6xA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i6xA01
3WKEA 4EENA 2P11A 4ZEXA 2EAUA 1WZCA 3QU2A 1CQZA 3EF1A 2BY4A 1QQ7A 2I34A 2QYHA 2JARA 2P27A 5ALZA 4ZEVA 5AKZA 3SMVA 1ZOLA 2FUCA 3QX7A 1O03A 4GIBA 2AH5A 3B9RA 1ZRNA 4EX7A 1YMQA 3R9KA 5AM5A 1TJ5A 4I9FA 2YFYA 1KYTA 3QU9A 2WHEA 3L8EA 4CF3A 3IB6A 3NASA 3NRJA 5AK5A 4O8CA 1XVIA 3L0YA 5AW6A 2YY6A 1Y8AA 3TLMA 1ZJJA 3P96A 5AM2A 3OTQA 2WM8A 5IS2A 5AI8A 1WR8A 4HGPA 4UM5A 3L7YA 3U7EB 2G80A 4XOUA 3U19A 4YGYA 4NABA 3QU7A 5AW1A 1YS9A 1T5SA 3L1VA 3QU5A 3ED5A 4DFDA 3N8GA 5AVWA 1K1EA 2FPUA 3HYCA 5AVSA 4F72A 3KD3A 5AVZA 1RLMA 2WF7A 3WKDA 2HSZA 4BKMA 3QYPA 2GFHA 2EARA 2FPRA 3SHQA 3AR8A 3NANA 3KC2A 4BX0A 5AI5A 5AW3A 1YNSA 1F5SA 4CE6A 2P69A 5ALXA 4AP9A 2WFAA 3QNMA 2PR7A 1AQ6A 1J97A 1Z4LA 3ZVLA 3OCUA 1WPGA 4Y2TA 5ALMA 2NYVA 3SD7A 3M1YA 3NUQA 2OBBA 3MN1A 2AUTA 5AKEA 5AKHA 2HEGA 5ALKA 2R8XA 4UMVA 3CNHA 5ALFA 1TE2A 1RDFA 3A3YA 1J8DA 3DDHA 4L57A 1RPZA 4C4SA 5AK4A 4YH1A 5AW5A 1Z4MA 4NAVA 3WGUA 3FGOA 1ZD2P 4FE3A 3ZVNA 3L0CA 4KNVA 2PQ0A 1NRWA 2VKQA 4MUMA 4YIKA 1ZD3A 5AM4A 5ALHA 3A1CA 4EZEA 3W5BA 5AESA 4UW9A 2MU1A 1N8NA 3RF6A 1TJ4A 3OCZA 3QUQA 1RLOA 2BDUA 2G0AA 3CZ4A 2C9MA 3R09A 2CFRA 2W4MA 1CR6A 5ALEA 3DNPA 3QXGA 2IOHA 1ZD4A 2W11A 4YCLA 4RETA 3ZX4A 2GHTA 1U2SA 2G09A 4BNDB 2YJ5A 2NO5A 3KZXA 2WF9A 4OCZA 1WVIA 1Z4JA 5A3RA 3WK6A 1EK2A 2CN1A 4UMDA 4HYTA 1L7MA 4G9BA 5AIAA 1RQLA 3MPOA 2JGAA 2IOFA 3WKAA 3WK9A 5AK3A 1T9ZA 2D2VA 1RMYA 3WK5A 1VJRA 1Z4KA 2GO7A 2PKEA 1MH9A 2I54A 4EEKA 5FP0A 3D6JA 5JJBA 5ALDA 5AVYA 3W5DA 5ALJA 2IA5A 2ZOSA 3AR6A 1Q91A 1L8LA 2EATA 2OM6A 1VJ5A 3SKXA 4H1WA 3KBBA 2YMQA 4HGNA 4J2TA 2FDRA 4Y2SA 4Y2XA 2B0CA 2C8KA 3SKYA 2IOFK 1L8OA 3ZUPA 1QQ6A 3AR5A 2I55A 3L8GA 5AKIA 2MU2A 5ALIA 3ZTWA 3L8FA 3SF0A 3UMCA 5IT0A 2ZBGA 2ZBDA 1Z4NA 5AVUA 4J03A 2W43A 3F9RA 2JAWA 3U26A 1SWVA 3ET4A 4RESA 4AS3A 2QLTA 2WF8A 2G07A 2RB5A 5AK6A 2Q4TA 1ZRMA 5AVTA 4HGQA 1XPJA 3WK4A 2R8YA 3L1UA 3OCVA 4HGRA 3E58A 2JAOA 1QH9A 1QQ5A 2X4DA 4UU1A 3WKBA 5AW2A 2B30A 3MC1A 2B8EA 4QQFA 2YJ3A 1Z5GA 1NNLA 5ALSA 3AR7A 3S6JA 3QGMA 2WF5A 2JAUA 1L7OA 4BEVA 5AW0A 3KDPA 3NALA 3RFUA 4Y2VA 3A1DA 1U7PA 3KOOA 3A1EA 3MMZA 4ZEWA 4IG4A 3ZW7A 1S2OA 5IT4A 3I6BA 5AI6A 3PGLA 1RKUA 2YMMA 4YCMA 2HF7A 3EPRA 4KX3A 5AI4A 1TA0A 3UM9A 3QUCA 4YIHA 1Z4OA 1O08A 1RKQA 4NV0A 5ALQA 3AR2A 4BYGA 4GXTA 3BWVA 2Q4RA 4B6JA 2HCFA 1EK1A 1L7NA 1RMTA 3PCTA 2YJ4A 5ALGA 5ALLA 4AS2A 4BX3A 3PDWA 4UAUA 2I7DA 5ALNA 4CNQA 3L0BA 4DW8A 4NWIA 3FZQA 3OPXA 5AVRA 3IRUA 5AVVA 4KNWA 5AM1A 1YJ5A 4UU0A 3PGVA 3E81A 1L7PA 3WK7A 1U7OA 2FPSA 4KYTA 3WGVA 3DV9A 1N9KA 1FEZA 1X42A 1SWWA 3UMBA 1Z5UA 5AW4A 2B1QA 2HOQA 3N5KA 5ALTA 1Z4IA 3ET5A 1U02A 1YDFA 4IFTA 4UAVA 5AKLA 3J7TA 5A3QA 1SU4A 2HX1A 2CFSA 1IWOA 2O9JA 1U2TA 3SLRA 2P9JA 2Q5EA 3DAOA 4G63A 3M9LA 4OFZA 5AW7A 3IJ5A 2RARA 1VFPA 5AKYA 4YCNA 2WF6A 1LVHA 4NFLA 5AICA 5AW8A 4F71A 1L6RA 2B1RA 3BA6A 5AI9A 3E8MA 3OCXA 4KX5A 2FEAA 4BBJA 2G08A 1ZS9A 1RKVA 2G06A 4C4TA 4UM7A 4Y2QA 5AVXA 2CFTA 3ZVMA 2R8EA 3AR9A 4OHFA 5ALRA 3OCYA 3NAMA 4KN8A 2HO4A 4HAIA 4BNDA 1RC8A 3I1YA 1RMQA 3ESRA 3AR3A 4BEWA 4Y2JA 3ZWDA 4FYPA 3UMGA 2YJ6A 1Z4PX 5ALWA 2AMYA 2HF2A 2RBKA 5ALVA 4EX6A 5AM3A 3EWIA 4FFDA 2OA0A 5A3SA 2HI0A 2AGVA 1XP5A 3K1ZA 5E0OA 3ZWKA 4DCCA 3QUTA 3ONNA 5AVQA 1LTQA 2ODAA 2G1AA 4E88A 4JB3A 2ZBFA 1T5TA 3W5CA 2O2XA 4DWOA 2HDOA 3WKCA 4Y2RA 3WK8A 3FPSA 4Y2UA 2YMLA 1QYIA 3ZI4A 5AI0A 5T41A 5ALOA 4CF4A 2FPWA 3ESQA 4UMEA 5AW9A 2NO4A 4JDPA 1RLTA 1RRCA 2B82A 4UARA 5AKKA 4CF5A 3I28A 2I33A 5AKXA 1NF2A 1ZD5A 2FPXA 2YN4A 4L6CA 2ZBEA 5AIBA 4OD0A 4L6AA 3N28A 4Y2YA 1Z4QA 2BDEA 3U7GA 4C4RA 2GMWA 3U7FB 2OYCA 1JUDA 3ZTYA 2GHQA 3QUBA 4Y2PA 2IYEA 3N1UA 3QLEA 3NIWA 4UMFA 3ZX5A 2FI1A 2YBDA 3B9BA 5AM0A 1RQNA 3U7HB 4XPZA 3FM9A 4XQ0A 5ALPA 2C8LA 4BX2A 5ALUA 1Z88A 3HLTA 3QU4A 4Y3UA 1TJ3A 4HGOA 4PNHA 3N07A 1Q92A 5AKJA 2I6XA 2RAVA 3W5AA 2R8ZA 3FPBA 4UASA 5ALYA 2HHLA 3L8HA 3OCWA 2FUEA 3VAYA 4EELA 3GYGA 3L5KA 2C4NA 4MWOA 1YV9A 5AHXA 3I76A 2MSNA 3U13A 4UATA 3E84A 2C88A 2ZXEA 2DQSA 2ZG6A 4QJBA 3EF0A 4XE5A 3R4CA 3ZU6A 3B8EA 4I9GA 3AR4A 1S8OA 5AKGA 2YMPA 3FVVA 2B8JA 1PW5A
chains in the Genus database with same CATH superfamily
4DEYA 4C2UA 4DV2B 4RQ5A 3B2QA 1EVYA 3L7IA 2JZBB 2IS1A 2H7VA 2P0EA 2ZREA 4QNMA 1UZNA 4E5YA 1GU0A 1M2EA 3OMXA 4RTSA 3HP1A 3L41A 2YHAA 2BFFA 5SZKB 3MCZA 1FYEA 3UT5B 1FQOA 1O03A 3AU6A 2B2NA 3L9WA 3QIVA 4ZOLB 1A8IA 1OU0A 1NXWA 1NVVQ 1PR5A 2PMFA 4TS1A 1T1JA 3GELA 1JDTA 1KYTA 3MSXA 1BQEA 4AZ0B 2QTLA 3ESXA 3L4KA 4ZK6A 2H2WA 4TMFA 4BO6A 1JMSA 1SVOA 3BSSA 1YOVA 4GOLD 5KFAA 4CCHA 1GFIA 1JXAA 1ZEJA 3HB4X 4HUJA 1QH8B 4U1RA 1B0XA 2PRZA 5DTMA 3T5KA 3PFNA 3I83A 3KO8A 1M34A 5HRUA 4DLTA 1NA5A 3U7RA 5B37A 3ETDA 2O2YA 4EYEA 5HUJA 2BT4A 2XEXA 4GPZA 4TLBA 3GJ3A 1ZH6A 4M38A 3AONB 1RYSA 4JC8A 5EE9A 1KIFA 1DJNA 2HDHA 1YUNA 3GCXA 2P9HA 4LSZA 2M9NA 1WV0A 4MCAA 3SYMA 1OPXA 4Y2HA 1FFDA 4D99A 5KHAA 1V48A 4ZAGA 4HGPA 4L0MA 2W2TA 4BX8A 6AT1A 4ECXA 5D86A 1D9XA 8ICKA 4MI6A 1E7YA 1SB8A 1W4RA 2G80A 2O0MA 3DB1A 2OEHA 2WJVA 4FMBB 2VANA 4L75A 4FYWA 4K8RB 1GGNA 4YGYA 3ZXYA 2Z5GA 4F4FA 4EBEA 1GGFA 1LS1A 2R4TA 2IY9A 4WW0A 2H4XA 4DFDA 2XUGA 4NLZA 4B3CA 2HWWA 1RVDA 2QTFA 3CUVA 4LKOA 4P4UA 4TZKA 1WX1A 4PSVA 3H1AA 1USGA 4TKLA 5LB4A 3IKJA 3OM8A 3EOZA 4JDUA 2WF7A 4Q05A 2PUEA 3OFKA 3LQ2A 3I4CA 4K05A 3EFOA 1HF3A 1JWLA 2BFCB 4LV5B 2XVTA 1YQQA 1CUZA 1G8MA 2PBFA 4QUDA 5DDIP 3BMXA 2XC9A 1IM2A 1FRZA 4FZMA 3CX6A 5ILGA 9ICQA 3H83A 1JEJA 1H8ED 1SXIA 1UXOA 2Z1NA 1BCRB 5EHNA 4AP6A 3KOZA 1EVQA 3JD0A 5B1EA 2G28A 3UQ0A 1FRQA 1GTJ1 3GEEA 1WP9A 4AJ4A 1X1EA 1F20A 1UJ4A 3PNKA 4O0IA 1DV2A 3AF3A 5ALXA 3C7AA 3FYUB 3MABA 1OI7A 2PR7A 1VKNA 3O4GA 4QWBA 4EY7A 4BFYA 3S4YA 2C7PA 1DG1G 2OP0A 3FHCB 3JZDA 3TQSA 2GJ4A 1PK1B 4U2BA 2PS0A 2UVVA 1CY6A 2VEOA 1G8HA 4DNPA 1VMKA 3BZWA 1BW9A 1B6SA 4FPXA 4PVDA 4NOJA 2EH9A 1A50B 1DX4A 5F23A 5IVKA 4GE0A 4KLGA 5FORA 4QVIA 1TAQA 1RQGA 5KFMA 4X8MA 1FQJA 2IEZA 5B3LA 2IS2A 3ZVRA 1KJ8A 4JLVA 1U1EA 1WL8A 4FYKA 3K9CA 4KQCA 3OPYI 4PONA 3REFA 3AWDA 4BZPA 5ITWA 3KOUA 3N2KA 1KI9A 4ZOHC 7ICPA 1NYLA 2EF1A 3ZJUA 4DOCA 3PTLA 4KREA 4RPLA 1JWAB 5AXDA 3TFSA 1NN1A 1U2ZA 4CMJA 3ESZA 3IR5A 2JGFA 5C7OO 2FR1A 4B9TA 9ICLA 1EG7A 4DN6A 3PGJA 5KQSA 4J4BA 1FFGA 4LVSA 2DWQA 3W6NA 2BELA 5TRTA 5EWEA 1DC4A 1L5SA 2INGX 4NG5A 1RAGA 4DR7B 5B4VA 5GV7A 2QL7A 4MUMA 4YIKA 4ON9A 4FZNA 2P8SA 4JUBA 1EI9A 1N2EA 4Y9DA 5ESDA 1YC2A 4UW9A 1QE3A 3AYXB 3HGMA 1R4MB 5FD8A 2CHEA 3QBTA 4Q1EA 3S29A 4YRZA 1E3MA 3C87A 4L1KA 4YECA 5EZYB 4H35A 4ANFA 2WDZA 1CJTC 3LNCA 4QZDA 1LFDB 4RQ8A 3EJWA 5BOSA 5K01A 1A0PA 1PZXA 3QE9Y 4NMXB 4AJ1A 4HAWA 5KVCA 2Y0SC 3CNOA 2J3DA 2IDKA 1I2CA 3FW1A 4F5DA 3REGA 2LVBA 4NARA 2ISQA 3OTIA 4ESEA 3AVTA 4UBKA 1JI7A 2UZAA 4BMDA 3PC3A 1CR6A 2DKFA 4TL8A 3NOVA 2NUAB 4BATA 1AUVA 4US2R 1A2OA 1NQTA 1NYTA 4OUDA 1Y6FA 2IOHA 1CUWA 1QZXA 1I3OA 3HXTA 2KICA 4QWEA 2WICA 3U5ZB 1J70A 4RPKA 4N6NA 1EFDN 1KQNA 3S7ZA 3T54A 3EFHA 6ABPA 5DFAA 3PW7A 1XJ0A 3UAZA 4H7KA 2IDZA 2VWQA 1WDTA 4RTKA 2NO5A 4TX1A 3KZXA 1P0CA 1Z4JA 2ZDHA 1LBHA 1X39A 2IQ5A 5A3RA 3PY8A 3WK6A 2D1RA 1JW9B 4FMDB 4IUYA 5KJCA 1YDGA 4P2HA 3U7QB 4ZV9A 2WHPA 3TLXA 2JGAA 4GKBA 1FFHA 1A9RA 3HM2A 2XUDA 3EGXA 4J2HA 2BFCA 4TUQA 2A1AA 2LDXA 2LGJA 3GG9A 3GX1A 3JQGB 3VFDA 2OXFA 3CGWA 3NDJA 3WG9A 4R2XA 3VYRB 5FNVF 3BB1A 1ZVKA 4GUDA 9ICBA 1I1NA 3D6JA 1V7ZA 2E7ZA 3UJ8A 3VI3B 1G20A 3RU9A 3VVCA 3NIBA 1WY5A 2ZB3A 3MQFA 4GSKA 3H2SA 3RIEA 2UYGA 5D00A 3ZKWB 5EUMA 1T26A 1TLTA 3E0XA 3IB3A 4C2AA 2ZM5A 1N61A 3G5TA 2H51A 3HM9A 2QE7A 4C4XA 1G9SA 2QT1A 1SUCA 2YW9A 2PNJA 3GLKA 3V8QA 4OQXA 4PNEA 3RB4A 1M0WA 3RW9A 4K26A 4YPOA 2H4HA 1I6LA 1XPUA 5K0ZA 3LG2A 2PT5A 2P91A 5G2OA 3FMPB 5I3ZA 2GN4A 3USCS 4EG0A 1D0VA 3FTQA 1VL0A 1WMBA 2WHXA 1YB6A 2QNRA 5C8VA 2QE7D 3BICA 1O94D 1ZHFA 2CXRA 5E9WA 2JLRA 2VP3A 1LKYA 4HQOA 2C2EA 9ICPA 1D8BA 1GCGA 3ELUA 4Q3LA 2O1XA 1SIJA 1T1RA 2A7QA 3L4BA 1PJ4A 4Y6GB 3R7AA 4AC9A 2GAJA 4E09A 5KOIA 5KG2A 1A7AA 4FJ0A 5E1DA 4YP9A 1KO7A 1O95A 3I2HA 4LF6B 4KJZA 4LWQA 2ANCA 4RV4A 5CVCA 3VZRA 4KU4A 2D0DA 3ZV5A 3KB2A 4ND3A 2Q4TA 1PVQA 4LJ4A 4C04A 2NLOA 2QLFA 3OFND 4B7CA 1XTSA 5IH7A 4UBMA 3FTFA 4YQZA 1IY2A 2AZTA 4JFRA 2R8YA 2XNHA 2PKRA 1B8NA 3AJRA 4MHOA 2X4DA 2RH5A 4MYSA 2VJYA 3P94A 3P7MA 3ROKA 3E61A 3JASA 4XX0A 1H1DA 1YC5A 1KDZA 5LWQA 1M66A 1KVUA 2B7CA 4ZI3A 3S6JA 1A72A 4YQYA 3WLNA 4M1YA 4Z6CA 4F0JA 3BBLA 4ICIA 4QUJA 1WNTA 2D8AA 3PQEA 1NC3A 2YASA 3AP3A 4Y2VA 4TQRA 2A3VA 5DG8A 3PB3A 1U7PA 1GPWB 2J4CA 4GPTA 4F4ZA 4L9AA 3STUA 2QV0A 4R8VA 3TDKA 3ZQ4A 1E3TA 2TSYB 4RD1A 3VR1A 5JQWA 4GC5A 4K6MA 1S2OA 4H18A 3SZGA 4IR9A 1U1FA 3MJDA 2NACA 5EQTA 2YINC 5CDTA 3ADPA 1F38A 4DHWA 4DDHA 1NYQA 4X6YA 2WSBA 3R40A 2DJIA 3HCDA 3LX8A 2O48X 4L5JA 4MIKA 1DCMA 3Q6IA 2QM0A 5JPIA 4IJUA 3PQDA 3N0WA 1EVIA 2CC2A 4MAFA 3VPBA 2Y3IA 1RKQA 2BRUA 2XYRA 4WFIA 3IURA 4RZUA 3V9AA 3WV5A 3LS2A 2QG6A 4HLDA 3UJBA 4E30A 5BOMA 3M1IA 4BO7A 2P2NA 4IJ5A 3LUPA 9ICTA 2Z5FA 5CFNA 5CFOA 1URJA 1KARA 3GEMA 4AZ0A 4PHCA 1NUSA 5J4LA 1MW9X 3SJ7A 3R24A 1G2IA 2Q3EA 2QL6A 4B75A 3N7SC 1F5NA 2P4HX 4CM8A 1QP7A 4NWIA 1Q7RA 2JI7A 2R3SA 2R8OA 4O63O 3WSTA 1F0YA 1N2HA 2WLSA 2RGRA 4L8VA 4HNHA 4KCGA 4UAZA 1KJWA 4YP1A 5G40A 1AKWA 2AD5A 4S1PA 2I2XB 1NT4A 4F5NA 2Q5OA 2FLVA 2VPPA 3H2HA 1V5FA 2BFNA 1KE2A 2W70A 3UY4A 2VDVE 3Q7SA 1JSRA 1EM6A 1OBHA 2VDLB 1XL0A 4HBZA 1A95A 4LHYA 2BVNA 4KYTA 4DDWA 3K1YA 3WGVA 3CYFA 1TYBE 1AVTA 3T7AA 3PHHA 3BA1A 3L77A 3O0FA 3DXXA 4YJHA 4F9EA 1ZMOA 1Z5UA 3JQDA 2VOEA 3K1TA 4DC0A 2VNSA 1UC5B 1Y1TA 3DT9A 1T8EA 1LVGA 5EVJA 4BQFA 5AW4A 2Q7OE 4AO8A 2R6HA 5ICEA 1USUA 1VDMA 3TBKA 3TXAA 1JYFA 1RYEA 1XDUA 3OFVA 1JDNA 3CH5A 5H9VA 4K0RA 4OB6A 2FF7A 3IR7A 4K9QA 5SY4A 1GRNA 3AVXA 2ZGVA 4AECA 2GZSA 5EG5A 3PXEA 3VMMA 2GKSA 4QNNA 1RC1A 5KOHB 1VB5A 4MV8A 2A7XA 4YRFA 5AW7A 2EVWX 3RTDA 1TUIA 1X7XA 1Z56C 3PNQA 3EA5A 5AVTA 1G5TA 5KVSA 1KQFA 1ZM4A 4GRIA 1YZ3A 4K03A 2WTMA 4LTNA 1IU9A 4CMCA 2QTAA 3MTIA 2WU4A 2ALZA 1IZYA 5BV7A 4H16A 2QVLA 1SCUB 3RIXA 4UBLA 1E4YA 3TLGA 1BOOA 1PGJA 1YI1A 3DOCA 3I6YA 5ESRA 1T3HA 1U45A 1SUFA 3ZLBA 2NZJA 3NHZA 1WDLA 1SKAA 2I6QA 3T4UA 4BOYA 5KX5F 4M0LA 3SQDA 2PV0A 1Z68A 2ZS7A 1ISGA 2R97A 1PR2A 1E7WA 4TPKA 2EHJA 1LEHA 1IUPA 3AY7A 4KMRA 4OHMA 3R7DA 2Y1XA 4G1MB 3HKEB 4EAAA 4XSVA 3QOYA 4GOND 4X97A 2KJ9A 2AK2A 3QG5A 2JHDA 3OCYA 4FHEA 1CLEA 3EDOA 4R2HA 1O97D 3KUUA 4FI3F 1HC7A 2J5BA 2HK6A 5CLGA 1RI2A 3AHFA 3SC2A 3HUFA 4PYQA 3RS9A 1G21B 2X2EA 3JR7A 2GLEA 2UYOA 5F3WB 8ICFA 2R86A 3BS5B 2F7SA 1MTOA 3I2GA 3UUEA 2P2GA 5CEFA 3LC2O 3KPUA 3WRXA 4EB6A 3VAAA 1SXHA 3GLGE 5KFBA 2OZKA 3GCDA 5M29A 3ETNA 1TYZA 4PWZA 1BA3A 1BNCA 3AFIA 2HGZA 4X7MA 3ANSA 2HNKA 1KFCB 3P0FA 4MPRA 2EKPA 4ODIA 5HIIA 3RKSA 3TFOA 3D4LA 4CM5A 1GAXA 1UBFA 3W5SA 4CM3A 2NVOA 1TO6A 2I65A 2V03A 4YO7A 5CCXA 2R0QC 2WNHA 1NQVA 2OPBA 4L72A 2F4VB 3ZW8A 3N7AA 3L07A 2XY6A 1M1NB 3KYBA 4ILEA 2XXAA 1N6LA 5KJFA 3BDAA 2OBXA 3AWIA 2P4SA 1AZSC 1ZCFA 3ND6A 1IE3A 3VR2A 3K3PA 2QTRA 2BBSA 1CZNA 2VH5R 3IDOA 4MS4A 3LY5A 1CHDA 1K3TA 3DOUA 2JH3A 5EZ6B 4CLHA 3K6SB 4KVFA 2P6UA 1SBIA 4ENRA 1BDMA 2WM9B 2D54A 4ZYZA 3KT3A 1WDWB 2NTYC 3T5CA 4BNTA 3S0JA 3UHFA 3OZWA 1UAYA 3SSOA 4DB4A 5LQDA 2Y9PB 2YQ5A 1ZD5A 2ZIVB 2ARKA 4RQAA 1FSGA 4L6CA 1IONA 1MC5A 4OD0A 3MLAA 4OK5A 4Z9BA 5EKSA 4CG3A 3ZWOA 3GK3A 4EB8A 1VL2A 2JFUA 3NJ4A 3P19A 1XZNA 1SC3A 2E1PA 2CSXA 2ZRLA 2K60A 2NRZA 5ERYA 3MYRA 3RWOA 4DBZA 3BT7A 1JSZA 5B4TA 3PYLA 3BGOS 2AQ4A 1TK0A 2GEBA 4Q4CA 4ETWA 1J8YF 2OAGA 4MV0A 1VE1A 4JP1A 1GA4A 4V3BA 4ZDJA 3ZVKA 2R65A 1FW6A 2JRCA 4HPWA 4XX0B 3PX6A 1TUBB 2QI9F 2QRVA 3B9BA 5B1DA 3WQRA 3L6CA 3WOVA 2ZR0A 9ICFA 3DBRA 3B1YA 1KZHA 1Y8ZA 1JXEA 4B7AA 4GGPA 4XQ0A 5HP4A 1OFTA 1VMDA 4DQVA 3EQ6A 2HU2A 1QPGA 5ALUA 1VKRA 2ACKA 4YFVA 4MKZA 4UB5A 2RRDA 3A6DA 4AYWA 1T4GA 3AEUB 3BD8A 1WOYA 2VATA 4O59O 2NAFA 1RTKA 4WASA 1JTEA 3CZPA 5AOCA 4LMBA 1F1JA 5FF9A 2XRZA 2H1IA 1G6KA 2O3TA 1Z39A 1ZJ4A 1GQRA 4BVHA 4I5EA 4C4AA 4NOLA 1E1NA 4C4PA 2BEWB 5CJ7A 2KW5A 2V7TA 1MT0A 1XAJA 3K2EA 2WYVA 2OB1A 3K96A 1FNSA 5EJ9A 1GL9B 1MJNA 1ZMBA 2Z8YA 3HXPA 3OX1A 4X93A 4Q7LA 4E0BA 2W0SA 4QZGA 1UBKS 3LPNA 4QWDA 1W8IA 2GAOA 1KXJA 3MFYA 4HYQA 1YJCA 3D3EA 3O8OA 4JYAB 2J59A 1JDJA 3MB5A 3O8QB 1JAXA 2FJPA 1HDZA 3P5BA 1KVTA 4FJ1A 3A36A 2DKZA 5FUBA 4AJJA 4V24A 3Q5DA 3SU8A 4PGAA 2C9YA 3F5AA 1HG0A 3W7BA 2P67A 1PEYA 4RKFA 3AR4A 3RH0A 5FWAA 1Y89A 2JDID 4P9NA 5J40A 1FIUA 1OGJA 3ZU4A 2B8JA 4NYJQ 4F04A 3QXXA 4QW8A 1ZN8A 5A05A 4K9OA 1LB1B 3OLQA 1FMFA 2VP2A 4OQDA 5FBQB 3E3NA 5FB3A 4DG5A 4WTOA 3ZBPA 2YXEA 1DEAA 2XKBA 2QYHA 4PSCA 3V8PA 1C29B 5BUZA 2A78A 1U3FA 4EA7A 3OEED 1YB5A 3DDCA 2VCHA 4K9PA 3V6HA 3F3MA 4X6UA 1NPDA 4DOBA 5K4HA 3FNEA 1UC9A 2YR0A 3ZK8A 2HCTA 1XQXA 3L3FX 1W59A 4UE6A 1UXIA 4ZOAA 3YASA 4CCYB 1EZ4A 3L8EA 5MGNA 1I6KA 1JDPA 3OJXA 2R47A 3LIIA 4WKOA 4BNUA 4BNGA 1TEHA 1RQRA 5E3HA 3SQWA 1HORA 1OXSC 2NPFA 4R64A 1BMTA 3CRVA 4W1QA 4Z3DA 3JVIA 4MUXA 2AFHA 1ZQTA 4DG9A 4IO1A 1CX9B 2NRXA 1OU4A 3AINA 3NVMB 1KEEA 4U3JA 1HPLA 1ZGCA 4JLSA 2H18A 4DL4A 1NJGA 1NKVA 1Q1ZA 1PEDA 3OPQA 1X9GA 2B69A 5KNDH 4UM5A 4YCAA 2XGJA 4KIFA 2WI8A 4LXGA 1CFZA 1XNGA 4CRXA 2YN2A 2ZJ5A 3GLTA 5DIFA 5TY0A 4TRMA 1CZLA 3DJFA 4BCDA 5ADHA 1E5QA 1Q20A 4JJ8A 3JQ8A 4CM1A 1YZYA 1ULZA 4KQWA 1Q3HA 1TQ4A 3SYKA 2K4PA 3F9IA 1UK7A 3KEOA 2Z8YM 4KXMA 2FZLA 3KXIA 1GU1A 2D5AA 1SL1A 4DC1A 1LCIA 4KBGA 4F2SA 1CZOA 4I2FA 2FCRA 2GETA 3ELYA 1Y1QA 4FS2A 3G13A 3TXYA 4YR2A 2BKAA 4PE5B 3WNDA 3KAKA 4RU9A 3NRCA 2F77X 1ZIYA 3NONA 5JARA 3OZAA 5CTJA 1DC8A 2KIWA 3B9QA 4Z0TA 1KQ3A 3DR3A 3IP4B 4YCSA 1IVSA 2D0OB 3V8MA 2IXGA 2DFVA 3W05A 1X77A 1ABEA 2EXXA 3L4SO 3TPCA 5LPNA 2WVJA 4LF5B 3GXBA 5DT2A 4UBNA 1J99A 1BS9A 1RE0A 1RJEA 2GI4A 3UWDA 2WHQA 3DOFA 4GICA 4PGXA 3ABOB 3CUEF 4YJ2F 2OECA 1M72A 2CJWB 4FEEA 4JB8A 2J3IA 1AQ6A 3FZYA 4AZWA 3Q8QB 1U65A 4ZYXA 3KFUF 2CXSA 2HRCA 3G5LA 3C15C 3WBKA 4YRMA 3GMTA 2WIDA 3JTMA 2RH8A 1O94C 1ZQIA 3MUOA 4ZVKA 3TRJA 1JP7A 3DYVA 3RD5A 2Q3DA 2FXIA 4FU0A 4BLTA 4DLNA 4DPMA 3K0HA 5K0EA 4OYRA 5F3RA 4EMSA 1N78A 3EZ5A 3WGJA 1ORDA 2GLXA 4ROTA 5IW8A 3UAWA 2HXGA 3BGSA 3QEOA 3PGA1 3PS9A 3VKUA 4Q3KA 3S2IA 1R2QA 2ZXIA 1EB8A 3FOWA 3NETA 3NR2A 3P9RA 1H0HA 5H02A 1IQPA 1RRGA 2ODEA 2ZJOA 4G36A 4GYKA 4XZ3A 4V2UA 5IAEA 4AMUA 1ZFNA 5A02A 5IH3A 3QP9A 4YMVA 3C98A 2PKCA 5JCXA 3FZGA 3T35A 3BQMB 3E5NA 4K6OA 4TRJA 1R0LA 2RHJA 3K0BA 1XZPA 2AGQA 5EMLA 1QO9A 2Z4TA 2HSWA 3ER6A 3O82A 2W6MA 2QW0X 3AW8A 2G9VA 1NRWA 2CXOA 3HYTA 4RQ4A 2HWUA 1AKVA 4K6GA 1Q1EA 3A9SA 3MGIA 3PDIB 2V59A 4LA4A 1JRLA 3JPWA 3IQFA 3RJHA 1T1EA 4GC9A 1LW7A 4KYIB 4R63A 4X0EA 4YV2A 4JXJA 1SELA 4ND4A 1XDWA 1CRWG 4MGHA 4OI0A 2ETXA 4LJAA 1DDOA 2Q9AA 4M83A 5IYZA 1DKOA 1J6UA 1Z45A 4WBXC 1JU9A 1YVEI 4ITVA 3UFBA 2G36A 1YVRA 3CJRA 1JHRA 1BKSB 2VRBA 3TQTA 2NWQA 2IYAA 2ZU0C 4TUYA 5LZ2A 1JHAA 1Z83A 8LDHA 1DRWA 3WO0A 4TV8F 1K2WA 5IUKC 4BXOA 5KQGA 1UP4A 1BPYA 3K20A 1OAOA 1CEZA 2O0KA 2CVQA 4Q03A 2DYKA 2QSJA 3DNPA 5DI9A 3NQ41 1CR2A 4EB6B 4QLBA 2FHSA 1NOMA 3QLUC 4Z3OA 3ZZTA 1SZJG 1E4EB 2QMQA 2X7HA 4OHWA 3WTCA 3ZBTA 4F8JA 4TLMB 4R05A 4NNJA 3W77A 1VMAA 4J1SA 3EXAA 4JJIA 3F0TA 4RVDA 2WTAA 3BQ7A 3Q0EA 4OXKA 4MYUA 4GI3A 4OCZA 5HQJA 5BRNA 1GITA 4N3CA 3ZHSA 4G5RA 3X2SA 5EE5B 1L7MA 1JXOA 3CN9A 1YU6A 4H1UA 3MRXA 1GY8A 3K0CA 1B8PA 4MQ4A 2EX1A 4S12A 2AN3A 2VQFB 3A8TA 3HPQA 2QSZA 5CG2A 2OK8A 3KTQA 3WE7A 1NFQA 3WK5A 3DEHA 2O0HA 4AIRA 1CUSA 1WQ3A 1KYXA 4LS3A 1VPDA 5HIAA 3R9IA 4LGVA 1VYHA 1VBFA 2DJ5A 2PANA 2X1LA 1AF4A 2CUNA 1JQBA 3PSFA 4LJ9A 1URPA 2AFIB 5LR6A 4KACA 1ZXLA 1ADYA 2VDWA 3BEOA 3H04A 5JO9A 3HJUA 4C01A 4CN9A 3SICE 4N0PA 1GTG1 2RI1A 3FF4A 4RKYA 1VA4A 2BFBB 2WK1A 5HQ3A 3LHSA 4ND5A 3ETCA 3VC3A 1VRWA 3USES 5ES4B 2R5WA 3ODGA 1JHXA 1CQPA 2Y0PA 1RLUA 2V7QD 3EAQA 4XJTA 3CYMA 1DZ3A 5MN4A 3KOWA 1A9YA 3ZGXA 3HW8A 4I2DA 4A26A 1T6BY 4EHFA 3FX2A 5HJ5A 4JT8A 1D5CA 1X9SA 4PBSA 1Y5LA 1IZ8A 1XMQB 4I9UA 4OHBA 2GCIA 3EVFA 2O50A 1RAHA 1W0CA 3C8MA 1T2AA 3O1LA 3HR8A 3L7AA 2A92A 4UFPA 4MA5A 3VPGA 4G23A 1BAPA 5KDDA 4WINA 1AKNA 2O3UA 1ZRHA 1EUDA 3KWMA 2Q3MA 1E1MA 2YVKA 3NCHA 3PNPA 3L9XA 1MRNA 4HEHA 4ALLA 3M6UA 4CCYA 2AB0A 1V85A 1Z4NA 1RJFA 4DQPA 4XYEA 3VO2A 4ZCPA 3KE8A 1W2GA 1O6CA 4B33A 5K8TA 2BPOA 3H2YA 1R4NA 2X86A 3D0KA 3WDMA 3L0SA 3IAAA 3MJRA 4UBBA 1HYHA 1Z5ZA 5BVGA 5KG3A 4B4WA 3C48A 1Y3DE 2Q8PA 4HDRB 1XMJA 3OE4A 4WACA 5CAEA 1T3GA 1J0AA 3W90A 5K6AA 1AKMA 3W9BA 2DUMA 3LVFO 3QZUA 3LOPA 2IRWA 4IHKA 3CPEA 3QKTA 2VKTA 4M1EA 3E58A 3BMCA 2BJHA 3IJPA 5LYYA 2YV3A 3BWXA 1F2DA 3FE2A 5K3CA 1DWPA 1P60A 3QVWA 1B0UA 4Q9HA 1U3GA 4QBKA 4OSOA 4JA2A 1NUTA 3QGMA 3TKAA 5KHLB 2FWNA 4B8WA 1A4UA 3X44A 4FP9A 1NBMD 1J24A 3C5CA 1UWKA 2BUAA 4K40A 4RSMA 2ZR9A 4N8EA 2QRPA 3UUFA 1OKKA 2EL7A 2HJVA 1GUZA 3INYA 3KFXA 3P27A 4LCEA 3ZW7A 3OLCX 3HKCB 3ZG6A 1DRVA 4QAQA 4RIHA 1GSOA 3I6BA 4DL7A 3UJ7A 1KKXA 3GYBA 7YASA 4B3SB 3FWZA 3D8BA 1PVVA 1W52X 2XYPA 3SVTA 5LYJA 1H9BA 4YXJA 1VGVA 5IC6A 1V9CA 4XGRA 5GWXA 1CUXA 1SC1A 4L8FA 2E82A 1Z19A 3DDWA 3IAHA 4BWVA 3GT0A 1KI1A 1O1YA 4WY2A 2FVXA 3N74A 4PG6A 1T1SA 2WM3A 4W9RA 3VM6A 5FBVB 1T9BA 1BWSA 5IJZA 1ZW6A 1F4PA 1XLWA 1D4OA 2EWWA 4TXMA 4KLUA 3HFJA 4O1MA 4W5WA 5CT8A 1LLDA 1KDOA 1E2JA 3E9CA 2V8OA 7ICHA 1Z0AA 2WW8A 2Y1IA 1A8PA 2AE2A 1ACMA 4MUJA 3TK1A 5CLFA 5K8LA 1WUKS 4JUAA 3T9DA 3OPXA 4HH4A 5FPPA 2PSHA 3KCQA 4P7FA 2C54A 2F59A 4IHJB 5AVVA 5I47A 1WZEA 1TK9A 4LNUA 4M9RA 1D9DA 2P4UA 3VH4A 4EB3A 4L73A 1GRVA 3VUFA 1YJ5A 3GMDA 3CVYA 4KLEA 1R8QA 5IFKA 5E7JA 3TTXA 4MTLA 1OI3A 4C7JA 4F4JA 2WB2A 2CDAA 1T5LA 4KLNA 5SYAA 1RRKA 4MVJF 5F4BA 4QXPA 2XDYA 3WRVA 3AW9A 1NR5A 3H8VA 1ZU5A 3OWXA 4JP5A 4URHA 3RE1A 5L6MB 4DZRA 5KKNB 5J0PA 3SVLA 1NI3A 4W5NA 2JGLA 3A9WA 3FYCA 3W06A 4QZEA 4YRCA 1QKKA 1XALA 2A0UA 3D4NA 5J2TA 1T4CB 1W96A 1Z62A 2NUPA 3PXBA 3QPAA 4P36A 4QDZA 4BV3A 1NI5A 4RIFA 4CQJA 5KYYB 4G5HA 2CXQA 1QS0B 2LTAA 4RNDB 3MTDA 4W9NC 3K70B 4AYXA 1I3KA 2W93A 3OOJA 4FD2A 3M89A 5FFMA 3PYMA 4OI4A 3WXBA 3QOWA 4R8LA 3PICA 1V5GA 1F6DA 1SVUA 3HWSA 1GKLA 3K4PA 2R1ZA 2DTEA 4A10A 1Y6ZA 3MRTA 1MFPA 4NFLA 2NU6A 2BR5A 2FR8A 2YWJA 1CG6A 4NZ9A 5EIBC 3WNZA 2MRLA 1GT6A 2F9FA 3IMKA 1ZH2A 3BQ9A 3FKSD 1JKMA 4H0CA 3RI3A 1GZ7A 3OCXA 4I5IA 3ONFA 1Y9EA 4WESA 2YDXA 4J1TA 2GKGA 3RR2A 5HNKA 4LOHA 4MR8A 3RSSA 4U2EA 2G06A 1S7GA 1MQAA 1GNSA 3L92A 4AROA 3V42A 4QIWF 4RHFA 5KYTA 3N9IA 4FFBB 2C59A 2O07A 3K0SA 3SOZA 1YKSA 4WY8A 1ZQNA 1MO2A 3M9MB 1T34A 2XUIA 3TAUA 1RXSA 2NUPB 2PLRA 4C2BA 3H17A 5B12A 3HCRA 1RSZA 2FSPA 5LA6B 2GZ1A 1WUYA 3SS7X 2CXXA 5DQIA 3HYSA 1WTCA 1OX5A 1W2WB 4MFAA 3PFCA 1WZIA 4FHZA 3ZU3A 1MAWA 4M9JA 4IOMA 1KVRA 3R7NA 1JPVA 2ADOA 4CKEB 4XDZA 5K3FA 2LYHA 2OSVA 3OA0A 3KXLA 4WXMA 3TEFA 1SHZA 4D6XA 2XOXA 4Q7MB 3L4JA 4U39A 3CUWA 4MINA 1Z4PX 1V8ZA 3AHHA 3D8TA 3JRNA 3PJDA 3RFAA 4IVNA 4Y6SA 5E8JA 3EUB2 1SBQA 2XLCA 1N3IA 5BNFA 4CMHA 3C8UA 4FMDF 4B80A 2R6CA 4PGYA 3P0HA 4C8MA 3WGOA 4D0SA 3JRWA 1PJ8A 2HRRA 3DHYA 1JEEA 1FXWA 1KA9H 2D74A 1SQGA 2OMEA 3CTPA 3NFYA 5BN3A 1TGVA 1GNRA 1KI4A 2DPHA 2Q45A 1R64A 3H9QA 3QUTA 4WQMA 1GPNA 3M5CA 3MW8A 3BXPA 1RLJA 4D3SA 1PAUA 3MD9A 1SFRA 4DM3A 1LV7A 4LOJA 5AOBA 4MF2A 1W2HA 4PX9A 4Q7JB 3IELA 3IHQB 1CUJA 1QK5A 1ZP6A 3OZBA 4RT3A 3PIDA 4IDDA 5C4GB 1BD3A 2ODTX 5C1IA 2PQMA 3CB2A 2HDOA 2ZANA 4JKIA 5CB6A 2ZAGA 3RAFC 3CP8A 1Q0HA 4LY6A 4XWAA 2AX3A 1X80B 4KAAA 1Z2EA 2VHVA 1D0IA 3BIFA 3JQEA 3U3RA 3RRBA 4OJTA 2OXCA 5I9LA 3JYNA 3V34A 2XAUA 5AKXA 3HP7A 4HB0A 2I9KA 2XMGA 4F3TA 2AZXA 3PPVA 1BDIA 3EFOB 3MGAA 1VG9B 3E7DA 2LE0A 1T3NA 5BR7A 1NHWA 1NWHA 1L7AA 4RGVA 3A3KA 4G85A 5D49A 2L82A 1E3WA 5DOZA 4RVSA 4UXIA 5BYKA 3U7FB 1UP6A 1XQ1A 2GAAA 4RNMA 4FWTA 2DBVO 4Y2PA 2GEFA 2GHQA 2JJ2A 3AJ8A 2KIVA 3EIHA 3Q10A 1RLIA 1SCKA 3Q1KA 3ISCA 2ZDGA 4ARVA 5DBFA 4FXOA 4CU2A 2VYNA 5LU9A 3ZE8A 4Q9IA 3E7XA 3KT6A 1Z0UA 4JUDX 3LBYA 3D6MA 4QM6A 3EDQA 4BS9A 3PXXA 3R6DA 2VJ4A 3DVRX 2HMVA 4FFNA 1ULHA 3QV1A 2Y05A 1HE2A 1HJPA 1SHTX 2H0AA 1DIRA 1NLFA 2JFFA 1KQQA 3A6HA 3IX7A 5EP4A 3A4IA 1UA1A 1BSVA 4IWXA 2QN9A 5F1OA 4KRFA 3NW9A 2B9VA 721PA 2X5XA 4F5EA 1R0SA 2IYOA 3OIWA 5GV8A 3TL6A 2GARA 3NTVA 4P2GA 4C6HA 1GZ5A 1J8QA 4DILA 3W5AA 3DCNA 3PLRA 1OGYA 3O3OB 1G7CA 4R3NA 4WLOA 3OCWA 3UK2A 1R5BA 3GFGA 1RFLA 3SE7A 2X2OA 4CV0A 1S9DA 2ZAOA 3FRJA 1KMNA 1NPTO 2CLIB 4N7JA 1BHO1 2C2MA 3TRFA 2XCPA 8ICOA 2J5KA 3LCRA 5DGBA 1AUPA 4UC0A 3VV3A 2ZTEA 4AU1A 1KY3A 3EAGA 5FTMA 5ARBA 3E18A 4MW6A 1FNNA 2V1UA 3G88A 5DBIA 5TMDA 2ZG6A 3SZMA 4L3OA 1OXBB 1Y1RA 2D5LA 1CB7A 1YDEA 3PDIA 4XE5A 4D0NA 2ZUCA 3HCOA 4UOZA 4ZTZB 1QZZA 3DVAB 4P3YA 2ZRBA 2R79A 2EKDA 1U0NA 5CDUA 3ZDFA 2XMZA 3OECA 3PPIA 4YCMA 3C6BA 3IQIX 2KM1A 2QY9A 4V0KA 3RTAA 3HU5A 1DCKA 1D2AA 3NWEA 3CF4G 1S89A 1HDYA 4MRMB 5DSTA 4HH0A 2G1KA 4W5RA 3U9LA 3I92A 1SKRA 1SVSA 3H6HA 3U16A 1FFWA 1YR2A 4L4ZA 2P9GA 2YWBA 5C2JB 2OBYA 3U44A 3RBXA 3FR8A 2ES4A 4JXKA 5FOQA 1XN4A 1ENPA 6REQA 2LXNA 1NJ6A 1TJ5A 4RD2A 1Z0SA 4QG7A 5AJXA 5KC9A 4ACAA 4O25A 1FP7A 4UM9D 5JS2A 4CT0A 4QRHA 3INTA 3FYUA 1H3NA 4MVJE 1OW3B 1OWMA 3D54D 3DW3X 1AN0A 1SBNE 4RMJA 2WKRA 1DS6A 4US8A 3JPTA 1U4NA 1BO6A 1HEIA 2G76A 2ORWA 1QDEA 4OGKA 4RA6A 1PJTA 1U5BA 2SHKA 1JBKA 1VHLA 1RM5A 2PGOA 3WFIA 2QRKA 3I42A 3RABA 2FXVA 3U17A 4UB4A 3H7AA 1WBBA 1GSIA 2EFEB 3FAZA 4JITA 1HGXA 2VQ3A 3FNFA 4R71A 1PIWA 3G0GA 3P2MA 1LPMA 2VCEA 3UANA 4FFSA 1HT1E 4LWZA 5GIPE 4MKFA 3DMDA 4UHDA 4UEOA 3TD9A 4RULA 1AF7A 2DPLA 4LDRA 3PD7A 5KPJA 2XDAA 3T9FA 4F7DA 3KX2A 4PZOA 4M9SA 2DRIA 4EOGA 1GTVA 1VGQA 4NLBA 5JRJA 4TKUB 5AVZA 3OG9A 3SLGA 4S04A 5F7ZA 1XJ5A 3ZWNA 5IX8A 3KHGA 1JIQA 3ASZA 3R3YA 3WZMA 1CV2A 2V6BA 1YR1A 2A59A 2I03A 1XD2B 3BRWD 3L18A 5JU6A 4FFLA 3W2TA 1RP1A 4RQ6A 3A0BU 2HHSA 1L7EA 3AR8A 5CYGA 2BEUB 3PO5A 4B8YA 1RS0A 4R6XA 4HI0E 4UFOA 4F1JA 5AW3A 3HWWA 1DJLA 5BW4A 4CE6A 1TKCA 1T2NA 4HXGA 4LYHA 1NUAA 4YCBA 2BQUA 1I0ZA 2EQAA 2EJCA 3SDZA 4KLJA 4BDPA 3E35A 3ZNPA 3ZVLA 1BIFA 5ALMA 2Q1YA 2NYVA 3M1YA 1NVGA 1F2UA 2B4KA 2R48A 3B3QA 3C3MA 4UAJA 4B84A 2BWJA 2YJGA 2QN2A 4MVYA 4NBTA 1EWKA 4NPHA 4P33A 1G8YA 2RQ5A 2Q2WA 2QB0A 2XZDA 3LPCA 3MN1A 4DLZA 5K8IA 2AN5A 5AKEA 3H2GA 4QEZA 5AKHA 2LIPA 3OPNA 3RFCA 5A71A 1OZGA 1KW4A 2IU3A 2J7PA 1JX6A 1SKWA 2PKWA 3CF2A 2NQ2C 3LE8A 1DADA 4GQIA 1TE2A 4QM7A 5KYGA 1IY0A 5CXUA 1CT9A 1MB4A 3IT3A 1DJOA 4Z9YA 1N2CA 5LP1A 5TISU 4MICA 4OQQA 3TZKA 2ZIEA 4F8RA 1XOIA 4HVLA 4AYBF 1AQIA 5JDIA 1U7WA 1MVNA 3M3DA 1UR5A 2IE0A 3OHSX 3M2PA 3CF4A 4D6YA 4IVQA 1U2QA 1CF2O 2AOTA 2B20A 1V41E 4YXMA 1A4IA 1MX1A 3DEJA 7ICVA 1XZQA 3Q2OA 4HQFA 4RGBA 4ZEOA 2II6A 1SVIA 3QJGA 5AJUA 3VHXA 2PMDA 3TB4A 5E6RA 2Q49A 2ODQA 2X0DA 2XGPA 1XXLA 4M8KA 3AQ4A 3A06A 1I7SB 2R00A 4I1OA 1KTQA 4LVUA 2PGAA 3A11A 3ZXXA 1YDWA 1NVEA 1PS0A 2ZUVA 1ZR2A 5DRYA 2HWXA 3H9CA 2VJBA 3JRXA 4JR0A 1O6BA 2BGWA 1Z2NX 1J7KA 2DY1A 3GNQA 4I4NA 2FSFA 3CW8X 2YTUA 4MNTA 2LPMA 4RQNA 1CZHA 5LYJB 1TZJA 4IY1A 4C6TB 1GEEA 4KTTE 3V8EA 2WYUA 5LJIA 1ZZGA 1E6UA 5GVRA 3FYUC 5BSUA 1UC8A 1NVTA 3NIFB 3K05A 1JXQA 1IWBB 3II6X 1CJBA 4I46A 4RZHA 4ARBA 4Z0NA 4URUR 2DXIA 4ZA2A 5IIIA 2A5JA 3OO0A 4GP7A 2E89A 4F3RA 3KR1A 4OQFA 4ARUA 1H8HA 2R8IA 3PWZA 3W9YA 1NT2A 1P7DA 3O21A 3HYLA 4BTLA 2W11A 4BVJA 1DQYA 3MT7A 4PXAA 2Y0SF 3DWGA 4RETA 2Y6UA 3NEAA 1U2SA 2AXTU 2NU9B 5A5GA 4MRPA 1IJKA 3VCBA 2YJ5A 4AKTA 1V39A 3U60B 4JL6A 4RL6A 3W8EA 1Q0RA 4ER6A 1QAMA 1EQUA 2E1RA 4RHXA 3S8MA 1W581 3NVAA 2C58A 2ZIUA 4R68A 4YCJA 2Q9UA 3V4OA 4BTVA 1YUBA 1PTJA 2R6FA 3PJRA 3PV8A 1REQB 4HAXA 4BB0A 2SNIE 2ZSAA 4GGMX 4KOEC 1CRXA 3PEWA 3ZLVA 2LW7A 2R8PA 1DXQA 1YKFA 2NSLA 2H2HA 2GA9A 5CXSA 2Y93A 4WL0A 1NX9A 3SR0A 2GBLC 1XSPA 2UYYA 4YRPA 2MCFA 3T3GA 3HCAA 4M60A 4GKJB 4FM9A 1SC9A 1MB2A 1KEWA 4MLDA 3W5DA 1OTXA 3CS3A 1OD6A 4ND8A 1K5HA 2R7NA 1AZTA 3T3FA 3FSJX 2EAMA 3CRZA 4Q16A 3SYNA 2BFDB 3NUGA 4YP3A 1FW8A 1MO6A 1W87A 3EGXB 1ONOA 4JBYA 4MLPA 5AJZA 5EQDA 2PA3A 3DO5A 1CJCA 3RS8A 2FW9A 1L5MA 3AETB 2HO5A 3DQZA 4NBUA 2NMVA 1T9CA 3I04M 4UDYX 5JW6A 5IRCD 4HTFB 3WLFA 4PPNA 1GUYA 1P5RA 3UOAB 2Y6VA 3VZCA 5CP2A 2FWMX 3G1WA 3FMFA 1A7UA 1P1HA 2C8KA 2HT1A 4UB8U 1QS0A 1TV9A 4WLNA 3TTSA 1J2TA 2IP2A 3B1JA 3ENQA 1K7EB 1XRQA 1GG9A 2VJLA 1QYXA 2ODGA 1UCVA 3CLTD 4QYSA 3MOGA 2HJSA 1P5JA 3LCMA 1RADA 2CUTA 3GZ4A 3IQGX 4CMKA 4J03A 4IEIA 1SOWA 4LDQA 4ABTA 1QHSA 4HD8A 1UDCA 2YV1A 2H5JA 2YZKA 2PS1A 3RVJA 4JI2B 3PEYA 1NRXA 1QRSA 2FPIB 3UMMA 4UXHA 3OURA 5KFLA 1CC1S 2YWHA 4CU5A 4YMNA 3ZZNA 4JC0A 1C0LA 5KTTA 2KSQA 2P6PA 1JEYA 3WADA 4DJFC 4QOGA 2ST1A 5KTQA 3VC7A 2PFQA 1PQ4A 1KKMA 4YALA 2JAOA 3IPRA 4UU1A 5A4KA 4KI0A 2JGDB 5E7QA 2B1GA 2GTIA 3M5PA 3ZI7A 4JLMA 2XYQA 1P4SA 1WAMA 1NNLA 3R3SA 1T0PA 4DBLE 1CQJB 5D01A 3ZHXA 3BRWA 5H5JA 1E69A 3EA4A 2BF7A 2VXBA 3DMRA 3GNLA 2VXCA 1L7OA 1ZJZA 1ZOSA 2IEIA 2Q3FA 4LBYA 3DBIA 4EW3A 4AMBA 5JEDA 3REQA 3A1DA 1K75A 1N6PA 4ZYWA 1T5OA 4DCTA 5CDYA 1G5QA 1E2PA 5MDHA 1WCNA 4TKVA 2F9MA 2NVWA 4MW9A 1N2IA 4GI1A 4ZARA 2EWVA 5TMEA 3ZWDA 4G07A 3R7SA 3BJIC 5DK6A 2PXXA 4O0MA 2OT3B 2HQRA 5EMMA 4CODB 5LN1A 4REQB 4BO8A 2PBLA 2WG1A 4RVCA 3AERA 4TUYB 1FUUA 3AIOA 3SZLA 4ZV4A 1O08A 1A2KC 1B3BA 2I8LA 4EGSA 4L5YA 4MYRA 1CETA 4J3NA 1CF4A 3HDYA 2XIQA 2N75A 3VBCA 1N2SA 2O1EA 4C5BA 1OZFA 4FYYA 5TQ0A 2PKQP 1R3UA 4C7BA 4F2WA 3AU8A 1UBEA 1CY7A 1XD8A 4NG4A 4GX2A 1PQUA 3OJCA 4RPJA 3RGWS 1UBMS 2X19A 2AJQA 4GMFA 3LUDA 3C23A 3IRUA 1YQXA 4PZ0A 4E07A 3ZGVA 3PGXA 2G70A 3DDNA 3ENNA 2GBLA 4BX9C 3MILA 1G16A 1LQ2A 1EP2B 4E2WA 2G17A 3D02A 4WKPA 1NM5A 3B78A 4YRTA 4FMPA 1FJHA 2YXPX 2ZZKA 1RHUA 4W1RA 2PZAA 3ZDCA 5TS3A 2J6UA 3R0XA 5EJ4A 4RSRA 2RGUA 2VWHA 1SWWA 1KO5A 2VTBA 2RBGA 1T25A 3NUZA 5K20A 1IXRC 2GYWA 2WFLB 3H5AA 5ILQA 1FOEB 7ICGA 3SENA 1LFAA 2BCUA 1QVAA 2EHDA 2UZ3A 3LYHA 4DR6B 1OA1A 2HQBA 1DX6A 1X1AA 4BN4A 1NWCA 2G4CA 4CUZA 2IEBA 5HS4A 3ERCA 2V9WA 4RPXA 4A6DA 3DE7X 5LDHA 2AFIE 2KFNA 1ZLXA 2HMSA 4GSYA 4IXWA 4TM8A 3HXLA 3AGQA 2PUTA 3ACBA 3CLUD 5G0VA 4E5KA 4IIBA 1AXEA 1S1CA 5LC1A 3DTNA 4WZAA 4DF8A 4DWIA 1Y5RA 2R6R1 1XT6A 3TQQA 2A30A 3CF6R 3T7IA 1IUOA 3MUNA 3DFZA 2XWPA 4EITA 5LLTA 3VDMA 5JS8A 2IHNA 1W93A 3AV0B 3BKXA 3DNFA 1VI2A 2HD4A 1JDUA 3FIJA 3WB1A 4LY9A 5DYYA 1NQUA 1CW2B 5B7QA 3CFYA 2Y1LA 3R5JA 3HU1A 3FPAA 3LC0A 2E49A 2CFOA 5KFNA 4OHXA 5KNDA 3AILA 3GUUA 3OPYB 1YB1A 2KLHA 2GESA 2O14A 4N0MA 3WJ7A 5LMNB 3ZNNA 2Y1GA 4Q12A 3ETJA 1LB2B 1GAQA 6YASA 1CQJA 3GVHA 4EJ6A 3OHAA 1YOBA 2A2ZA 1UFOA 2O7NA 3RH5A 3FHOA 4H6VA 3WIVA 4AJPA 4YCXA 1YXMA 4TZ0A 1C1XA 4FLFA 5LNK6 4MR7A 3UUWA 3NP7A 4LK3A 3V6MA 1VPEA 3NYRA 1T5BA 3AR3A 4GI2A 3RVQA 4AJ9A 2ZIXB 2IZ6A 2QN8A 2FMXA 2F3RA 3FFXA 2JHPA 1FBNA 3H4DA 2BZFA 5KTSA 2V54A 1HMPA 3JW8A 4L4RA 4B4UA 4HDKB 2PM8A 3DEZA 2EGHA 1LWOA 4E13A 5EWGA 5IEBA 4EI7A 2JBWA 3HVIA 2JK0A 5C9ZA 2O2EA 2E8PA 1DAHA 2OG2A 3EWIA 1JV2B 3ZD9A 4OQ4A 2OA0A 4EPYA 5DN9A 5G1OA 5H4GA 3WBJA 5K9ZA 2QR2A 4LJKA 3K1ZA 1T0IA 2WYOA 2KI5A 1N5LA 3KQMA 5G1NA 4PLCA 5AUQA 4X7BA 1H9CA 4KAFA 4OHKA 1JU4A 5KYWB 1U1IA 3QLJA 2DVMA 4RWEA 4OXXA 5IF9A 3G8BA 4QO8A 1H0SA 4OL0A 2DL0A 2X5KO 3EXG1 4U7PB 1NKCA 1C3XA 1F7VA 4DFMA 1AKTA 2WILA 5FPTA 5K2OA 5J2KA 3T9AA 3JQAA 1SCJA 4RS4A 2V3CC 1B6TA 1CHNA 1E18A 5T8KA 3ZLTA 4FTWA 2HNAA 1X38A 2B8NA 2A1JA 1MLDA 4MW5A 1NONA 2I4IA 2W2MA 1JPNA 2YHIB 4OXIA 2PX2A 2FZCA 4B9NA 4FONA 1DLIA 2QQGA 1SIUA 4PAMA 3T34A 1TYCA 2C4KA 4J0FA 2BDEA 2WWXA 4Z99A 2JD2A 3FNIA 1EDEA 1NMXA 1ZVQA 1GLVA 2ODNA 3O38A 3PC7A 2DFDA 1B3RA 1EBFA 1HK7A 2VPTA 5FBLB 4NM2A 3HZOA 1WB5A 4OTZA 2FB9A 3U62A 4DCPA 4OO1J 2G4VA 4UTXA 4AG6A 3MDCA 2A0WA 4EO7A 2AGOA 1EDBA 4KO3S 3U4AA 1AQNA 1Z5VA 4BN5A 2PS9A 2XMCA 2W6PA 2HYIC 3E27A 1T15A 1NF3A 2FZEA 2WBLC 2ZT5A 3KG2A 2EYUA 2HT6A 2WMOB 3RSZA 16PKA 2E3TA 3LDHA 2PA0A 1G18A 4F5ZA 5DLGA 5BR1A 2O8FB 1OT3A 3EZLA 2BCVA 1RWMA 1CUDA 4P0PA 2WNSA 3H11B 3A10A 3ASVA 3IVCA 1TJ3A 4BVFA 2VG8A 3HL4A 4FCWA 3M34A 4H3KB 3RHZA 1XFAA 3EYZA 1JIXA 4L5AA 3N07A 3A27A 3KSAC 2OWDA 2ICAA 3D4BA 3SF8B 3M8SA 2QORA 1B8OA 1AQUA 1E9DA 1QCCA 3WBBA 2OHJA 2VRNA 4UASA 1QP8A 2P2CA 3C70A 1Y4DE 3G8YA 3KU1A 2W9CB 3LFTA 1HE1C 1JTVA 2E4UA 3R7FA 3N2IA 1KKLA 5C7YA 4U9IS 1EAMA 2Z08A 2W4QA 1HT2E 1V11B 2FQXA 4AJKA 1G4AE 5AHXA 1ODCA 1GXSB 4I36A 5FL7D 2YV2A 8OHMA 4O2BB 1DK2A 2C8JA 2V7WA 3E3OA 3SDSA 2VEDA 3NHYA 3UMSA 1UMBB 3EG5A 1HG1A 4A3SA 4R0MA 5HKLA 2LKCA 1Y7TA 4KEAA 5EJIA 4I2AA 4YRRA 3VDXA 2QT0A 1S8OA 1XZEA 3ZJVA 4NV1A 2XGQA 1E0JA 3UW3A 2C96A 5EKDA 2OAEA 5DBEX 4D3FA 2WTFA 2B6GA 4I1PA 4W6ZA 1K89A 4F2PA 3FHJA 4LYDA 2HHWA 1G8SA 2QU7A 3G9QA 2FG5A 4MMXB 3B5JA 3EUAA 1PSWA 2OLEA 2ZJAA 4N3NA 3WRWA 2FSGA 4M1OA 1UPUA 3GQBB 3GCGA 4Z8YA 1QQ7A 1LGYA 1KI7A 3SM9A 1RE1A 1K1QA 2JMGA 2OV6A 4IH4A 5CVVA 3GJSA 2IH2A 4NCAA 4BFLA 5TR9A 3UK0A 4BVBA 2CFIA 4U2DA 2OTCA 3H1TA 3R5SA 4OQMA 1Z36A 3Q9LA 1V16A 2TMKA 3RYIA 5HE9A 4BRZA 2E4ZA 2OQ2A 4Z4GA 4JQOA 3EYWA 1KH3A 4EHKA 4D9EA 2IH4A 4QTXA 5H3HA 5CFPA 2DMRA 3V8VA 2Y92A 1SPBS 3LF2A 4IHAA 3QX3A 1T9HA 3W79A 2WIJA 1FDTA 1N1MA 3PR1A 2H7CA 5BXQC 3ELWA 1MNQA 2R1TA 3TLMA 4BV2A 4E03A 2Z7JA 2FPGB 2XB4A 2VHEA 3CCBA 3QTLA 1P4GA 3K6RA 4IS2A 5ECWA 3C3AA 4YVFA 4G0YA 2UVPB 3L6RA 3SSMA 4MARA 3K9GA 1LJUA 4QD3A 4Q66C 4PX5A 3LH5A 1QV6A 5DX1A 3K94A 1WR8A 3L7YA 4CNBA 1TZMA 3MIIA 3QQ5A 3D2QA 5IBQA 4PYJA 4ZJUA 4C87A 1W25A 3H2ZA 4D56A 2IEYA 1OI2A 4FILA 2DR2A 3ETRA 3QW2A 4D9IA 3QU7A 1LDGA 3BMNA 3HGQA 4TOIA 2OYRA 2R8BA 5LMUB 4Q4DA 4MUKA 5JJ5A 4JHXA 3Q5EA 5AVWA 2AHRA 4Q01A 1R8SA 2AWOA 1UBNA 2FPUA 1U2DC 2Q0SA 3C5WP 1UPAA 2B4AA 1MGOA 3E3LA 4FNAA 2MINA 5DYTA 3C7DB 2CRXA 1QSLA 4FVTA 4HNSA 1L3UA 1GCUA 5F1PA 4DPKA 1YCGA 3UPQA 2Z9DA 1FK8A 4RCYA 3PUXA 4TMZA 3KQNA 3HNOA 4A73A 4JXZA 4CKWB 1P39A 1H2YA 2A3NA 4W8OA 4EHLA 4KH0A 5LD2C 3RSCA 1ZM3A 3VSEA 4GHWA 3Q11A 2H0RA 4BPRA 2ECKA 3UMVA 1B14A 4MIYA 2R2AA 3IS3A 5L51A 1P3DA 2D6FA 1SN7A 4MKRA 4NLCA 5GZ6A 2CDRA 4KVAA 2X8JA 3NYWA 3JX9A 3GJRA 1XTVA 5CA1A 4AP9A 4ECZA 5J2BA 1RWNA 3GEBA 2VAXA 3Q7TA 1DX9A 4JJ7A 1EX1A 1L3TA 1LKZA 1QDUA 2YWRA 5J4KA 3P26A 3RHTA 3ZDDA 1NSYA 1ORIA 4K9RA 5JSQA 3F5EA 3I9JA 2HJHA 3STYA 4QUHA 2R9VA 3S2UA 1QGAA 2XZLA 2A9OA 2DR3A 4ZOLF 1U8TA 2JZNA 1EZ1A 5I9BA 1A98A 4GZ3A 3O4FA 4HKTA 3G23A 3QVKA 4X00A 2N1RA 3TMAA 5CT6A 5FWYB 3TR5A 4U4AA 2JFXA 4DOMA 4BASA 2F44A 3FR7A 1ESZA 5E38A 1IY1A 5KFXA 1X1CA 2QXUA 2IWHA 4EFKA 2EKQA 3G5MA 1ZZEA 2OWEA 1HLGA 2KLBA 2JGDA 3QJYA 4N7BA 3K0EA 4ZVSA 1WKCA 4E31A 3ZE7A 4Z9FA 1VECA 1Z3IX 2VP9A 5LP6F 3ROZA 2VLIA 3AUAA 3D3QA 2W2OA 3LVRE 3JALA 1XEFA 4NEQA 1VCMA 3BQ0A 1JAIA 3PRYA 4H7IA 4N6GA 1Q8KA 5D3KA 5FCDA 3K75D 1NY5A 4P98A 2W9MA 1H2BA 4F6RB 4CLRA 4UHBA 1GGKA 2ATVA 2QU8A 4Y7DA 3M9NB 3DV2A 2PQ2A 4OQNA 5DW0A 3GZNA 5TS2A 3V4SA 2RDIA 1SR8A 2CE7A 1XTUA 3A6PC 1XVTA 4IMIB 2IV3A 3E23A 1O4VA 3Q9NA 4KN9S 4FGSA 3R0QA 3TR0A 3P9CA 4JYCA 3V80A 5BNTA 3LA8A 1MEOA 1TAMA 1M1NA 3T7RA 1DAKA 1V9SA 3F2DA 2CNKA 3DFIA 3DYBA 3HVJA 4D98A 1ACJA 3DEYX 4AICA 4FN5A 4ECVA 4IGIA 3HBLA 4IIUA 1ZIDA 2VPIA 2YHUA 3H9UA 4JGIA 4MW1A 4AN0A 3LZCA 3QPDA 4WLFA 2AT1A 1DKRA 1DKNA 2H52A 2BDUA 4EZ9A 2QD2A 2IS4A 1GAJA 4ITRC 1M1ZA 1VLLA 4DYDA 4HLUA 4HBGA 9ICRA 1FTYA 2FW1A 2G1JA 3HB5X 2BM8A 3NP9A 4DCSA 5DK4A 2XA1A 1H2ZA 3MJHA 4B5LA 1K5GA 3IULA 2A5YB 3JPYA 3HG7A 4BFUA 3WLQA 4BRSA 4HAYA 1KH1A 4XLTA 4OU4A 1E77A 2BZ0A 3MAGA 5AP9A 1AK9A 1OCEA 1Z0DA 3CR8A 3FPLA 1JN3A 4KI7A 4C7KA 4M0CA 1BE6A 4LXXA 3HCPA 1D8AA 3AX6A 3DE2X 1EK2A 1N1DA 2AI2A 3ME5A 4R5MA 4C8KA 3S68A 4EGJA 1WE2A 4EG6A 5IC5A 1J1ZA 3EPHA 2HSDA 2FZKA 4TV9B 3KM0A 5IKMA 1Y7PA 3SX2A 1YB4A 1D09A 2HMUA 5FUXA 3LSYA 2J9FB 3MT9A 3OIDA 3VAZA 3RADC 5KG5A 1P3JA 3QWIA 1PZMA 1NQAO 1QYWA 3G3EA 2ZIAA 2I99A 1C9EA 2WJ3A 3GIWA 1RPNA 5LQSA 1Z5WA 4WXYB 4BJHB 2A1JB 1SZPA 3HCNA 4QE3A 1QGED 4ED0A 4RENA 4KPUA 2PZBA 4JB0A 1X8XA 2A0YA 3LPLA 4OBEA 1OC4A 4FR2A 1ECLA 2W6JA 3SE0A 2CMDA 2ZRDA 1EU1A 5FUMA 5INTA 4H1WA 3QKRA 1J07A 1K86A 4RHCA 1EUZA 1UQUA 2FR0A 2VH1A 5I4IA 5IYZB 2G8LA 2DCUA 2NU6B 4I2NA 3GLVA 2EBWA 1EAYA 4J2TA 4F91B 3GGPA 5JSYA 1EP9A 2TMDA 5FTWA 1ISIA 3F74A 4ENUA 1QV7A 3A2KA 3SKYA 1OZAA 2IOFK 5C8YB 4ZZ0A 2JBAB 4FGLA 2HWKA 2QRVB 4FZRA 5GVSA 1JXMA 3JPSA 5G3ZA 1ZQ9A 4FB4A 2QQ5A 1B16A 3MWDB 5GTDA 2H1OA 4M76B 3KLOA 4R9NA 1ODJA 5D6OA 2O3RA 4I55F 4MFCA 5EGSA 3S2ZA 2I1VB 4AP5A 3FWNA 4D8UA 5DCWA 4ZDKA 2JHCA 3IQEA 4NBLA 1SHJA 3VOSA 3UOWA 2QQFA 2WLTA 1L5YA 1SO8A 2ZE6A 2YN0A 3KKQA 4R0NA 5F2NA 2PEYA 3FB1A 4NFYA 4DJDC 4OYHA 5C81A 2WF8A 1T8PA 2RB5A 3LTEA 3TZEA 2C0CA 4YFKA 1ATIA 2O6LA 2N3ZA 2QD4A 4EA9A 1PL0A 3WLTA 1KAGA 4MRRA 4DCNA 1VL1A 3LKZA 2HPAA 1KZ1A 3JYLA 4OKSA 3D9QX 3LHDA 1XPJA 5J1SB 1XMXA 2VBCA 2JIZD 1ZQOA 2BP7B 3PDJA 3QY9A 4CLEA 4BO4A 3M6KA 2VQDA 3HWX1 1ZI9A 3DFFA 3OM1A 1Z5GA 3JV7A 5EP3A 1EBUA 4AW9A 5AVKA 4CN8A 1SCNE 4K86A 5DN6D 1XCLA 2HRZA 4YRSA 1CRZA 2F3QA 2RHFA 5CA1F 3PBKA 1OWLA 1I7PA 1DKMA 4AY4A 2HJWA 3R5FA 8AT1A 4NU6A 3KDPA 1F0NA 1N6HA 5CHEA 5FYQA 4DZTA 2GPNA 3AV3A 1ICEA 1K4MA 3MMZA 4LNAA 7ICLA 2SKEA 1ISSA 4HLUC 5COQA 1ZQRA 2CXUA 2HHAA 2ZT6A 2FPPA 4OYYA 4PN7A 1TKRA 1TL7C 2G5TA 1GPYA 1PG0A 2HQSA 5DM2A 3SS9X 1P5FA 4ESVA 5AI6A 1FJXA 4RNNA 1P9OA 2WWFA 1ECBA 3GAMA 4YP0A 1U2GC 4XIIA 1AMOA 3ZHUA 2P9CA 3OQ1A 4CMIA 5BSMA 3MAAC 1KFJB 4QGHA 3LI2A 1TVAA 1Z4OA 2WG2A 2GZDA 1PR0A 3KJHA 4Q4HA 1SV4A 4KITB 4DSNA 2BDTA 2H7XA 1QAQA 3VZPA 3GPBA 3WLKX 1BROA 1IAQA 2O2IA 3FA2A 5DB9A 1JLMA 1T10A 4JR1A 4IIGA 3L43A 1TXGA 3NRWA 1MXFA 3GDOA 3JQGA 3A3OA 3M9OB 4C78A 3L0BA 4IQUA 3KLBA 4BNVA 4MV1A 1GV0A 1DIHA 1Y9AA 1COOA 2EF0A 3ADOA 4DARA 4LZDA 1T9GS 2V7BA 2XMRA 4PC3A 2KBFA 121PA 1ZONA 3V32A 3BE6A 5J2DA 3MB8A 4TWJA 4BMPB 4IQWA 3WBFA 5FADA 3GEIA 2V9ZA 3S99A 3RUDA 3CX4A 4KK3A 3JD1A 4OK3A 3O4VA 4JR2A 1FUKA 4U7GA 2CLDX 1AKEA 2ZULA 1RC8A 4NH4A 4KP7A 3T1VA 1XN1A 4JT2A 8ICWA 1LW6E 1PFKA 2ZTSA 3MJCA 4IHJA 5ALTA 5CDHA 2JRZA 2W3RA 4UBCA 1Z4IA 3A37A 2ZSIA 9ICWA 1NXSA 1YDFA 1I4EB 2ADFA 4HNRA 3WQQA 2QARA 1KEUA 2XVYA 3TTVA 4KBYA 2WZQA 3WX0A 2A9JA 3KXDA 2Y1OA 1HOTA 2V1XA 1PHPA 4NMWA 3RS4A 2EAPA 2H31A 3ZHOA 1WXWA 5KYXA 3CHYA 2WKQA 2ZYIA 3G89A 4YCNA 1NR1A 5EIBD 4OBBA 5B4UA 2MSCB 3ALRA 5AICA 1XVUA 3O3MB 3RRXA 4N7RA 2JFPA 1DBWA 3DBLA 3IO3A 3AUJB 3K9LA 3NEJA 3O2SB 5M04A 2IU4A 2IIVA 1JQDA 3P2YA 2CJWA 1L6RA 2TECE 3C3DA 3D8UA 3JARB 3NORA 1FDVA 1G0OA 3QX8A 2R85A 3R3ZA 3GJ7A 4KX5A 1WS6A 3LVQE 1U6JA 5KL8B 1IBSA 3F6EX 3H18A 1BRTA 1C4WA 2VUUA 9ICUA 2XQJA 2AHOB 3UHOA 1HDXA 3PT5A 2Q1WA 1FSZA 2E6KA 3QHPA 2Y67A 4OQYA 2HSEA 5DYWA 2IP4A 1IHUA 3N2NA 2O4UX 1FJGB 3SXJA 4ZK2A 2GXUA 1TZ2A 2KG5A 1E2UA 1EM8B 5DM1A 1TYAE 3GAZA 2OILA 3GO4A 1JAHA 5DYNA 3T4PA 2HO4A 5BMOA 4S05A 4S1VA 4HAIA 3PRJA 4J7AA 3ZCXA 1EFRD 1OV4A 4YN3A 4A8TA 2OCAA 1X0VA 1Q3VA 4MHVA 2NSYA 3HA3A 3KVRA 3W8FA 3JQQA 3ZE9A 3TPZA 3KTAA 4F3CA 4LX8A 5HKOA 3G0HA 5CBPA 3AHGA 1QMGA 4FYPA 4R0VA 2C3OA 3DE4X 1M8JA 2UZ4A 4FR5A 3B1ZA 3H0MB 1CERA 2NUTB 3CONA 4JYBA 4K9KA 3C6XA 1PK7A 2WWGA 4KFTA 4YJKA 1U6IA 2XGSA 5A5EA 4YD1A 1USWA 3KIPA 2XDQB 4Y9SA 1NVXQ 3SIWA 2GCEA 3B70A 4ESOA 1K9SA 1EUYA 2ONYA 4CEJA 5FOXA 1NBOA 1JE1A 3PKJA 3JSXA 5A3SA 4M9NA 1IJFA 1GU7A 3DG9A 2JKYA 2W7TA 4LPSA 4RIIA 1AHNA 1G5RA 2O7RA 1C0EA 3R8XA 2XNCA 1AUQA 3WR5A 3CVUA 1DPFA 3PR5B 1G1MA 3F4LA 4TQAA 2F55A 4K28A 5HGJA 1P33A 2O2ZA 2I71A 2QYTA 3C6ZA 4LN1A 4XYLA 1N6RA 4EARA 5BUQA 1DEOA 1XAGA 4OLAA 3NV9A 4E22A 1BJRE 3CZAA 4NZNA 1W0KD 3UV7A 1N3BA 3ILYA 3JATB 1T5TA 2OGWA 5C8XA 3OMWA 4NE7A 3HGTA 2PWAA 4AZ3A 3OZTA 4DWOA 3Q1LA 4P3XA 3AY0A 3P5SA 1WSAA 1WW8A 3FF1A 2F8TA 2EZ4A 3G1UA 5JI2E 1I10A 1M6HA 3GUZA 2IS6A 2PO7A 3U0VA 1PFYA 4DA7A 2BAGA 5C34B 1M76A 1WXEA 5DKWA 4WCFA 4DQLA 2OUKA 3QF4B 1FJ2A 3ESQA 2P2LA 5CBPB 2OD7A 4NU5A 1QYDA 1RM3A 2Z5LA 3W04A 5FDFA 2I33A 3ANXA 3CSUA 3NG1A 4UUPA 3BWYA 4AT1A 5AIBA 1IC6A 3OEYA 1KRWA 1HLDA 4QASA 4IILA 1F4LA 2OAQ1 5E95A 4A2CA 4ER5A 1ZNXA 1FUIA 3U4CA 3LWZA 5AHOA 3D1JA 1AKUA 3JWIA 5DULA 2Q3LA 4DBLC 1LDNA 2FCAA 3C2MA 2PK3A 3CX8A 3JQCA 2K5UA 3QUBA 3R5HA 2V0GA 4MA0A 4GLFA 1CVIA 1FQWA 4JMLA 2UUBB 1W44A 5EXSA 4LQCA 3ZHRA 5FTJA 4BO0A 3M4NA 3B51X 5DGXA 5MN5A 3GP3A 3P9XA 4LRTB 2CZQA 4MVJM 1QO0D 2AJCA 2IP1A 2A1UB 1CZRA 3HJHA 4YB8A 3VNRA 4P4MA 4CUJA 4QDOA 1M5TA 3NBYC 4B6OA 1UK6A 1JJIA 3EEFA 3W4JA 2RGEA 2FQQA 1LNZA 1CYDA 1YT3A 2PH5A 4GX5A 1YBHA 3IBGA 3HADA 1VPVA 4QBTA 3C28A 3BTSA 4MRMA 1N6KA 5KFQA 5GINE 4WEOA 4KLRA 3FCEA 2BGKA 1ZLYA 3RU7A 4PC1A 3KYCA 2OCPA 2NZ2A 3IDSA 2BDPA 5G53C 1UKZA 4IMJB 4TSFD 4ZMBA 1L4LA 3UJAA 1Q7CA 3IUPA 5KFOA 4NR0A 1VZ3A 4IDFA 4A7PA 5HF8A 1ABBA 1NAHA 1H5NA 4Q48A 4MFFA 1M10A 1TM3E 2QTCA 4KGVA 5CMLA 1ZJYA 1RZUA 4YRLA 2ZRHA 3RC7A 2GNAA 3VYTB 4A82A 2EC5A 1KN5A 2OZLB 4D3XA 5I4BA 4ALKA 1X1BA 2OV3A 1PR9A 3K16A 2C4NA 3WLEA 4EHNA 5IDQA 5E1BA 2PPLA 1PG5A 2JRLA 1EJBA 3NM6B 4N01A 1A7KA 4XR4A 5BNIA 4M89A 3ZGYA 2ERXA 3QA3E 1ESDA 2YWDA 1Y5NA 4GPIB 1XROA 2EP5A 3F67A 5JATA 2HQOA 2ZYTX 2CLFB 1E9VA 3CO5A 1JF8A 3CRW1 1UM9A 1UPCA 2P7HA 3M5WA 2EZZA 1Z12A 4EYIB 3BDIA 2MUTA 1KC3A 2HA3A 4G2TA 3WRYC 3B1VA 4XVCA 5J8YC 2BCRA 3JVDA 4EENA 2VPYA 3IMGA 3UK6A 3WMXA 2OKGA 4D57A 3EC2A 2RK3A 1HEUA 2PY6A 1Z00B 1ZGHA 3HHEA 3KDSE 1RYUA 4ZZ2A 4YRAA 4TRRA 2O6KA 5DH9A 1HRDA 4U7CA 3KP1A 3BWMA 2ZAMA 3E82A 1JQ5A 3G0CA 4QVKA 1N0IA 4PIMA 4ZPJA 5GOZA 3TOXA 4YRBA 2CPRA 3GFKB 4ED6A 1KZGB 2QLJA 1AHPA 2OXTA 3JTEA 4ER3A 3DZGA 4ZC1A 2RGXA 4GEGA 1FLDA 3EEQA 4LYJA 4BQIA 1TAUA 8ICUA 2D3WA 1FF9A 4XUCA 5L95A 2ZZNA 1RW4A 3A14A 2CNNA 3WGYA 4KRYA 2ZITA 2O8BB 5AK5A 5A5VA 4U7TB 4RD0A 1MQ9A 3OF3A 1GYRA 3OKFA 4QFCA 5KSWB 2G9NA 2LIVA 1Y3BE 2PJDA 3DKIA 3VTFA 1S3SA 1DHRA 1R37A 1FE8A 3M70A 4ECRA 3OX3A 3V2HA 3AVWA 1ZESA 4B6QA 3QHQA 4BFCA 4DJTA 4GVLA 3E9MA 1AKRA 4OQLA 2A1TR 1X70A 3GW8A 1ZGZA 2ZB7A 2IYYA 5FTLA 5IINA 4CIDA 2GSDA 2J0EA 3IP7A 3T94A 3TLKA 1OB5A 3PSAA 7ICRA 3F3YA 1ISJA 2JFOA 5BVHA 2VYVD 4A0GA 2JGNA 1V3VA 3OP1A 4BRWA 1J39A 4DNQA 2UZ0A 4QAJA 3UGTA 3NXKA 2XCUA 1QRAA 3OICA 5BOVA 4DSZA 4XCVA 2FW0A 3Q15C 4QQKA 4NCXA 2JAPA 1BTOA 1WCXA 4Q9NA 3AFNA 1JGTA 3KR2A 4HAVA 1S2LA 2Z1DA 4FLEA 4WN9A 1C3LA 1ZQZA 1JKJB 2OE2A 3A9CA 4WKGA 1KMHB 4BO3A 2Q2QA 4ZI7B 1L4UA 3G2HA 1N75A 2I5PO 4FCCA 2J48A 4NP6A 5D7BA 4I5GA 4YRJA 1M1YA 5IN4A 4MS1A 4B71A 1L5GB 2H16A 3M5DA 4LJLA 2EJTA 4PLYA 3KC2A 1ZSVA 3A9UA 4MYTA 2XKKA 1QVWA 5A62A 1L5ZA 2CXHA 2C7GA 2XCLA 3G9XA 5DHFA 4ZV7A 4OJMX 4YRGA 5IMSA 3O1HB 2Y1CA 4PHAA 2G0TA 4NZZA 4RU1A 3WYBA 3KTAB 2E1FA 4EG8A 2LM4A 3JQ6A 3EHEA 3NGDA 1S7CA 1TW3A 1ZSNA 3GT4A 4W7IA 2M6LA 5DB8A 3MINB 4EYGA 8ATCA 3BJZA 4ZCSA 3K0FA 3SBDA 4LF7B 3A1UA 4WNCA 3CRXA 1XU4A 2KQUA 3KYJB 4EYSA 4HXFB 5AUNB 1PT8A 5LA6A 4HV4A 2WJWA 3CNHA 1RYZA 4PY2A 3DHNA 1Y1SA 1SU6A 2ZT7A 2I3DA 3Q3VA 4D44A 2SCUB 5KG1A 1NN5A 1Y80A 2WJHA 1IV8A 2YIDA 1RZ3A 3NB0A 3R6LA 1WB9A 4RTPA 4O33A 4DQIA 4LZZA 2HBQA 3H05A 2GPTA 2VA3A 3AHDA 4ZHQB 4EUKA 3ETEA 2VF8A 5FOSA 4CWAA 3HH8A 3H2JA 5BORA 2PSJA 1ES9A 3QOXA 3U48A 2FN4A 1ULAA 1TQ2A 1XDGA 2KJQA 4WZZA 1QZUA 1YJBA 5AT1A 2QQEA 2XQGA 4RORA 1Y98A 5BQPA 4M87A 2VK4A 1R6BX 1ZMTA 2RAUA 1MD9A 4BKOA 4ZKEA 2JEZA 2VKQA 4DT1B 1KP3A 1FP2A 1OAKA 2ZS8A 3K09A 3KEFA 1OBOA 2BTQA 1Y3HA 1G5FA 1YBAA 2O52A 4Y9UA 5F9MA 2ZCUA 3H4IA 2J5QA 1NG9A 4QWCA 1EH5A 1JX4A 1O6FA 3I1IA 3R6WA 1JSLA 3E9NA 3LY8A 4MB6A 4ZC8A 3RWBA 2O19A 1I5EA 2AYZA 1DFIA 3W3AH 3ISTA 4MO2A 5B3AA 4O08A 2CL6X 2JJYA 4B9SA 2QUBA 3KV1A 4C6SA 1B41A 1IFXA 3CG4A 4NU8X 3OCZA 3V6LA 4IOLA 5JAUA 5J47A 1SQFA 1GYQA 4P4TA 4HY3A 4BLWA 3KD2A 4LRQA 2NV6A 4RK6A 1WXQA 3ONEA 1KSGA 3AKZA 4MR8B 4OP3A 3A4VA 3UZUA 3LKVA 3ZE1B 3ZHQA 4D8WA 4EABA 2W4MA 4NXNB 3AEXA 5KG0A 4OFXA 4CIVA 4GX0A 2I1WA 2ZYAA 1DC3A 2NUTA 4TYNA 5D5QA 4FHDA 1J00A 3Q5GA 2IEDA 1HURA 1PZFA 5GAJA 3NOQA 3IKMB 4D0RA 3RANA 2FPGA 3EWNA 3PTAA 2AFIA 2FDXA 1WVIA 2V7QA 2WZCA 3D3WA 4IQ4A 4X5VA 4IV5A 1W48A 2XGOA 1OH7A 4I2HA 1XU7A 2XICA 1UMDB 1GUAA 2VLBA 3BGDA 3LQKA 4HYTA 4DJJA 1XJWA 4AO6A 1FPQA 3F7NA 4N54A 2X1MA 1BHJA 5H4HA 5FWXB 4UAYA 3CISA 3RUEA 1QWSA 2QTHA 1RMYA 1XU9A 1PGPA 3TL3A 4PZAA 4LDZA 5IU6A 2ZTDA 2WVAA 4E5MA 5E4FA 1LUAA 1FB5A 4QOHA 3T52A 4CFYA 1Z22A 1GYPA 3FMIA 3B7GA 4I99A 4KN6A 1UA0A 2GILA 4K3UA 3EPKA 5ECGC 1NOIA 2MMCA 2DSTA 5ENZA 4HWRA 4QPDA 4BFSA 4DRXB 4EO9A 4LECA 2AU0A 2SICE 4JGGA 4RKRA 4PYLA 2V7EA 3CNLA 5EWMA 5ALJA 1YA4A 3SR3A 5BSKA 5GMOA 4L2IA 2L69A 5AXBA 2VJQA 4B2IA 4I2EA 3DDZX 1Y8RA 3WGKA 4L7VA 2QM3A 3I9OA 4ERXA 1D07A 2VQ6A 1PL7A 3QPBA 4Q43A 1Y3CE 3FB4A 4C0HA 5J58A 2YXDA 4JLPA 4NCIA 1YMVA 5FOUA 3IN5A 4XVQA 4L5CA 4OKIA 3T41A 4QG3A 5JY1A 2BGRA 2YYAA 4N3AA 1IZZA 4J9UE 1BWPA 5T4HA 4QUAA 4HNAB 2OFFA 4F8YA 4OB8A 1JIVA 2C8VA 1TZKA 1U7ZA 2QARB 1O8CA 1XWWA 2XUFA 3V5NA 1XAIA 4PLPA 4EI8A 1SY7A 1NLZA 5ALIA 1TUBA 1MHPA 3C3YA 1VLHA 4ZICA 3BS4A 4MA4A 1RP7A 3LPAA 2AMFA 4RY9A 5IJAA 1T6NA 4L76A 5CP8A 2BKXA 2P4EA 1T36A 3FOCA 2QLTA 3NDPA 5ISMA 1L1QA 1P9RA 2W42A 2BH2A 5ER9A 5EWMB 1C1YA 1E89A 3I12A 1DGQA 3L49A 4ELVA 1UBGA 1WY7A 3BE5A 2YNMC 4IG9A 4OU5A 4CRWB 2QKQA 2IZ1A 4IJVA 4HG2A 4HEA1 2PMEA 5KNLA 8ICAA 2XR1A 3WLMA 4EPXA 4HN2A 1EK5A 3ZWWA 4DRYA 4UOQA 2H06A 2KTQA 1WEKA 2B30A 3CH4B 3QWAA