2I6XA

The structure of a predicted had-like family hydrolase from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
205
Chain Sequence
AMIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRFLPSGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLLREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a predicted HAD-like family hydrolase from Porphyromonas gingivalis. (CASP Target)
rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
molecule keywords Hydrolase, haloacid dehalogenase-like family
total genus 73
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2006-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2i6xA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i6xA01
3WKBA 4I9FA 3SD7A 2IOFK 4NAVA 1TJ3A 2B8EA 2JGAA 3N8GA 5AKJA 1YS9A 1XPJA 3DDHA 1NNLA 5AVWA 2ZBDA 3E8MA 2WFAA 1WPGA 3ZX5A 3W5AA 3DAOA 5ALMA 2YMLA 5AW8A 2FPSA 2C8KA 2Q4TA 3I28A 4QJBA 4YGYA 1QQ6A 1RRCA 5ALOA 5AVRA 3NIWA 5AM2A 2O9JA 3N1UA 4MUMA 1Z88A 1CR6A 2YMQA 1RMQA 4Y2QA 2WM8A 2C9MA 4UAUA 3SKYA 1Z4MA 1SWVA 5AM5A 4YCLA 2HDOA 4KX5A 3QUCA 2HSZA 3ET4A 3D6JA 4XPZA 3FVVA 2EATA 1ZRMA 2PKEA 3L1VA 2R8YA 2WF8A 2B1QA 3L1UA 3WKCA 2FUEA 2GHTA 5AVYA 3WGVA 3W5BA 4I9GA 1Z4OA 1ZJJA 5IS2A 1YV9A 4C4SA 4ZEVA 2ZXEA 2P69A 3U13A 4YCNA 1RKVA 3ESQA 4UM7A 2ODAA 3MC1A 2QYHA 3R9KA 1F5SA 5AHXA 4F72A 1SWWA 3NRJA 3ZUPA 5A3SA 1Y8AA 2EAUA 1YNSA 4UU1A 5ALQA 5AVUA 2CFSA 1RKQA 5AW7A 3IJ5A 2GMWA 3OTQA 3UM9A 3UMGA 2C88A 4YIKA 5AW5A 3QUQA 3L7YA 1L7MA 4E88A 2MU1A 1SU4A 5ALWA 5T41A 4HGOA 5AW6A 2OYCA 2FPWA 2RBKA 4BNDB 1LTQA 3KBBA 2ZOSA 5AW3A 3NANA 4NWIA 4HAIA 2VKQA 3WK5A 4RETA 2YBDA 1VJRA 2X4DA 4Y2JA 5ALIA 1N9KA 3OCUA 1LVHA 1YDFA 4Y2VA 5AKLA 3WK6A 4EZEA 3RFUA 3QGMA 2RAVA 3E81A 5ALHA 3CNHA 2I55A 3E84A 4EX7A 1KYTA 4NV0A 1Z5UA 3E58A 5ALLA 1CQZA 3IRUA 5AVSA 4IG4A 4BKMA 1RLMA 2HO4A 2PR7A 5AVZA 5AK4A 3W5CA 3WK8A 3ONNA 2IYEA 3AR9A 5ALXA 3AR3A 5AKZA 3KC2A 3PCTA 3QUTA 5AI9A 5JJBA 1ZRNA 4YCMA 4BBJA 3VAYA 1QH9A 1J8DA 2B30A 5AI5A 4EELA 2EARA 3PGLA 3N07A 1Q92A 1NF2A 4O8CA 4UMFA 1ZD2P 3AR5A 3QLEA 5AW9A 4KNWA 4L6CA 2W43A 5AW1A 3NASA 2GFHA 4DW8A 2WF6A 3J7TA 2G80A 3MN1A 1TE2A 2R8EA 3NUQA 3MPOA 2ZBEA 1T9ZA 5ALTA 3U26A 3AR8A 5AW4A 4UMDA 2PQ0A 2HCFA 2I34A 4BX2A 4UU0A 5ALFA 5AW0A 1Z4IA 4Y2SA 4UM5A 3QYPA 1L8OA 1YJ5A 5AI8A 3ZVMA 4J2TA 2HEGA 3EPRA 3TLMA 5AIAA 2YMMA 3P96A 3I1YA 4Y2TA 1T5SA 2JAUA 2JAWA 4IFTA 3SHQA 3ZW7A 4CF5A 3PGVA 3ZX4A 5ALUA 3M1YA 1Z4KA 3FPBA 1RDFA 1Z4NA 3B9BA 2W4MA 4G63A 3DV9A 5ALGA 4XE5A 1YMQA 1Z4LA 3I76A 1Q91A 3WKDA 2ZBFA 4PNHA 3QU9A 5ALEA 2HI0A 4OCZA 1X42A 4Y2PA 3QU5A 3ZWDA 4EEKA 1O03A 2I33A 5AVQA 1L8LA 4BEWA 4HGPA 3L0CA 4FE3A 4CF3A 2YJ6A 5A3RA 2BDEA 5ALDA 2IOHA 4G9BA 2G06A 2CFTA 4JDPA 4KN8A 3W5DA 2HF2A 1S8OA 1VJ5A 2FPRA 4HGNA 3A1CA 1RC8A 3EWIA 5AKKA 3UMCA 3HYCA 4NABA 4UASA 3L0BA 2Q5EA 3A1EA 5A3QA 4DWOA 2OM6A 4RESA 1IWOA 1NRWA 2NO5A 5AVXA 3M9LA 1TJ4A 1L7NA 1Z4QA 2MU2A 2R8XA 3L8HA 3OCZA 4OFZA 1QYIA 4KX3A 4DCCA 3EF1A 3FZQA 1U2TA 4MWOA 2CN1A 3N28A 4CE6A 1WVIA 4UMEA 3QX7A 2B0CA 2NO4A 3QU7A 1RMYA 3HLTA 3A1DA 4JB3A 2AH5A 5AK3A 3MMZA 2GO7A 3PDWA 5AKHA 3N5KA 4UW9A 4UMVA 5AW2A 2WF7A 3L5KA 3UMBA 2AMYA 5AI4A 3GYGA 2YY6A 1N8NA 3ZWKA 3QU2A 2R8ZA 4EENA 4J03A 2G1AA 3ET5A 3OCVA 1S2OA 2G07A 3K1ZA 3ZVNA 1EK1A 3AR6A 3WKEA 2HOQA 4UATA 5FP0A 3U7HB 3WK7A 4BX3A 4XQ0A 2WHEA 3SMVA 5AKIA 3KOOA 1QQ5A 5AM4A 3WGUA 2AGVA 3ZTWA 3CZ4A 2MSNA 2G08A 4Y2RA 1ZD3A 2C8LA 2O2XA 2I54A 4HYTA 3OCXA 4BNDA 5AICA 4Y2UA 4CF4A 2G09A 3BWVA 4OHFA 5AKXA 3U19A 5IT4A 1ZD5A 2YJ5A 2HF7A 3KD3A 5AK6A 4GXTA 4YIHA 5AI6A 3ESRA 5AIBA 2YFYA 1XVIA 1J97A 3SLRA 3AR7A 1U2SA 3L8EA 5ALJA 1WZCA 3U7EB 5IT0A 1U02A 3QU4A 2P9JA 1EK2A 1PW5A 5ALVA 4NFLA 1RPZA 1Z4JA 3A3YA 3ZVLA 5AM0A 4HGQA 3OPXA 2IOFA 2JARA 1Z4PX 1T5TA 3QXGA 3KDPA 1RLOA 3AR2A 3ZTYA 2WF9A 4Y2XA 3L0YA 2YJ4A 4UARA 1Z5GA 5ALKA 2G0AA 4C4TA 2YJ3A 5AK5A 4ZEWA 2JAOA 4Y2YA 1MH9A 4C4RA 1XP5A 2BY4A 4QQFA 2FUCA 4EX6A 4GIBA 4KNVA 4Y3UA 2I7DA 5ALZA 2WF5A 5AKEA 2GHQA 3I6BA 2B82A 3R4CA 2P27A 4B6JA 1K1EA 1WR8A 1RKUA 5AVVA 3OCYA 5AESA 2B1RA 3F9RA 1FEZA 1VFPA 4ZEXA 1ZOLA 3L8GA 2CFRA 3U7FB 5AM3A 3NAMA 2ZG6A 5AI0A 2QLTA 4OD0A 3WK9A 5ALSA 3U7GA 1TJ5A 3SF0A 4BEVA 2FPXA 5E0OA 3EF0A 5AKGA 2FI1A 3FGOA 2Q4RA 2OA0A 4L57A 3WKAA 3NALA 1ZD4A 2BDUA 4H1WA 5AM1A 1JUDA 4CNQA 2AUTA 2RB5A 3B9RA 3BA6A 4FYPA 4BYGA 5ALNA 5AKYA 2HX1A 1TA0A 2FPUA 2W11A 2IA5A 3QUBA 3IB6A 5ALYA 3DNPA 2P11A 3FM9A 2FDRA 1U7OA 2I6XA 2ZBGA 2OBBA 1L7PA 1U7PA 4YH1A 3ED5A 4HGRA 5AVTA 1RMTA 3RF6A 4AS3A 2FEAA 1RLTA 4XOUA 5ALPA 3L8FA 3R09A 2NYVA 3KZXA 3B8EA 2RARA 2B8JA 3ZI4A 4UAVA 3AR4A 1O08A 4F71A 2C4NA 3FPSA 1ZS9A 3QNMA 5ALRA 3WK4A 1L6RA 3SKXA 1AQ6A 4AS2A 1QQ7A 3OCWA 4AP9A 1L7OA 4DFDA 1RQNA 2YMPA 2HHLA 1RQLA 4BX0A 3S6JA 4FFDA 4KYTA 2YN4A 3ZU6A 4L6AA 2DQSA 2D2VA
chains in the Genus database with same CATH superfamily
3EZNA 5JSUA 4I9FA 4GWLA 1SZPA 4HXEB 2I4IA 1YDHA 2IDJA 4B3FX 4EPXA 2M98A 3FFAA 1P2VA 1A5AB 4KPGA 1NKTA 5ITSA 1IG6A 3EXHB 1MPXA 4XYEA 5KFKA 1F12A 3D64A 4LHYA 1PAUA 1NNLA 1SUSA 1HT0A 3EIOA 5FUQA 3ADKA 5H82A 4Q8EA 2HPVA 1L5GB 3I92A 5JS1A 1MEOA 4B9EA 3CV3A 1MZVA 3U62A 5AYVA 2AKEA 5E0KB 1EB8A 1NVVR 4HTFB 4Q18A 1W76A 4NE9A 2HKIA 4RSHA 2BHRA 2WAMA 4CM7A 3H97A 4H1HA 4YGYA 2HQ1A 1PK1B 5E4TA 1QFXA 5HKBA 4R01A 4M1WA 5JS6A 4MWGA 2JA1A 4X92A 3SC6A 5IDXA 3V8RA 4PVDA 5DTJA 3VR3D 4Z9AA 1CB0A 1O3YA 2QT0A 1T43A 5BYBA 4LSWA 3TNYA 1SIJA 4YJKA 3EARA 1DKOA 2QG9A 3LUGA 4M1EA 1E9DA 3LWDA 1GNSA 3LKZA 5ERGB 1G6OA 1RCFA 3MWEA 5LU9A 3UWSA 3I62A 1L5WA 1DI0A 1ZGAA 1SCUB 1QB7A 4O63O 1Z4MA 4CL0A 1CVIA 1DAOA 2BQRA 4I2GA 3KR0A 1IQ0A 2P9ZA 2W03A 3DZDA 4H60A 3U4QA 1FP4B 3RFAA 5ICCA 2IYAA 1VRWA 1Z2PX 2QW1A 1HOTA 3GT4A 5T3YA 1W8DA 3IAS1 3OLCX 3OKPA 5KNBA 1E2UA 2E9SA 2WEKA 1GR1A 3RR2A 2FUEA 1K06A 1GU0A 4Q3BA 4CETA 1QMPA 4CGYA 4LBZA 4W9NA 1A7UA 5CNJA 5F77A 1SXEA 2AG5A 4RMIA 1YCGA 421PA 3DFUA 2GM5A 2VYND 3AVUA 5BUQA 1T4CA 4TTPA 4FI3C 5LM3A 3ESQA 4Y18A 4KLAA 3MC1A 2D3TA 1JFVA 1HE4A 1JR3E 2VXYA 3GFVA 4XCXA 4DCPA 1W4ZA 4J43A 1F2UA 4JT2A 2P9GA 4KZPA 1U2DC 5EZSA 1R74A 3GLUA 3DOJA 4N0QA 1BDBA 1NW6A 4Q4JB 3HX0A 5DXJA 2WE8A 8ICBA 5GJCA 4QODA 2FWRA 4RPCA 3TAXA 4DM4A 3BXFA 4P31A 4YUZA 3O3CA 3GZNB 4OJ6A 1FDVA 4YHHB 5JR3A 1GN9A 1P5HA 1G9XA 4QARA 5TQ0B 3KXDA 3RSLA 3K1JA 3WICA 2C2YA 1V43A 4X84A 2AI3A 2NU9A 3OU6A 4H7EA 4Z99A 3FTDA 1RQRA 4Q4JA 4U9HS 2GWSA 2VDUE 2YS7A 1XQ1A 2KNJA 2AR9A 2HIAA 2Q3FA 3GH3A 1N6OA 2IYPA 4XR9A 3RE1A 1T3QA 3M2PA 4AZ0B 4B9LA 1AV7A 4WE3A 5LMZA 3C41J 1U2PA 4NXZA 3KCNA 4MDYA 3B48A 1D6SA 2M6SA 1KO4A 3BXPA 2JR5A 4YXWA 2CNBA 3CX3A 2HBZA 3PJGA 1PVDA 3WGMA 4G26A 1OPXA 1PJAA 1KYXA 5F3WB 2GEDA 1M2VA 5IUKC 4F5WA 2IWHA 4BGEA 4MUBA 4EITA 4BZQA 4Q82A 3ITNA 4XM0A 3P9KA 1U5CA 4DCJA 2XHZA 1JHRA 1DX4A 4RCZA 5DXFA 3MBOA 5IP5A 5CG1A 2C77A 4EJFA 1EWQA 4JLMA 3KUXA 4CTKA 4Y2VA 5CPFA 2AUMA 3BFJA 2J3QA 2VDMB 2QI9C 1QTMA 1VXOA 2NXNA 4IEFB 1BOFA 3JAWA 4WNIA 2I55A 4MQLA 3SXPA 4QBTA 4DYVA 1GPKA 3DDOA 1KYTA 1UDAA 1T5OA 2GCNA 5FA5A 1CJCA 1P19A 2Z6QA 4PHFA 3ELDA 5J2KA 1TA9A 3HCRA 4MQBA 5SZKB 1KE2A 3S2UA 1GM5A 1P1KA 3D7MA 4YRQA 1E7YA 2J9ZB 2VP0A 3DC7A 3N9IA 5C53B 2QLJA 2WD9A 2E5SA 5IXSA 1A5TA 4B82A 8ICKA 3UH1A 3FOEC 2HO4A 1MJ5A 3W5CA 3ZNNA 3CWCA 2B37A 4RK1A 4GYJA 2QUHA 3Q3GE 4WERA 2GZHA 1LSUA 2JFHA 4Z0PA 4KAJA 2HJWA 4QREA 2XF2A 1NVTA 3C6ZA 4NXMB 1UBHS 4ARUA 4EAAA 2VBCA 2J6TA 1HI9A 2WWIA 1J7JA 3FCOA 2VDJA 3F5FA 3PWKA 3AOEA 2NUBA 3D2BA 4OH1A 3WJ7A 3EWSA 4GWGA 2RP5A 3UBTA 4CMHA 3HWSA 2LVBA 2HMXA 2OGTA 1R8JA 1X38A 3AQEA 1XRMA 4JKOA 1NBEA 2B36A 3EQ8A 1ISSA 2OHIA 3U4GA 4AYBC 4CLOA 4CGZA 1M10A 4N12A 4WZBA 1ISGA 2G4LA 1XWFA 3HSYA 1JR3D 2PX6A 1LK5A 1Z5PA 1WXHA 1GV1A 4LRXA 4MVWA 4ZCIA 2F43B 4YDRA 2QZJA 4PCVA 1KEWA 2BFDA 3CU5A 4YLGA 3KLOA 3OH8A 4CKZA 3J7TA 1P9OA 2YXNA 4UQGA 4A0FA 4U7CA 1TAQA 4PS0A 5KYNA 4LG1A 3UK6A 2EGGA 1EDOA 5GM1A 5B4TA 2J7PD 3IHTA 2XXJA 1QSYA 4M9SA 2X0EA 4DC9A 3AM1A 5LDGA 1UPBA 4TLMB 1WXQA 4NBNA 3FJOA 2Y0CA 4DXAA 1RC1A 3JTMA 2H3HA 4YR3A 3EFEA 1USGA 2BTQA 4MWTA 1WHTA 3A0RB 3CLRD 3F6BX 3PX4A 1Q2UA 1L8OA 3O73A 2OOSA 3OAAD 4X44A 3RS9A 4XWKA 2IP2A 4RQAA 4W1PA 1XMQB 1W581 1X87A 2ZYRA 3W2TA 1Z35A 3JPRA 1DKPA 3I1YA 2V7UA 2UUCB 3UXNA 4WGGA 4WY5A 2QT9A 4LRWA 2I2CA 4QRIA 5B1YA 2DEUA 4XQ8A 3BMOB 3FPBA 4JHLA 1C3EA 4DRZA 2H3EA 2Z57A 2FLKA 3ISBA 2ZI6A 3SEQA 1A2OA 5K0JA 2W4MA 2HYIC 2HHUA 3UXOA 2KZZA 1GILA 1PQPA 3RC1A 3TRJA 4CM4B 4K2HA 3CE6A 3FFXA 1YTLA 4CR7A 3UB2A 4D9HA 2GT1A 1YCFA 2PI4A 3NR2A 3F98A 4IIYA 1ST2A 4IJWA 4LCBA 2QL6A 4UVDA 3P9NA 3F7NA 2YV1A 5ALEA 3VVLA 2Z6UA 2HI0A 5FUXA 5JH7F 1H1LB 3GUCA 4JX8A 5CYFA 2PXIA 2CRXA 2VEDA 1L4KA 4MI6A 5KUTA 3QEMB 4D8TA 2ZAGA 3IMCA 4RNMA 1NBMA 4ID3A 3T54A 4BEWA 3RBDA 2PRZA 1JALA 4FDVA 2NU6B 3B6IA 3LC2O 2FWJA 4LV8B 4V0MA 2YJ6A 2HA0A 3QZ8A 5DDYA 1FB5A 1HG0A 2PZKA 3ZZMA 4WCFB 2RGXA 4R8KA 1FMJA 3NAQA 1GITA 1NUUA 3LWMA 3U4CA 3W2IA 4DDVA 1ES9A 1TIKA 1ULUA 3JSXA 3OY2A 4I6GA 2ZATA 4NEQA 3UAGA 1RWXA 2HJ9A 2BI8A 4C0BA 2XUFA 1Z5VA 2X3FA 3SR6A 3DWFA 4EQ6A 1ZUWA 1YZTA 3PDUA 1NKSA 3ICPA 1M8FA 3Q1LA 1MA7A 1GQSA 3EHDA 3TK1A 5I7UA 1TDJA 5TMDA 3FWKA 3GJ5A 4Q9LA 3CSDA 3L1HA 2FUKA 1QX4A 4R8VA 1YGPA 2GA8A 4QNMA 4MQ5A 4LE0A 1Z26A 3PZPA 1D9XA 1XS9D 5A2QA 5GQSA 1NV9A 2PMZC 1AKNA 2GYWA 2TRSB 2NU8A 4BP9A 4K6KA 3KHRA 1U2GC 4D3DA 3EEFA 3IRVA 3KLNA 4MKGA 2FW1A 5CLQA 4DQUA 4TUSA 1JJIA 3MDAA 3E03A 3LDGA 2BBWA 4ABYA 3QF7A 2ZS8A 3HCAA 4KV7A 3TRFA 1S0OA 4J7XA 4OJYA 4XWWA 2W7OA 1YQWA 1ZCFA 2C78A 3EN0A 3I9KA 3JD2A 4ICIA 5FAKA 5JYEA 5KB3A 4GZ6A 3ADDA 1C9KA 5KFBA 2CXQA 4OB6A 4QUEA 3ZDQA 2WJYA 4EA6A 1BPDA 1J5PA 1IMJA 4DLSA 1U8CB 2PGJA 4IIJA 8ICUA 821PA 1I4EB 1RM6C 1S1CA 1Z36A 3AYZB 4QHSA 3RK1A 4DIEA 3C70A 3O3MB 4JEHA 3C85A 1GU1A 3ER9A 4X1IB 2GXSA 3E9ZA 3E7XA 1UBFA 4QIWC 2A9FA 3INNA 3MB8A 1GCIA 2NZYA 4M76B 2HU2A 3HB1A 4PSUA 2GB4A 1PTJC 4E22A 7ICIA 2PE5A 2GARA 4MULA 4F3CA 5A5GA 5JIBA 1JA9A 4QOEA 3UC5A 4EQZA 4F21A 5JU6A 1HNZB 4YGXB 3ZWKA 3T15A 1AMUA 4HB0A 5L53A 4YAFA 1YOVB 2R8ZA 3DEZA 1EA5A 2J3DA 2WHXA 4IVNA 4Y9UA 3GH1A 3CF0A 2GRJA 3A25A 3KUDA 1XTQA 2AYXA 1MRNA 3LA6A 4QQRA 4P84A 2J6IA 1K1QA 3ZVNA 3JRWA 2FLVA 4PX2A 1JQAA 4B47A 3OURA 1WW2A 2DPMA 3PSFA 4TXJA 3IJPA 1Z63A 4LZGA 4I0WB 3SMVA 4TSRA 3D6UA 4YAOA 1JJ7A 2VHWA 1DAMA 4HNGA 5F3DA 3PEWA 3GFGA 3VDXA 2HK6A 3ENNA 4OTZA 5DT2A 4NJ8A 3Q9LA 4G5OA 4YDHB 1QZUA 4YRRA 2IELA 1RM4A 2YFKA 5DTIA 3GR6A 4D6XA 3CRXA 1ZYUA 4M0UA 3TR5A 3MUNA 1JR4A 4M0PA 1QUEA 3HJUA 1OHHA 4JNCA 2O2XA 2JD0A 4LWQA 1N8SA 4RQ5A 4N82A 5BR8B 2FW9A 3VHXB 1E1RD 1RHQA 3BWVA 1LI5A 3CBQA 3DEYX 4XQCA 3K5IA 2AN1A 1NK6A 5EE3A 1ZITA 1WZNA 3ABZA 3OQ6A 2O59A 2OGZA 4ND7A 2H5LA 3VDRA 3RSFA 4D92A 5GTHU 5EHZA 5DASA 1AC5A 3FCSB 4CUZA 1W73A 5K0BA 4CBVA 5FFFA 2V7QD 1JJFA 1P44A 4F1WA 3FB1A 4GFJA 4BUGA 1QXSA 2IYXA 2OB1A 4Z8YA 2H1LA 5BRAA 2VQFB 2R87A 3ITEA 4ZU6X 5IKXA 1XRRA 3COZA 5KHOC 3ZDFA 4O3OA 3DAFA 3LYUA 4K9RA 4YJ2B 1GPBA 5FH9A 1OLUB 3L8EA 5CEJA 5C5EA 4US2R 3A0BU 1T5HX 3GZJA 1J33A 4QOHA 5T8KA 5JZMA 1ISFA 4EUHA 5BN4B 2NZVG 1JI3A 1M2WA 1W9MA 3THRA 1PNVA 5LP6C 2KI5A 1SURA 1UR5A 2G40A 3H1PA 2PRJA 8OHMA 5L6MB 1W5AA 4DMCA 2PY6A 4G37A 2PZ8A 4GBJA 4MVJP 5JT1A 1EXWA 4RL4A 4QGSA 1AH2A 2YNMA 2CV1A 4TMWA 1YOBA 3UMJA 1VPVA 2B5OA 3KJFA 2CC2A 2NUPB 3NIGB 1QAMA 2JJ8A 4FWTA 3QWIA 1XL1A 4ZCQA 1FMLA 4DCGA 4WZBE 1GL3A 3BTUA 3HBLA 1JLKA 4R66A 1CLEA 2FNAA 2K8AA 4IJMA 4W5QA 5I9BA 2MRLA 5TQVA 3W7AA 2QB0B 1L7QA 2VJBA 3PC6A 1H3EA 3V97A 3TL3A 5DG9A 4RJKA 3BFPA 2YJ3A 4QDKA 3K2QA 1JG3A 4EGCB 3MG9A 5ES4B 2VT3A 4NG5A 1GZUA 3EB9A 2OWDA 4RKQA 1D0IA 1FBNA 2RJOA 1UOPA 4JB8A 4TS1A 4GIBA 1BW9A 4MW5A 1BCRB 4CKEB 1NKEA 3A11A 3BTOA 1UJ5A 3U0BA 5ANRB 5JD5A 1AGPA 4LY3A 3RROA 2VJPA 5IILA 2P27A 2P2GA 5JI2E 1S2GA 3WO1A 5KSOA 4Z9YA 4BQOA 2DTXA 3IIKA 1IHYA 4EUKA 5JNWA 1VE6A 1SKQA 3IUMA 2F48A 2VLBA 4AG6A 3FDSA 5EJFA 4QBFA 1IZ0A 4BLUA 4ZI5A 3DTTA 1V1JA 4HLDA 5B5EU 1EBFA 2QMYA 3P2JA 5BMVA 4QGBA 4G09A 1Y9ZA 4LAFA 5G2OA 4C9BA 4F86A 1WCV1 4XSGA 4OD0A 5EP2A 2Q7DA 4DOAA 2ZTUA 3C8MA 1C9NA 4RW0A 2VTBB 2J3HA 2GAOA 4QZDA 3ETLA 2GO1A 3DWIA 4I19A 4EPTA 5JEDA 4TV9F 2IYNA 3V46A 2BFDB 2FE9A 1VLJA 1U6JA 3M6KA 5DTEA 4EYKA 2A3NA 4QT4A 1QWOA 4YBZA 2UVDA 3NALA 3LT1A 5KL1B 4LPKA 1MO3A 1SCAA 3PL1A 3R6WA 3CX6A 5I5EA 4PZCA 4NEHB 1OXUA 1KJQA 3N2GA 4FYYA 4DNFA 1NP6A 3TTXA 1PGPA 4FOTA 1KA9H 5J2TF 1OVGA 1ZQRA 1P0FA 3SXUA 1BE0A 1D8YA 3O38A 4DXHA 4EZIA 1E2MA 2WICA 3WJ1A 5CRXA 4DOBA 1QE3A 2AR7A 2Y76A 3H5NA 2OKCA 3AXSA 4X7MA 3BXOA 1ACLA 3UW3A 1G98A 2P1ZA 3B51X 3GQVA 5ITWA 4HLNA 3RR8A 1LJLA 3P0RA 1B0XA 1Z0KA 1RMTA 3IVAA 4K8RB 1P2SA 4MR9A 1T3GA 4BNVA 2ZAYA 1J4AA 1JFFB 4AIRA 3H5VA 1CR2A 3LX5A 3T9BA 1TC1A 5LZ2A 1QQAA 1Z56C 4MUAA 5J5VA 1HDYA 4DNXA 3AF1A 3PXEA 3LKVA 1YH3A 3MLBA 3UAYA 5K8CA 5L95A 5C8YF 5G0TA 4QDXA 4F71A 3BD7A 3MJDA 4ACAA 4LNHA 4CCAA 1HKHA 5JROA 4WOCA 1FPMA 1L7EA 4ICAA 3AKDA 1YZ7A 3MLEA 3LNCA 3DOOA 1WMSA 2I6UA 1LLFA 3AJEA 3OZDA 2VIXA 3PUXA 2ZR0A 5HR7A 1FFDA 2PUVA 1E6LA 3PQ8A 2PNJA 4GSYA 1H5NA 3AIMA 3KTAA 1UXKA 4ZZ3A 5A6VA 2FMUA 1KEEB 1K4YA 2IYWA 4Y0AA 3TWOA 3VNSA 3CMCO 1UCVA 1Q3UA 1DIOB 3VDQA 1PI3A 3J81k 2WMDA 3EDRA 1D09A 1VE9A 2P5UA 1V25A 2F8SA 1QYVA 3VUFA 4U3JA 4BHTA 3SD7A 2A9PA 3T3PB 2OFWA 5C8DA 1V96A 3A1FA 4CM1A 1ZSVA 2HYDA 3LH5A 3O84A 1E2IA 2JA2A 1GL6A 2OCAA 4H6VA 1NLYA 5DHRA 3N2EA 3E05A 3LA8A 4BNUA 2X19A 1GGVA 2XCQA 4F9FA 5COAA 1KDYA 3QZUA 1SRQA 1WPGA 4IHJB 3UEOA 5U4XA 3TUZC 1C5KA 3NRWA 1XC7A 2QTHA 5I7FA 2FPSA 2AOTA 3NIDB 1U98A 3NDRA 4Q1CA 4DV0B 3L2OB 1WXWA 3ZE8A 4EP1A 3GP8A 2PGIA 1GXSA 1PZXA 3PRKE 5FUVA 2G9QA 1X0XA 4M8NE 2RIRA 5TVKA 5J4LA 2DFTA 4LZDA 2ZIWA 2F8KA 1W1IA 1NE2A 2X7HA 3RUFA 4X94A 4AKTA 4BATA 1AROP 2ZU6A 4MROA 3OKAA 3HVIA 2IHTA 3QXJA 1EE9A 5HVNA 2XGQA 1QV9A 2Q2NA 1GXSB 1JZTA 1JA0A 1N1DA 4PO8A 5EUCA 1TQHA 4GLBA 2DZDA 4DCOA 5DH9A 2NXWA 1JT2A 1KMMA 3CH6A 4DL2A 4Y2QA 4GP9A 4EF5A 3HP1A 4P4SB 1QCYA 1XKXA 3LCJA 2NUTA 4TTIA 1GNTA 1ZO8A 4C0WA 4U7FA 4BC0A 1TB4A 2RGEA 3NJRA 3RTAA 5LMCA 1BEEA 2HSZA 1F20A 1FDOA 4O3SA 1UWLA 2GN1A 4AO7A 3TX6A 2BEWA 2B25A 4LDAA 3WMGA 2SBTA 2PKEA 3HVHA 4TQRA 1E1DA 2DBZA 1ZJ5A 4D4GA 2OCYC 4BMDA 3QE0A 2VHXA 3ICWA 4FDMA 4GKVA 1RSZA 4QAQA 2XVXA 5TARA 4BNIA 3PEUA 9ICNA 4BO0A 1HDOA 1WCYA 2QD5A 5HKKA 5JAPA 1GKKA 1ZU4A 1XLWA 3DB1A 1A69A 1E3QA 3A6PC 1PDOA 3KQNA 4GECA 5F2NA 3Q0IA 1W4CA 4KFRA 4X8MA 2V1UA 2QYHA 3HKCB 2XTZA 1JQKA 3B9QA 1E1MA 2ES6A 2BE7A 1BQEA 2F3QA 1NJ8A 4B43A 4EVIA 4Z4FA 3B89A 4OK5A 1YRAA 3AEUB 4CKXA 1KQFA 3HHPA 3QVSA 4XA8A 4MVJM 3D7RA 4CEJB 5E9QA 5F98A 4OXYA 3Q6MA 4OXKA 1V5FA 1G8MA 2CHVA 4XPIB 3WB9A 4D42A 1C30B 1RWOA 1KFTA 3LVRE 3WJ2A 1F4VA 1KNQA 1P2UA 3EUFA 1AHNA 2IEZA 1CRQA 2NUAB 2KICA 3T5JA 2GBLC 3AJRA 4FU0A 3SJUA 2VDQB 3K0FA 3BUSA 4HTFA 2C2EA 4MYTA 5C34B 4AZSA 1EM6A 2HV8A 2V4ZA 3LVFO 4AJ2A 1HT2E 4PSVA 1M2HA 1BVSA 1UJCA 4PGXA 1WQ3A 2J3IA 2P77A 3KWFA 1JEDA 2FPWA 4KACA 1JZQA 4Q3CA 2OYCA 3SMQA 5I7WA 3HA5A 3JQ6A 2JEIA 3V1UA 3IP9A 4PF1A 5BWBA 2QY6A 3ZCQA 3GG2A 2BCRA 5HQTA 3IUYA 1XAJA 2XCRB 4CKCA 4JODA 4HOYA 4ZVNA 2VKQA 1JIIA 4LOIA 3T41A 3O1JC 3ABIA 2WHPA 2WLSA 3NBYC 4HMPA 4S35A 2YBDA 4Q03A 2AN3A 5B1SA 1DAPA 1SK9A 4C30A 4PFQA 1X39A 4RVUA 1BMQA 1IM2A 1BE6A 3AI3A 3OSPA 1CJUC 1KBQA 5CDHA 1JXMA 2VPWA 3LBFA 3IUJA 5E7JA 2JZOA 4LISA 5AKLA 3U44B 3WMEA 3PQ6A 2HK8A 4AFNA 2WIAA 1U45A 2EJVA 1DXYA 1VJDA 2WJ3A 3E1KA 1OA0A 3ROMA 4HKTA 2ODEA 4DEYA 1DWQA 1TQ4A 5D46A 2XTAA 2AFRA 5SZHB 3DBRA 4MRRA 3REGA 2EFEB 3PICA 4IGEA 2WSYB 2YWXA 2GRAA 2CNNA 4LECA 3UMFA 7AT1A 3DL0A 1UUFA 4UBMA 3NVDA 5ALLA 3KL4A 4ZVTA 4OY3A 1JTEA 2RHGB 3R4VA 3HMKA 4LVNA 4YYEA 3EFOB 2IZOA 3LS2A 3AG6A 3UGQA 2BBSA 3OP1A 2WWFA 2G70A 2PJZA 5AP9A 2H4JA 4I3FA 2DPIA 5LZ7A 1FVOA 3GC6A 1G8JA 2FGJA 3BJMA 1QRDA 1EP2B 5HHHA 2BW0A 3HGMA 1KC1A 1ABBA 3A9SA 1QOZA 1PFQA 3SZ2A 3DVLA 3DMFA 3PCTA 2JHDA 2JFPA 4M7OA 3JW8A 4Q7KA 1ST3A 4MYCA 1SVOA 3LVQE 1T6NA 5DYWA 2I9PA 1AB6A 3FOAA 2VOEA 1VL2A 3JYOA 1FL9A 4YV0A 2PQ2A 3EGDB 3HKEB 3A05A 5IBPA 2NU9B 5LN1A 4YQZA 5K20A 1EQUA 3CR3C 4DARA 1DKMA 3VH1A 4TKLA 4FPXA 1Q44A 4DCSA 3V4FA 1XSPA 2BFWA 4FC7A 4BNKA 3DLBA 1OIWA 3FOFC 4R2HA 1JIQA 1ZD2P 3ZNPA 2VC2B 5KU7A 2IU4A 1H6CA 3KSMA 4K9QA 1P77A 3KJGA 4LY0A 4DIFA 1L1QA 3LK9A 3EJ6A 1YR9A 3BWMA 4L4UA 3PRJA 1BRTA 1KK0A 3KQSA 4XWTA 1VYTA 1XD2B 4EB0A 3IQWA 1SBYA 2JJQA 2RQ5A 2R8EA 1RZRD 2YZKA 3P9PA 4LXXA 4R3WA 2O8FB 2IA6A 1DJPA 2W2NA 5KT4A 4K9LA 3X2FA 5DX0A 4ZOLA 1FMFA 1ZIPA 2BJHA 2FE1A 4DYHA 4Q7EA 3OEWA 3DMTC 1JHZA 4PG5A 2I34A 4AKHA 2G5PA 3TCKA 2H18A 4J29A 1X6JA 2RHTA 4XAQA 2WPNA 4CTJA 5JISA 2Q5HA 3BWYA 2E4AA 3EUAA 4URHA 5KTOA 1HY3A 1FX0B 2BMDA 2QW0X 4C29A 2DWPA 1RFGE 1YR1A 4WD3A 2H4ZA 2IYTA 4YTEA 3WAKA 1IBCA 1URPA 2DBVO 2HXGA 1JHDA 1PS9A 2BP7B 3JPSA 1HBJA 1XBTA 2G5HB 2JGNA 2DY1A 2OORA 3E8SA 3EPRA 3GDGA 4HCJA 4KFTA 3RYFB 3BFVA 4ARAA 3BS7A 4M2YA 3SVZA 4GKKB 1NBAA 4MYDA 3C29A 3B9JA 8ICZA 2PVPA 3GPLA 1CK4A 2ASVA 1GSIA 3PFWO 5I9MA 4CF7A 2C7BA 1CI4A 1YIDA 4IZHA 4GMHA 3G2JA 5J2JA 1TAGA 1TX4B 2BRUA 2I4NA 2NTVA 5KVCA 3DBHB 3L77A 1O94A 1B0AA 2UZAA 1CS0A 4P3NA 4BJHB 4E2FA 1BPZA 4F06A 4HNUA 3IGFA 3G02A 3G7SA 5L4NA 2WUEA 4OMFG 4QBIA 5GIOE 2F2AB 3JARA 2VRBA 2QIPA 4N9WA 5EP1A 3O4HA 5HGJA 3QYFA 5HFJA 1NI5A 4GLOA 2CCKA 3FOWA 1DBQA 5GP1A 3RFCA 1AQYA 3K0CC 3I2IA 3OMLA 5EERA 3ANSA 4II7A 1O03A 3DL7A 3NM4A 4G1MB 1JSXA 1U3FA 3LZCA 2CLOB 2EANA 4HUQA 2VUIB 4A23A 1FNBA 3IMKA 1ZGZA 4L28A 5H5JA 2GNAA 1SXJB 2X23A 2ACVA 5G1NA 5JCOA 1ESEA 4FGZA 4E07A 2J32A 2C5LA 4CT0A 3M6XA 2HZ7A 1XCMA 1F6DA 2DFPA 2G06A 4YDQA 3C87A 2JHAA 3Q9SA 1DEXA 1GQFA 4K03A 3Q3IA 9ICOA 4EW1A 1D1TA 1ODCA 2MYUA 1S8OA 3F8SA 3GD5A 4HF7A 2D1TA 2XT9A 4M83A 2X4IA 1SL1A 3FPJA 4KXQA 2IWRA 5IAKA 4LJ6A 4LE2A 3RAJA 1YRLA 3E0QA 3OOHA 1CY0A 3R6DA 4KDRA 5AOAA 1N3YA 1QF9A 3QNWA 4LJ9A 2ZKLA 1IYZA 3N3AC 3A1EA 5EKTA 2OCKA 1XTUA 4Z8XA 1T35A 1JKJA 3JVEA 4KTVE 3SC3A 3WLSA 8ICJA 1QQTA 2V97A 4E2YA 2WJ6A 1H4SA 2SICE 1L7NA 1KO7A 1WU8A 2H31A 2WNIA 4RPLA 4D3ZA 3BL6A 4EECA 4RVDA 5JEEA 1P5RA 2IFTA 3ZS9A 3M4NA 2YKGA 4D4LA 4B9NA 3PCXA 4Q47A 1T1IA 1DC5A 1QYIA 2DERA 3OD5A 3EF1A 2JBAA 7ICQA 3D2CA 2EBHX 3N7PD 3I1JA 3KEFA 1E1QD 3P1JA 1XAGA 3V42A 1V6AA 4C0XA 2HRCA 3OEED 4CE6A 3ZHBA 1N7GA 2ZWPA 2W2PA 3R5KA 2V7GA 1RMYA 1UQVA 3R0IA 4NENB 1NF8A 3ORRA 1FSGA 4X97A 3PQ4A 2EDUA 3SS9X 1ORWA 3G89A 2RIPA 4NBUA 3CNOA 4NQRA 2IL1A 4O4IA 2VBIA 4PPGA 5AW2A 1L4BA 4FDLA 4D9CA 4YJ3F 5J0UA 2ILTA 3AU9A 3N2KB 1MTOA 1JVBA 1D2NA 1XFAA 4I55B 4RY0A 5REQB 3FA2A 2YY6A 4ATNA 3THWB 9ICRA 1GHTA 1GPNA 4HX9A 4WA8A 1ISMA 3TZBA 4EENA 2XNCA 3BKXA 1KSGA 3DE4X 4WVLA 2CDNA 5DNDA 4OHCA 4B1FA 4M6WA 1KYIA 3FFWA 3OO1A 3DAHA 2EQAA 2OO7A 2XQKA 5H68A 4P3KA 4G2TA 3SIRA 2GA9A 1SVKA 1TC2A 1JQLB 3P97A 2DOKA 1BWRA 4J1TC 4JJAA 5F21A 3TQTA 1Z6QA 3K5PA 4PG7A 5L45A 2QV7A 1VPWA 1WZIA 4M6WB 3SIWA 4DN6A 3CPEA 2FLNA 5G0SA 1GDHA 1R15A 2VJYA 1XYGA 3PWSA 1Z00B 3FMVA 1DADA 1NLZA 1YZGA 2D7JA 2E6UX 3RRFA 5TC4A 3RUPA 5E1OA 2GKSA 1PEDA 2OUIA 3RS3A 1V5IA 3FCEA 3L05A 5H80A 4K46A 4YUYA 1YBMA 1KO8A 3T7EA 1H4QA 4DS5A 1RP1A 3UJPA 2C8LA 2GX6A 3WLLA 3U49A 4J75A 5BSMA 5UKDA 2QRVA 2WTNA 4FUTA 1ZDMA 5JAIA 3V32A 4JU9A 4KQGA 4GNRA 4RU9A 1RWWA 5K3FA 5CU7A 4IRDA 7ICTA 5TS2A 4HDSB 3EPIA 7GPBA 1M8KA 4J6FA 3ITKA 5KYWA 4GXTA 5CVUA 4EFMA 3VPGA 1SOUA 4P7BA 2GN2A 2W6MA 3EOBI 3O8RA 2WYHA 1ZGCA 1WVGA 1HKUA 1TEXA 3EC2A 1EGMB 3ONVA 3UAWA 2Z8ZA 1FA9A 1T0PA 1R37A 2DUJA 4FKMA 4WI1A 3W6PA 3CEAA 4FI3F 1E64A 4E3ZA 3A6ZA 3P8ZA 3KKKA 4PAMA 5CXXA 1UFVA 1ZJYA 2BIFA 3AGQA 4W5WA 4E13A 4RTQA 2HW8A 2YINC 4X8OA 1I1NA 3ZHUA 1P33A 4P7GA 1GTSA 1X1SA 4DL5A 2C61A 5K03A 2D59A 3VV3A 4ECXA 2OAGA 3DE1X 3ZDRA 3FAHA 4ZT2A 3PNVA 1N5JA 3S44A 1CCWA 1YVPA 2HT1A 2OC9A 3TLJA 2XCSB 1BE1A 4JLJA 4R1LA 5KFDA 2I78A 1F3OA 1MX5A 2X76A 3EQ7A 4QSHA 5K7SA 1TK5A 3L1JA 1EBUA 4HZUB 1WMFA 1T9AA 4L5AA 4ZV9A 1G4UR 1JQ3A 4NCIA 1Y4SA 2J6SA 4I50F 4OBWA 4KQXA 5JC8A 4CM8A 3HY3A 1WF3A 1GSHA 3IOMA 4XXHA 3GEMA 1ACMA 2NO7A 1O97C 4PLWA 3WIDA 5L3QA 3W1VA 1F1JA 5DULA 4BVHA 4HAYA 4I3HA 1XZKA 2AXEA 2OENG 2PH5A 3KOMA 4HEQA 1HTTA 1RWMA 2YIJA 4Q7MB 4NE2A 4XIGS 3RJTA 5F64A 4M7WA 2IU0A 4Y3UA 5CXQA 2CXSA 4RVCA 5ALZA 3IKVA 3EW7A 4TYPA 5BSTA 3NT2A 3PHCA 5IIOA 4U1RA 2GHQA 3I6BA 5JSQA 2MSEB 1VLQA 3GAAA 3B5JA 5IWCA 5IC5A 5IX8A 2B4AA 2I2DA 3ILHA 4LPSA 5CVCA 2IUSA 3FPLA 2ZIUA 1WX1A 4KOEC 2A1AA 4DNOA 4LYFA 4H59A 3KALA 2CUNA 4JA2A 1VGQA 1L4LA 1LPPA 4KKXB 4L51A 2E87A 4IZOA 1IXYA 4ECVA 3PUVA 1C20A 4M46A 4OXQA 1M34A 3S40A 2H17A 5BQ5A 4ZVPA 2O2DA 3F5MA 4KO8A 2PWBA 3LD9A 3Q6IA 4EDFA 1U4SA 4XR4A 1TJ5A 4N3CA 4BEVA 2EGUA 1YB4A 4B4OA 4KLDA 2MMCA 4H4EA 2FI1A 2VAWA 3LY7A 3DMYA 4PZAA 1AXEA 2PM8A 2NXEA 2PBLA 4ML3A 2H1IA 1C4KA 1DRVA 1QOPB 2D0DA 1Y81A 2Z08A 2ZPUA 1OH6A 4MVCA 4LYDA 1ECFA 6YASA 2PZEA 3FBGA 1SXJC 4MZXA 2VVTA 2FZLA 2Y1EA 4OQFA 3FE2A 2XNKA 3H5AA 4EHAA 2H3FA 3AEQB 4Q9JA 4KYVA 1AD2A 2X8JB 2LBOA 1XLTA 1PN3A 1WV0A 4MGZR 3G8CA 3FYHA 1MNQA 1LK7A 3IVGA 4I50B 1TK8A 2WE7A 3USCS 5JCPA 2ECQA 1UBSB 4DL4A 3OLZA 2RG1A 2ZZNA 1X7XA 2GOYA 2NSDA 4L2IB 4G0UA 3HR4A 2QZZA 3WL3A 4OP2A 2V7BA 4UDNA 3H9EO 3SZLA 4AD8A 4XQGA 1LY1A 4J0FA 4TS3A 4ECWA 3ST7A 4BKUA 4LDQA 1OHHD 2G63A 3R41A 1IJBA 3L4KA 5HBGA 3TX2A 1Z1BA 1WXIA 2JGEA 4MFFA 1KU6A 1IU9A 5C35A 1G2PA 5BUCA 1CUSA 3JQ9C 2HJHA 1G5IA 4B74A 4MUKA 3V5NA 4QFMA 1N0UA 2R6FA 2XYPA 4P5PA 4LF9B 2Q5IA 3LQFA 4FILA 1BCRA 1Q0UA 5KFAA 1M67A 5G4KA 1G0OA 2BM8A 2RGCA 3K9FC 2H54A 2QAGA 3QNMA 3OPNA 4ZEMA 2FRDA 4PQYA 1PVPA 4OFBA 4Y1EA 3KYDA 2PCJA 1T0HB 4L4RA 1AQ6A 3FBWA 3NFYA 3ABOB 3KBOA 4WL0A 4UUNA 3L3BA 1NVXQ 1N63A 2W6JD 1OC4A 1RHKA 1NG9A 1N2OA 2QTVB 1Z12A 7ICEA 1NJ2A 2W6QA 2LIPA 3ENQA 3LP5A 2H92A 1ADYA 1RWQA 2YX8A 1Y48E 4NYIR 4XIJA 2BPCA 3ECSA 5K3SA 3X43A 1FJXA 4Y67A 4ZAYA 4C80A 2DQSA 4Z9BA 3E6AA 3VCBA 3K0KA 2PKXA 1N5KA 3LK7A 2QZPA 2XJ9A 3MWYW 1W1UA 4GT1A 5FIUA 4BCCA 4R71A 3F5DA 3PFFA 4IFIA 4CRWB 3GFPA 2PUBA 3ETJA 3WWCA 3MTGA 1Z8NA 2HU8A 5A4AA 5AVWA 2LZ0A 3IURA 1SCDA 3Q0TA 2ZM5A 4OQ4A 5AH0A 2UUAB 1WZEA 3W5AA 2W04A 5ITVA 3NTXA 1PW7A 2WZDA 2HCBA 1XL0A 1FDUA 3QK7A 3FLEA 4GZLA 2H2HA 1KZHA 4ZCRA 2GYYA 1E2JA 4J9NA 4EPRA 1XKQA 3FRJA 3TQOA 3CZ5A 4R2JA 4RXMA 1ITZA 4KP7A 5DYGA 4BP8A 3O8QA 3PE6A 1Z07A 4NCNA 1RXCA 1YT5A 1M83A 3AUOA 5FPTA 4BWJA 1CUGA 2AKYA 1RYBA 4QOSA 3PNMA 2XMSA 3SY8A 3TXXA 1XRNA 1FQOA 1KYWA 1QIKA 2C9BA 4OSEA 3TZ6A 1NK7A 4TVSA 4OGKA 4WZ6A 1SIOA 1YE5A 9ICPA 4BMPB 1PE0A 1W85A 4XDGA 4A15A 2PMWB 5J47A 1SVIA 4IIFA 2HCRA 1HNWB 1SBNE 1M2EA 1Y33E 3H2ZA 5CA1B 2Q6IA 3R7WB 1L5FA 2J31A 2R8GA 3PVZA 1YFKA 4B9SA 3HA7A 2AU0A 2BUCA 4PYRA 1UC9A 5DHSA 3PKIA 1VGVA 1L3SA 1SKAA 4HN4B 3WV4A 1RM0A 4PC7A 3RT7A 4KFSA 1TUGA 3IODA 4P83A 1NQ5A 5F9HA 1EX6A 4QJIA 4D97A 1C7RA 4ELUA 3QXCA 2QQFA 4L8LA 4KSCA 4C04A 2AB0A 2W6NA 3KU1A 1CRLA 1KZ1A 3COYA 3LYLA 1LLDA 3EIQA 3PI7A 3PUWA 4FIDA 5BOVA 4EJ6A 1NJSA 4WEQA 3R9XA 3NTUA 4HUQB 4QXQA 2V7VA 4O2RA 4FBMA 4GC9A 3ZUPA 4R2MA 3IV9A 4N6OA 2BJVA 2O3SA 1DCKA 5FO0A 3W2FA 5ALQA 1JIKA 3PC3A 4JZYA 4NNPA 5BVGA 1LJ8A 3WL4A 5KFRA 1QHNA 4JLOA 4O1MA 1NMSA 3IJ5A 5LUBA 5KPDA 3LXXA 3AB3A 4C89A 3PUZA 2KN7A 4F9GA 1RADA 5KAFU 5CVVA 4NLLA 3RQSA 1LI7A 2IGTA 1WULS 2XSZA 3FGZA 3Q3CA 4L3WA 3L7YA 3RF7A 4BVJA 4ZFNA 2KVCA 4DKJA 1L5VA 1F1BA 3F53A 4FYHA 4OQMA 2OBNA 1OX5A 2P2CA 3CCCA 4FEEA 4M4SA 1TEZA 4FZMA 2H7XA 1OGJA 1WQ1R 2OHHA 3AFOA 5CT8A 3ECAA 1MOPA 2QRKA 4U7GA 5D7BA 5H3HA 3K30A 1WMDA 4W5TA 3GBVA 4FFWA 3QLVC 1VJ1A 3NM5A 4WOPA 5J0PA 1I32A 4PPQA 4C7OA 5EOVA 1L5HB 2PLAA 3W9UA 5F78A 1KJIA 2JGKA 4UEKA 1ZW6A 4OA8A 1WKBA 3OTWA 1QTIA 1RYUA 3DEEA 2OBLA 4IXMA 4FYIA 4P4SA 4UXIA 1ZMRA 3ZGLA 1KDPA 2Y99A 4PBTA 1GNRA 3EYZA 3JYHA 2R0QC 3WK6A 4RORA 4D9KA 1BDIA 3L8MA 4U39A 4G0QA 5ALHA 2GLUA 4HB2A 4YMIA 4DR6B 1DK2A 4MRPA 3ESCA 2JJ1A 4U2CA 3ZBPA 3A2KA 3BIOA 3O9MA 4IIGA 5IK2D 2OXOA 2A0FA 2PKQP 1K89A 4L5YA 3RHSA 1PK8A 1WCNA 1SUWA 1JVNA 4HAXA 1Y1SA 2P40A 2QLMA 1J1IA 4HDKB 3B1JA 2D7CA 4UBOA 3RRJA 3TEFA 5L1JA 1XWWA 3OIVA 5A05A 3RV4A 3SLKA 5C9ZA 5EMJA 1E4VA 4JR0A 3RF9A 1WBDA 4J49A 2PBZA 3K15A 4UPVA 1YUMA 2FW0A 4JOQA 4BO9A 1ULSA 2H11A 5AKZA 3HLYA 4G84A 2X6TA 2GJSA 4RGYA 4YAEA 2PZFA 2XWJI 4JD5A 3VO2A 4FC6A 3NG1A 1L8AA 3T1YB 2IY7A 3NHLA 1M2FA 1OFVA 3C8ZA 5J58A 2QMZA 5AI5A 1EM8B 4IQFA 1XROA 1C3VA 1K63A 2FR1A 4EELA 4KDFA 3AVTA 4KSYA 3M82A 1JDNA 5J8YA 1ZQZA 4M0DA 3JVVA 4PWYA 3VRHA 1JQ5A 1IIPA 1H2ZA 2VTVA 1X80B 4D0SA 3WBBA 4LGCA 3SHVA 5FNZA 5AW9A 5KYGA 1NRIA 2B78A 4FBGA 1O54A 3C74A 1G21A 5ELXA 3HZRA 2R11A 2WUFA 5KAMA 3FWNA 3HN7A 1PVOA 2CF6A 4ECQA 4LXUA 2ORYA 1HYQA 5BW6B 1KZ4A 1FU8A 1MRSA 3IP8A 3NONA 2ZW9A 3A0HU 2ZEJA 1Z0IA 3KXKA 4B7ZA 5BSHA 3CC8A 1ZH0A 3F6EX 5FR2A 3WDKA 1SUPA 2ID7A 3PTZA 3F9IA 2DFVA 2JIPA 3BMQA 4HB4A 2Q6OA 4DV6B 3ZW8A 1XMXA 1MHTA 1S89A 4TTQA 4TZTA 3TM4A 2IBTA 4BJ6A 1HMYA 4EHHA 3QLUC 3P96A 1PK7A 4QTZA 1CEEA 1JRLA 1EGAA 1UOEA 4F8RA 4PZYA 4CF5A 1JMVA 2X5JO 1CP3A 3GT7A 3DMDA 1L5LA 3V4VB 3AL2A 1FFYA 3SOPA 3R3YA 5FUWA 4UHFA 1SL0A 4TUPA 1TLFA 1T15A 4L9WA 4C07A 5ADUS 1RT9A 3R0JA 3WNDA 1KMIY 1UOOA 5ALGA 4D5EA 1V1RA 3OFJA 4KQWA 4O02B 3IEIA 5JQGF 1KTVA 1LZLA 2O2GA 4W82A 4CKYA 1NDHA 3MW8A 4ZXFA 1V2GA 5NLLA 4E08A 4MAFA 4YRKA 5KYUB 1IOWA 3UFXB 1C3OB 1PUIA 3BB4A 3LOPA 5JNRA 5K8IA 3FHTA 4YT4A 1ZG3A 3M81A 4HDNB 4OI2A 1X42A 3HRKA 1P1BA 6NULA 1K2VN 3ZWYA 2ID4A 2L2QA 2UZIR 2ZB4A 3GJ6A 1UBJS 5G4KB 2R8RA 2BEUB 4F96A 3K7EA 2FZ4A 3MD9A 3PVSA 5F35A 3OPYI 4CKWA 2P30A 4QT0A 3EVGA 3HCCA 3PXDA 3C8DA 3OX1A 1B16A 5L40A 4JDPA 2R3SA 4EA8A 4EI8A 3LL7A 5ELLA 5FB3A 1I7LA 3TJMA 3W5DA 3AVYA 4H35A 1DQPA 2WRZA 8ICIA 2FPRA 4M0CA 1VL1A 4L4SA 4YRAA 1HEUA 3GCXA 5DJ5A 4URXR 2ZIGA 4KR0A 4YC7A 3JQ8B 3FPFA 1UHUA 4L15A 8ADHA 4Q1EA 2M1ZA 2GR9A 3G2OA 1AO0A 3VR5A 3WGGA 1ENPA 3TYXA 3P19A 3UJNA 2WDPA 1CRWG 3HILA 4HUTA 1GGKA 4QPDA 3ZDAA 4Q4AA 4TXMA 2C2GA 3H9CA 1AN0A 3SSAA 4IDGA 4QZEA 2CFCA 2QGNA 3GT0A 4ZHQA 5BT8A 5BXYA 4OKNA 3ZDZB 1RYDA 1BTOA 1DJNA 1XCJA 2AJCA 3QKRA 5T4FA 2ZJOA 3RTDA 1JDJA 3WWYA 1A88A 1WCIA 3ILYA 3MT8A 1JH9A 5G5GA 1CV2A 3P45A 2FEPA 4C7JA 3WGOA 2WQZA 3TLCA 2C4MA 3CXUA 4R5MA 3R7DA 4QXAA 4EPYA 5IH7A 3LECA 4H6PA 3N28A 1YUBA 3VO1A 2XZOA 1I1QB 2G7ZA 3N8NA 3O8QB 3QU7A 2NSYA 2F7SA 3WSTA 3HG7A 4S0XA 3M3DA 3C24A 4HX5A 4LJXA 3E9YA 4HAOA 1U5BA 1X7YB 2W9CB 1MC5A 3ADCA 1KO5A 3NZEA 2PT6A 1RVDA 1QIHA 4LSGA 1G0NA 4GW3A 4QQ8A 3K0AA 4DQRA 3DFFA 4EMUA 4MUFA 4ENPA 1MW9X 5LIPA 1QGDA 1F8XA 1HA3A 3KWLA 2AFIB 4CTMA 2LGJA 3NRCA 2G1AA 4JWKA 1TM5E 1GEEA 2IS4A 2C42A 3LCUA 1WDTA 1Q0QA 2R1ZA 2WTEA 3OCVA 3P0IA 3SJ7A 3W1WA 3N0XA 5BUZA 1XZFA 4AJEA 3PO4A 1J0XO 4BQIA 4EARA 3BA1A 1W44A 2WHEA 1T6XA 4K9DA 2Z4RA 1JMYA 4KTTE 1DC3A 3FWPA 1PR3A 3OIWA 2QE6A 2CXYA 3GQCA 2C2MA 3OIGA 4N8EA 5PGMA 5EJ6A 5LNK6 3N75A 2VYCA 2NLOA 3GV8B 5FHRA 4H0NA 5BRJA 2OK8A 3RHFA 1GEGA 3KVVA 3P2YA 3UMYA 3VZSA 2GAFA 2EZTA 3G8YA 3PP8A 4WZBB 3HW8A 3UTDA 3CW9A 4BWYA 3MWKA 2WD8A 2IUUA 4Y2RA 2RK4A 2Z4SA 2UVRA 4B5LA 4CF4A 1OBCA 1WMBA 2KSOA 3I1FA 3DR3A 4K9SA 4ZI3A 1IBLB 3RIHA 1VIAA 5AKXA 1CR0A 3AIIA 2XTJA 4RPHA 4R9RA 1A8UA 4G36A 2HHCA 3WBJA 2DHRA 3VO8A 4IAOA 2R6GA 3B7WA 4J1NA 1CYEA 1AV6A 4QDZA 1MC4A 4WDQA 3R7AA 3HR7A 1QF7A 5AIBA 2HXSA 3X3HA 4AYWA 2ZK7A 3DQQA 1VPEA 3ZE1B 1JT9A 1OE0A 3I73A 4N41A 2W5UA 3AR7A 1CTQA 5CHEA 2FG5A 2MDTA 2P9CA 2PVCA 2VAVA 3U48A 5ICGA 4OXNA 2AMJA 2Y0PA 4HDCA 4WFQA 3ZVRA 4ARZB 4U63A 1ZSYA 3R3XA 4FZ5A 1CNFA 2RI0A 1BX3A 2VRNA 2WSLA 3ER8A 4XGKA 2AOWA 2P6PA 2XYQA 4BXOA 1N2SA 1VG8A 1DFIA 4ZDKA 3DO6A 4L50A 3BMOA 4FOPA 1BS2A 1YDEA 5DI3A 2H4WA 3AHCA 4CM3A 4ESHA 3C2QA 4YALA 5C7IO 4QBKA 4R31A 1IM5A 2DJ5A 4ER3A 3JRNA 3MRTA 3NC0C 4F3KA 2YIMA 3TD2A 1UFQA 4ZCPA 4GBMA 2WTXA 4Y2XA 4NR0A 4BWGA 1D1PA 2E7ZA 3E7FA 1NLMA 1XCOA 2C00A 4RZ2A 4JB2A 2NTJA 1MEJA 2LKDA 1W5SA 2C4TA 1Z19A 1MH9A 3Q7RA 1PJRA 4B76A 4DDMA 1O5OA 1BDJA 1JJVA 1KFDA 2VDPB 4X00A 1ZNWA 2CB9A 2V96A 3Q5DA 1KKLA 3H9JA 3NEPX 3PDJA 3CVUA 3H2JA 1F7UA 2QN6A 3SN6A 3SYNA 2B82A 2X0JA 2XMQA 3OPMA 2PK3A 1QO0D 4UTNA 4CM9D 3VR6A 1UC5B 5AVVA 3E53A 1P7YA 4HMOA 1PBTA 5FDFA 1X14A 2VSNA 4P92A 1BWPA 3R7NA 1SV0C 2NV2B 1AK9A 1ZOLA 1RAGA 2BLLA 1WZ2A 3UT0A 3ICEA 1UJBA 1Y88A 1PNOA 5BQXA 1GRCA 1PJTA 3KYCA 2CE2X 5FYDA 3AMZA 1ZW1A 2PD6A 3PDHA 1Q7EA 4GOMD 2EKDA 2W70A 5JSZB 1ZU5A 1GDDA 4RTSA 1NW9B 3WLEA 1L3VA 2AVNA 1PX0A 3NBFA 2F59A 2Q2WA 4OHVA 2K2WA 4KBFA 4GYKA 2OCIA 3FVWA 4F6LA 4JBXA 2QTRA 4FZVA 3QVWA 4R65A 1AOXA 3T94A 3PFNA 4ERNA 3L7IA 5JFGA 1FDWA 4QHTA 1U8TA 3SQDA 4BB0A 4BS9A 5LBTA 2PO7A 2XSZD 3DOFA 3SX2A 4MW2A 2RDJA 1C0KA 1GCOA 4MIEA 3LOQA 5EESA 1GZVA 4Z4HA 3TUIC 5JBIA 4GI2A 1D4OA 3DV0B 2K5UA 4MW6A 1S7CA 2Y3IA 5D5PA 3TQSA 3VSCA 1DKNA 4R1NA 4DDTA 3FNRA 2V3WA 3BQ9A 1FPQA 3IB6A 2CLDX 4GX5A 3L18A 1RPJA 4CFZA 2QB1A 4Z4IA 1V8ZA 2WVHA 4WSOA 1NIJA 3DCJA 4YACA 4NATA 1R16A 3R8XA 4A0QA 3A6KA 1D07A 1KI6A 1Y6GA 3LHKA 3C3PA 5FL7A 1DUVG 2C83A 2G1KA 2NYRA 2VT6A 3FTNA 4AS3A 1P7PA 1DKQA 1G3IA 1ZD1A 4GPTA 3NB0A 1TFUA 3UAZA 1W2GA 3TMAA 2NVOA 1HWYA 1UPCA 1TYZA 3K9LA 4JYPA 2NYVA 5CTAA 1YVRA 3TEJA 2IBSA 2H1OA 2DPJA 2HSJA 2RARA 2VQSA 4O3QA 1XZIA 1O6GA 1QLWA 1R4NA 4A82A 3K8YA 1GP2A 3C7DB 2HWUA 2PT7A 4AG3A 1S10A 4EPVA 3LRTA 3D3JA 1CY4A 1V1RB 3R44A 5KNCD 1O0BA 2UVUA 4PC1A 3A6JA 3D3WA 1SM4A 2ZYDA 3PJDA 3O7WA 3EXEB 4UKDA 3K0FB 3GIIA 1DUIA 2AFIE 1IJEA 2KHVA 3AF2A 3OFNA 721PA 3PIDA 1N2EA 2Z6VA 4K9OA 3GQBA 3EZFA 1R4NB 2B61A 4FYJA 2R6HA 3SU8A 1RQNA 3R6TA 4HDSA 4JL6A 1RQLA 1DGSA 2O2ZA 5FJJA 4AVYA 3D3WB 5FWAA 5JFOA 2ZSBA 3EZLA 1M72A 4G6ZA 2AHOB 2V0CA 2RB4A 2PZAA 4P4NA 4DCTA 2ROQA 2JI6A 4NLGA 4I9HA 1PG5A 1UZMA 3HNOA 3FC4A 4MKFA 3B53X 4CN8A 3DQPA 5LLTA 2YWCA 3KPWA 5FQNA 1I0LA 2PJDA 1M34B 4BQPA 1VSQA 1EWKA 1R6VA 5DU2A 1DAIA 2VQDA 1L5NA 3WWPA 1S77D 3MT9A 2AHOA 1K66A 2ZUSA 3UMSA 3WTBA 1K5HA 1BS9A 5JNVA 1DIRA 1ZQMA 2AA3A 3FSEA 2J09A 2GRUA 4ZU3A 4MLPA 2R8BA 4HVLA 2AQ8A 1H5QA 2GN6A 2A0UA 3EIWA 3HKBA 3ANYB 4L95C 2C8KA 4TLEA 3VDMA 3AKEA 3VTZA 1KK2A 2ZWVA 5JZSA 5LFAA 5MN4A 1EX9A 1I6WA 1AUQA 7YASA 3RBZA 4ZV4A 2GHIA 4PGGA 1PFWA 1YS4A 2ESEA 1W47A 4S1WA 4LI0A 1KBOA 1YS6A 5AM2A 2IZ1A 2X77A 1P8AA 3DE5X 1L7BA 5JMTA 4ZPXA 1DBPA 1MUUA 1XNHA 3I6YA 2NU7B 4OQYA 1HURA 1JZSA 1TTPB 1TK3A 4ZO8A 1CR6A 1WBJB 3OTOB 3BL8A 3FG9A 2IIVA 3BF8A 1P7VA 5AOCA 5HQ3B 3SQNA 1DEAA 3VSBA 4H6XA 3VH4A 4J0KA 4RHTA 1W75A 3FYSA 2HIHA 2P4HX 4BO6A 2NV3A 1T91A 3E1GA 1NFFA 3LW8A 1QS0A 4RXTA 3NOOA 4YCLA 4YMNA 2V4MA 4CI0B 5EIBC 1FY2A 1SHJA 2NNLD 4B46A 4E1AA 1LD3A 4MQ6A 5SZIA 3S81A 2JGMA 3NTOA 4A2CA 5C3MA 4BLTA 2KOBA 3L1VA 4HDRA 2XB2A 3AVPA 4HS4A 2FSFA 4MRMA 2HGZA 1Q1AA 3GXBA 3RYIB 2IDZA 3JZFA 3OPYB 4W7SA 5E6UA 4F8YA 1RXEA 5J43A 3NXKA 3QM1A 1MX3A 2YQ5A 1INLA 2EIXA 2P6MA 2J3EA 1C8LA 1UFRA 4UM7A 4PR3A 2WTMA 2PEZA 2UUBB 3AC0A 1XELA 3HY6A 5JARA 2GD0A 5ESXA 3NJ4A 4HN9A 3LBNA 4KVZA 1X3LA 1Y8AA 3B0YA 2JFWA 1DZIA 3LKBA 2WSMA 4L78A 3DZKA 3SNHA 4B6SA 3GHHA 1PT6A 5HZHA 3E9MA 2XVMA 1BZYA 4P08A 5AXAA 3M9MB 3ZD6A 4LCJA 3OQBA 5HHTA 4QZFA 2HA7A 3UANA 3EQ9A 3AU6A 3WLMA 4BFYA 2O8BA 1C3JA 2GMWA 4DQPA 4E4YA 1RCTE 4GUAA 4IH9A 4MLCA 5K3BA 1T3NA 2I4MA 3CEPB 2WB2A 2IZ7A 3UWOA 3TD9A 5EIFA 4X71A 3CWQA 5TE9A 2C28A 4QVGA 2G71A 4PRZA 3D0KA 5FKJA 3L46A 3S2SA 5JWHA 1JJAA 3FNHA 1T4GA 3KT0A 2QUKA 1JEEA 4HWOA 3ETCA 1AX9A 1T34A 1E1RA 1CIPA 4CN9A 1A6SA 3AXTA 2ISOA 4JVNA 5EPEA 1DIBA 2ABWA 4MS3A 4C7XA 4Q21A 4FS2A 4EZ6A 2GDZA 2WP0A 1PT8A 3DHEA 4LXYA 1N6IA 2LKYA 2JH7A 1P74A 3ASVA 3I1IA 3JZAA 2FZ5A 1V85A 3GCZA 4HAIA 3SQLA 1LDYA 1P0PA 4DY6A 3VX3A 4A8JC 1UXIA 4I2VA 4PZ9A 4TL9A 2IHYA 1N0HA 1OXBB 2HMSA 2X4DA 4M8KA 3V4LA 4CPDA 1T2NA 5FEUA 3GJXC 2ERXA 3JARB 3SYTA 4XARA 4R41A 3STTA 5BR4A 5JRDS 3OX2A 3R7WA 3U4HA 1ZHOA 4GR9A 1T29A 1IXZA 1AHHA 3JD4A 1TTQB 2WJGA 4EHBA 2KLBA 4XB1A 1AJEA 1ZK2A 9ICSA 2NGRA 2PX3A 2Q99A 2VEOA 1QYWA 4HPXB 5BSEA 5JANA 2E21A 2AOUA 5K2MA 2KJ9A 4PGYA 1GT6A 3D8HA 1YB2A 1HFWA 4H7PA 1GT91 4GOKA 1XDGA 4WKCA 3I45A 3V1YA 3ZOKA 3GU3A 1ZI6A 2HU7A 2M0NA 3SOZA 4BCDA 1R8XA 2HPAA 6GPBA 3DVSX 4FDTA 2VHJA 3AHIA 2RKWA 1YJBA 2IY9A 5EWMA 4D46A 4GOJA 2P6NA 2DRIA 1XU9A 2ZJ3A 4TLCA 3DPSA 4O2LA 1F14A 3VR4A 3OWOA 3MJVA 4MEYA 3RG8A 4MUYA 4DC0A 2WTAA 5ISMA 2VJOA 3AR9A 3K1YA 5I4CA 2D8AA 5I7OA 3RLIA 3DJFA 2VS1A 4S12A 5EWMB 5CLJA 3WGYA 4CM6A 3BMNA 2XHEA 4G5FA 3LHSA 3KUUA 3TAPA 3GO4A 4Q3KA 5DE3A 4ZVKA 4BBJA 1I24A 1G9TA 2KK0A 1MFZA 2B30A 3NBKA 5CDFA 5C46F 2QVXX 4KUEA 2R1VA 4QBHA 2Z5GA 2IHMA 4WK4B 2C95A 3HE3A 1P0CA 3QNUA 1ZWLA 4O2AF 4RBNA 5E7MA 4Q5IA 3T4EA 5AVOA 4DV7B 1EXDA 5F12A 5LB4A 2YR0A 3N97B 3IUQA 4IDNA 4DJDC 1KN5A 2W8KA 1ZQVA 3FETA 1D0VA 4RLFA 1C4WA 2PCLA 2JZCA 3DM9B 3KUCA 3NBMA 3TIFA 5J29A 2B1GA 4NCXA 5CD9A 4PSAA 2CB0A 4NL4H 3D7SA 2QRMA 4G9GA 1PJ4A 1S01A 3MR2A 2DG2A 3AM5A 3AT1A 5B1EA 2WD7B 3KSZO 4RD6A 5DYIA 5TPZD 1WAMA 3NIFB 2DGZA 1ZQ1A 3SSMA 5JNLA 4S05A 4O1HA 1T9ZA 3KYDB 1XXHE 3KYCB 3HO1A 1EUYA 3AR8A 5KFMA 5IIJA 3DLTA 1ZHHA 4B4DA 4O4IB 3IR7A 4O5CA 2GJ8A 1MOSA 2G77B 4YVFA 3NHPA 5TNXA 4BX2A 4F3NA 3PNCA 5JPDA 4NDNE 4LKRA 5AHRA 2XWSA 3KHLA 4NAHA 4ZANA 4JLSA 3NNSA 3NV9A 2OXTA 3C3MA 2HDHA 3HYRA 1XJ0A 1CJMA 3EH1A 3GLFE 2DLNA 3FAZA 5CB8A 4KTQA 2QD3A 1NGSA 1P4HA 1GUFA 4RF2A 2HBQA 5HCUA 3SEZA 1NY6A 1RHUA 4AMVA 1XJWA 4KH1A 4CW7A 4QECA 3GIJA 1T36A 4YJ3A 2NRXA 2Y1JA 1MKYA 2X40A 4DB2A 2RHJA 3G8BA 4DBZA 4YMOA 4YAUA 2ZUEA 3HRDD 1L4FA 5L1MA 1YZHA 2WOJA 4AWBA 5IXJA 1F2TB 1GFZA 5LVAA 4QDOA 1DBIA 4HNTA 4R9SA 4XE5A 1V5GA 3IBSA 4WLFA 1E2BA 4AO8A 4YN3A 5I9TA 4QJ3A 2C2XA 2D06A 3CA8A 1MX9A 4L9AA 1CUXA 4KN4A 1J0BA 2IP1A 3JQEA 4MEJA 1OPRA 1V16A 1BEUB 1NW5A 3CNQS 2Z2ZA 4Q34A 3C5HA 5E6SB 4ED0A 5JBNA 4Z0TA 4PIPA 1FXWF 2W6CX 4OBXA 2JIDA 4RK4A 4TS9A 1XDWA 3DZFA 1OWPA 3B5IA 4IDAA 4QPJC 2O5CA 3WV5A 1EESA 2DBQA 1U7TA 4HGPA 1KKMA 4E15A 4EW3A 5KVVA 5DBEX 1SV4A 3I30X 4E11A 1RLIA 4CF3A 1R8YA 1SB9A 4MW4A 1Y37A 3N6RA 2CY0A 1Z7WA 1E94E 2DPGA 1CQJB 5DTQA 3TSOA 3TDKA 4XCVA 2FF7A 2QBYB 1ML3A 1QRSA 3PR4A 1BN7A 1ETHA 2V9ZA 2F1OA 5SV2A 2Q21A 1IBSA 3V1KA 2QN7A 1T1RA 2IXFA 4CV3A 8ICCA 4LNAA 1PVRA 1REQB 3DE3X 3GEHA 3RVPA 2DL0A 5AKKA 2F3UA 1WWVA 2QN9A 3HSSA 5EZQA 5FOXA 4W9MC 2VK1A 2WWYA 5EWLB 3N0WA 5IVKA 3Q3JB 3CIFA 3EPPA 2W0MA 4O4HF 1WM1A 1SKMA 5BVHA 1X9MA 3KYJB 4C0ZA 1A95A 4BGUA 5C3UA 1EUQA 2GJKA 3BVPA 1XMOB 4B83A 1Q0RA 3VH2A 4BECA 1IATA 1L2TA 2HREA 5AVXA 5KJ1A 1NLUA 3TTYA 2YX1A 2NO1A 3OFKA 4KLHA 3R0QA 1PZMA 5AJHA 3FR8A 2IUEA 2B1IA 5J0RA 2GHRA 3OZGA 1TVMA 5EZYA 5TY0A 1IRIA 4NOMA 3SFTA 4DNQA 3LGSA 1I7SB 3BMQB 2BSQA 3G9QA 4DCCA 1O4WA 1SOAA 3HABA 2W3RA 1BX1A 1II0A 2VZ0A 4ILEA 4CM8B 4DZZA 5LL6P 1XTIA 1U47A 3DZIA 4Z53A 4TPKA 1VG1A 1XXLA 5KYVA 4YJFA 2J5QA 3ZWPA 4ZYYA 1N34B 221PA 2QJFA 4JROA 4REOA 2WM3A 1O58A 1QZTA 1A98A 1YC2A 3LMKA 4YUWA 1R0RE 2WTFA 3LDAA 1FVFA 7ICJA 2PUJA 4FNOA 4LGYA 4OX9B 5I7VA 4ZC8A 4GM0A 2F6RA 3THOA 3WDMA 2W54A 4G0PA 4JAVC 3TKYA 2G6TA 4YCBA 4BE4A 5TISU 3EXHC 5ICEA 2VRCA 2WIJA 4F97A 4JEUA 4J03A 4IX9A 3RVKA 1WETA 1YKSA 1G8KA 3F67A 2AQ0A 3FDFA 3VR6D 1V41E 1UFKA 1QKJA 2BGJA 1T0IA 1N6HA 1XJCA 2KLHA 4KODA 3BEOA 3K1ZA 3JATA 3WWEA 4JJKA 3KK0A 4Q9KA 4BX3A 4EFLA 2IW3A 1Q50A 2B35A 3MJRA 4ALJA 5B7QA 1XSEA 4BEJA 4BRSA 2Y6VA 3AQFA 4YJHA 2B3TA 2JD1A 1V95A 1QQ5A 2RJNA 4K3UA 4MW7A 3QELB 3EODA 4O0IA 1U7HA 4NARA 2ZUTA 1PL8A 3WGUA 4MVJG 5DHPA 1XK6A 3QLTA 3OSZA 1O97D 3BN3A 1KVQA 4JLDA 1TZBA 2D3WA 4WESA 5BQOA 4Z6DA 4D43A 3TGPA 2IITA 2MSNA 1NI4A 4JQYA 2IOQA 3ZVKA 2ZFUA 3FDIA 3NGMA 2BCVA 3CEHA 1QGYA 4WMLA 3C4QA 3A4TA 4COOA 4D9NA 3B8HA 5FWYB 3LSYA 4U4AA 4RVNA 4B80A 4LWZA 4BZZA 1E6KA 1RQPA 1GQQA 3SAHA 2IU6A 4B3MB 1PP4A 4LNUA 3GL9A 4M1KA 5DDIP 4QTYA 1RJGA 4L7VA 3UMRA 1V4NA 3BH6A 1M2KA 1FFGA 3OC0A 4I1UA 5JAMA 4EBCA 1M6NA 3LAWA 3J81j 2BKUA 1PEAA 5JCJD 3PY8A 1X7ZA 3A1VA 4HWTA 1GTJ1 1UWVA 4NCKA 4F45A 2DECA 4WOKA 4XWYA 3H9QA 3IALA 5EEGA 2JS7A 2PL5A 3IOEA 3EUB2 1JVSA 3E9NA 3NATA 2J9YB 4CEIA 4ZXPA 2EH9A 1J07A 1NT2A 5WRFA 2XNHA 1QRRA 3MEQA 1HSOA 4UPDA 1KH3A 3I05A 2WI8A 3RVOA 3UHAA 1T4CB 5B64A 2YWGA 3DUFA 3JALA 1GYQA 4UREA 1FRNA 4M86A 1M2OB 3PKJA 2WB1F 4URWR 3IQEA 2ZYUX 2QP3A 2QTCA 4D41A 5A9SA 2QK4A 3CG4A 1C1DA 1QP8A 4TURA 4D8VA 3F9CA 2PGDA 3MT0A 3Q87B 4TKMA 3KSUA 1HT3A 3T79A 2VQ3A 3A1WA 5F1OA 5IFLA 4KU4A 4W6ZA 4O33A 5HIJA 3CLRC 4LCEA 4MYSA 4F4YA 4TUYF 5ULLA 1QK4A 2QTVA 1CUFA 4GPEA 1TYEB 2RHFA 2BEUA 3NRZA 2GBPA 2A58A 1G5FA 4MCJA 1BMFD 5CA0A 5A9SB 1MT3A 5AUOB 1SPXA 3ZBQA 1A82A 5GV8A 2Y1IA 4DQSA 1CERA 4Z4GA 3MCWA 3ZKWA 3L0YA 3D6NB 4X6LA 3EXG1 8ICTA 3HU5A 3U0VA 4EUFA 1JRPA 2QQEA 2WU1A 3QE2A 2DFKB 3M3PA 2XYRA 2FOIA 4GEKA 2FEXA 3QBDA 1ZM3A 2WIKA 4P7FA 4EGAA 3UW1A 4Z6KA 5B30A 1RYHA 1US8B 2AT1A 1GLNA 2IF2A 2VZLA 3CLVA 3GPDG 4EX6A 4V0OA 1NY5A 5ADVA 2FHSA 3TB6A 3HKZF 4PTLA 2OP1A 3PUIA 4MVJI 2Q5QA 3BWDD 3IE0A 1FZQA 4FGJA 5CFLA 4BVBA 2WV7A 4LGVA 2VATA 2PUGA 4QRDA 4AJHA 2RHRA 1G7TA 4I6EA 5J5AA 2V3CC 1KI8A 2C82A 5E2IA 2J1LA 3B85A 4KLUA 4OKSA 1A4RA 1CQPA 3IEPA 1C9DB 3PYXA 3NTQA 3HP7A 3BB3A 2PYIA 4R8LA 3S3TA 4BO2A 4YECA 2XO7A 2VQEB 1Z73A 2G82A 3GILA 3BFXA 3D6MA 1ZKDA 2BGUA 4QU9A 4WK2B 5GWXA 1ZI9A 1EHYA 1G63A 2FE4A 3IDSA 4BE7B 4KGDA 2Z1MA 4LQCA 3KLPX 4R8SA 2WDZA 3K6SB 3BICA 2XVTA 2BR0A 4GPD1 2I6QA 5FOTA 5E79U 3GMTA 5KG7A 1S0VA 3GLTA 3IP1A 3R3WA 4OB7A 2IH5A 1XJQA 4XGIA 3EZYA 3ZV7A 5J0QA 3ZWVA 1HL7A 1V45E 3TRDA 1ZD4A 3DKKA 2B83A 5F33A 3CLSC 4RTNA 4E30A 5TMBA 2VDLB 1JDUA 4WZZA 4GLXA 4DS4A 2W9XA 3B9RA 3IUSA 2JBAB 2JLXA 3KQKA 4DEZA 3INRA 4QLAA 1B74A 1H4VB 3PT5A 2C5SA 3NO4A 1EFVA 2D74A 1P4JA 2QX9A 4LE1A 4OHMA 4UCFA 3DKPA 3L7DA 4RFVA 3IUBA 2JEJA 3WG9A 2Y93A 2Z1NA 5DZSA 3R5FA 5DW0A 2PLFA 4KXFB 2R7AA 3PPIA 6LDHA 1ZLXA 2GPSA 5PNTA 3R9IA 4CG2A 1XV5A 1BSVA 4MFAA 1GWNA 3B13B 3KHUA 3DMNA 1AQIA 2XIJA 3CB4A 1SUDA 5CW2A 1TK2A 1RJ9B 4WLOA 2Z43A 4ZOCA 2W90A 1E59A 1KIAA 2BD0A 2FSVC 4K7JA 4PLZA 3HB4X 4QLOA 1EINA 5IDYA 1G2IA 3BSYA 4RCYA 4DJEC 1PR6A 1LK0A 2C4NA 2C07A 3TARA 2WJHA 4RD0A 2IPAB 2UZ3A 2E5WA 2QU7A 4LOKA 3RKRA 1N33B 1JPJA 1VM6A 4L3VA 4UU7A 1T6YA 3CKMA 4LZOA 5FO1A 1SQ6A 4CLRA 2O1WA 3K31A 1UKBA 3G79A 4W63A 1Z6AA 1NX6A 3GFFA 4FOSA 1F60A 3ZCRA 2P9BA 4JR1A 3VPAA 4XWOA 5KC9A 3O2SB 3WQRA 2Z7JA 4DR4B 2JJ2A 1QC5B 2QSZA 5CIYA 1MO5A 4HK4A 1CUAA 1U9CA 4B4KA 2KTQA 2H8GA 3JX9A 1K97A 3A1TA 1WB4A 1GPH1 4MKHA 1YZQA 2J0VA 2PIDA 3KVNA 1MGOA 1QLHA 5J2AA 1W96A 1X70A 2PMBA 4V2UA 2YZNA 4EJMA 3H8JA 2YXDA 3NBXX 2BMFA 2JDID 3FZEA 3H5RA 3P2IA 4J07A 3QWHA 4UXHA 4ASUA 2OY0A 1SQ5A 3L06A 1COKA 1G5TA 3H16A 2QJOA 3DDHA 1P72A 3V7YA 3L82B 1F0YA 3GZTB 4IOKA 4AS1A 3AILA 1HETA 2JZBB 4M9GA 1NPTO 4ZQIA 4QUGA 3WBFA 4C0LA 3U16A 1LW7A 4LBWA 2WBLC 3GLHB 2X0IA 3NH6A 4HNQA 4IDHA 2HF8A 1U94A 5JG7A 2VXCA 4WBNB 3IAAA 3ZHYA 4M9CA 3NDPA 1Q3HA 1XMSA 4LVUA 3AUUA 4O2AB 1NMEA 2J7PA 4P2BA 4J9RA 1JDBC 5DYNA 4EA9A 7ADHA 5JZOA 2AR0A 2AEEA 3CUSA 4B2PA 1IHXA 4Z7JA 5IU6A 1E8DA 1X1EA 2A0KA 2Y1CA 3DP9A 5K0SA 1OB5A 4R0MA 1E7MA 2QUAA 3RWMB 3HUDA 5KWJA 1J0DA 4IJQA 4TL8A 4MUEA 3GMSA 2K60A 4FINA 4GF5A 3GIWA 1BXZA 1DBRA 2G04A 4TMYA 1SKWA 4IV0A 2BOVA 2BF7A 1GAXA 3C98A 4FZJA 4D9IA 1GVHA 5BSFA 1MB9A 3HO6A 3GG9A 4OJNA 3W9SA 3QEBZ 3QPBA 1B14A 5DSXA 1VIDA 4DS3A 5EXDA 2D1QA 3EXIB 4AYTA 3D6JA 2YB1A 1LXCA 1TU4A 1U0NA 2QD4A 3QW2A 5K51A 3D54D 4AJLA 2BMWA 3PCRB 4PO3X 3IXQA 3NOXA 1ZRMA 4HUJA 4DXDA 1EM8A 1OBHA 2H9YA 2Q0XA 3B1ZA 3BZKA 3BWXA 1L5OA 3KZCA 4ZAGA 5A3VA 3V3KA 2HLPA 4A16A 5BWNA 2XI4A 2L42A 3FZYA 3E9EA 1HT1E 4RFSA 3E2PA 1M7HA 5DN9A 3I53A 4YP3A 3L6OO 3PC4A 4ZQHA 2GM3A 1TKCA 2QPLA 4ZICA 4Q00A 2I2BA 3C5VA 4EIWA 4F38A 2FCRA 5T64A 4USAA 5D4BA 5KMGB 2XGMA 3HVRA 3C7TA 3T5DA 2AF3C 1ISHA 1C7FA 3IG8A 7ICNA 4PLYA 1H65A 3PNBA 1HE3A 4WV3A 3FTEA 2K87A 1S76D 1P45A 1T4BA 2UVPB 5LPNA 1Z62A 3H9GA 4GFDA 1SCNE 2CBXA 4CL8A 1E3SA 1Q1BA 4M0LA 5F52A 1R88A 3U7JA 1C0LA 4PAOA 5AMXA 3W5VA 5EHIA 3PQ2A 2C88A 5IINA 2WU4A 4D45A 1JWLA 5E8RA 4C5AA 1IBMB 5AW5A 5BQFA 3E9CA 2EWMA 4J9OA 3PENA 3BKWA 2HOFA 4OMDA 2QLLA 1GPLA 4YRMA 2LDXA 4CKCB 2EG5A 2C59A 4QVKA 5CT9A 1Y63A 3ZDCA 4IQWA 4FS1A 1YQQA 2BC9A 2OC4A 3ENVA 4HN2A 2JXJA 4X1OA 5EZ5A 2F3SA 4ZCSA 3VMMA 2C7PA 3ZHTA 3GDFA 5JJLA 3F6PA 5ICMA 1C7ZA 4U7JA 5B58T 3DG9A 2QP9X 3KT6A 3JPQA 1JAYA 2WZQA 2PWPA 3PGA1 4KK4A 1S3IA 1YU9A 2COEA 4NKRA 2YN0A 1HDCA 1LNZA 2JLCA 2X8JA 3BXEA 3EZGA 5FUBA 3T1QA 5TIIA 5KDDA 1G41A 1XTJA 3HT3A 1S2DA 2DTDA 1KOLA 1ECCA 1KZ7B 4QSMA 3QG5A 4RJ2A 2J3JA 4XDHA 4EZEA 2O7VA 3OG9A 1X1BA 2FPOA 4BB9A 3R2JA 2FV8A 1UK8A 2H1WA 2IEYA 4P54A 5IJXA 3I58A 2RKOA 2RSLA 2VTKA 3E84A 4R2LA 1WXDA 1I6MA 3LC7O 5FBHA 2D6FA 1R6BX 4NV0A 4EX7A 2R8IA 1QSSA 1TADA 1YHZA 1NBHA 1Z5UA 3B1FA 3FUCA 4W1SA 1P1JA 4UOZA 5HX7A 2H0AA 5KEIA 4A36A 4GVLA 1G8YA 1A0OA 5IARA 3I01A 2JEYA 1KL7A 3IIJA 3N2LA 4PYJA 1XSLA 4B0PA 4JJGA 3RWOA 3CR7A 4BKQA 1F2UB 4IJ6A 3SI8A 2ZSKA 4D4JA 5IJWA 3UXMA 2ZXUA 3K09A 3LQYA 4GE0A 2FMIA 1X77A 4O4JB 4FS8A 4MI9A 3ADOA 1SVMA 4PIVA 1M0WA 3IPXA 2ZSAA 2NZJA 2ZBVA 4C1BA 2FZKA 5K3AA 5CYOA 1NZBA 3NHWA 2HJRA 2PSHA 3GJ3A 1BNPA 2I4RA 4KLMA 1BMTA 1NQVA 2QXTA 2GN4A 3BGDA 4OATA 5HUQA 4IL5A 3K4GA 3HJAA 1T0UA 2OAEA 1R4MA 4HT3B 2NACA 2R1UA 2HC9A 1RABA 2V45A 3EZ2A 1LQTA 3Q3VA 1XXHB 3A3PA 1HV8A 3ZCPA 3O8CA 2KMLA 5HNKA 2X58A 3Q72A 4KI0A 4QRHA 2RONA 4UMFA 4ER5A 5HK9A 3BCRA 2I2FA 1GYRA 1IY1A 3CO0S 1SUIA 3DJYA 4UE6A 5FA6A 4QQNA 3KKNA 4M9QA 2XQIA 5CNKA 1ZD9A 3ML1A 3WGKA 4MO9A 4DW8A 5I48A 2R84A 3OBBA 1PDVA 4KI7A 2OCEA 4LIPD 5CLGA 1EP1B 1MOZA 1JYFA 2PL3A 2WVJA 2ZXFA 4XGNA 4KXXA 4ZYZA 5J4VA 1LF0A 2HU5A 2NVBA 1T8PA 2JAPA 3FUXA 3GEBA 3S2FA 5AQ1A 4E5PA 4F6RA 1KETA 5NULA 3U60B 2OCDA 2J45A 1YKFA 1Z7BA 3O8DA 4ZTBA 1P4SA 2HDWA 2YV3A 3AEKB 3AU2A 3OCJA 1Z4IA 2C3UA 4P0PB 1K92A 2L69A