2I6XA

The structure of a predicted had-like family hydrolase from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
205
Chain Sequence
AMIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRFLPSGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLLREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title The structure of a predicted HAD-like family hydrolase from Porphyromonas gingivalis. (CASP Target)
rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
total genus 73
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2006-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2i6xA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i6xA01
1SWWA 5ALEA 4OD0A 4L6CA 1YMQA 4CF3A 4HGPA 2JAOA 3KBBA 4I9FA 4OHFA 1TA0A 3WGVA 3WK8A 5AI0A 1WVIA 5AVVA 5AI8A 1U7PA 5AK6A 1ZS9A 3QX7A 1K1EA 3AR4A 4OFZA 1FEZA 4DFDA 4HGRA 4HAIA 3WKBA 1J8DA 3W5BA 1NNLA 3ED5A 1X42A 5AVTA 4EX7A 4QQFA 4B6JA 2BDEA 3R9KA 1Z4OA 4IG4A 5AVXA 2JGAA 3IJ5A 5AW0A 4RESA 4CF5A 3EPRA 3I28A 3UMBA 2C4NA 3AR8A 4F71A 3ZWDA 5AKLA 2RAVA 4EENA 1IWOA 3BA6A 3MN1A 4NV0A 4GXTA 4L57A 3A3YA 3E8MA 2C8LA 1RKQA 2HHLA 5AW1A 3N5KA 1S8OA 3FZQA 1L7NA 2FUEA 4NAVA 3I1YA 1YS9A 4UAVA 1EK2A 1QYIA 1L8LA 2GMWA 3W5DA 4MUMA 3KOOA 3WKEA 2FEAA 4H1WA 3M1YA 4UU0A 3NALA 3HLTA 1RPZA 2G06A 2WM8A 3MC1A 1VJRA 3BWVA 5AKHA 5ALWA 1O03A 5JJBA 4UARA 4GIBA 2FPUA 5AK5A 1Q92A 2WHEA 1XP5A 4PNHA 5A3RA 2FPRA 3U7GA 2BDUA 1Z4LA 4XPZA 2O2XA 5AHXA 3E84A 2YMLA 4AS2A 3AR6A 2B1QA 2C8KA 1Z4NA 2Q5EA 3L8GA 2B0CA 3F9RA 2CFRA 2G0AA 1L6RA 4UM5A 1ZRNA 3L7YA 1VJ5A 3WK9A 4HGOA 3NIWA 3ZTYA 5AW2A 1SWVA 5AI6A 4G9BA 3UMGA 5AM4A 3B9BA 2AUTA 5AICA 5ALSA 3PDWA 5AKIA 1YJ5A 3AR5A 2WF9A 1RLMA 3M9LA 3EWIA 4ZEWA 5AKYA 5AKEA 3WK7A 1J97A 3A1DA 4BNDA 2I33A 5ALHA 2ZBFA 5AIBA 2OA0A 1WPGA 2Q4TA 3L8HA 1S2OA 4JDPA 2WF8A 4NABA 2IOFA 3FM9A 3ONNA 2GO7A 2GHQA 2Q4RA 2W11A 2QYHA 3NUQA 3ZVMA 4Y2TA 2O9JA 2HEGA 2NO4A 1U2TA 1EK1A 1ZD3A 1VFPA 1QQ7A 2HO4A 3W5AA 1LTQA 1NRWA 5FP0A 2YMMA 2HCFA 3QUQA 3E58A 5ALNA 2I34A 3B9RA 3MMZA 2CFTA 2HF7A 2I54A 2B8EA 1CQZA 1L7OA 1ZD5A 5AI4A 2D2VA 4Y2QA 3RFUA 2ZBEA 3L5KA 2HX1A 3U19A 3KC2A 3FPSA 2PKEA 3L1VA 2YJ5A 2EAUA 2OM6A 5T41A 5AW4A 3OCUA 3PGLA 4Y2RA 4I9GA 2IOFK 2CN1A 5ALMA 2BY4A 4UW9A 1RQLA 3R09A 3RF6A 3ZTWA 5ALXA 1TJ4A 1L8OA 3D6JA 3TLMA 2WF7A 4J03A 3U26A 2P69A 1TJ5A 4UMVA 1RLTA 5AK4A 2RARA 1L7MA 5E0OA 3OCYA 2OYCA 5AK3A 2ZBGA 3WK6A 2YJ3A 2R8EA 3EF0A 1ZD2P 3ET4A 2MSNA 4KX5A 1WR8A 1LVHA 5A3QA 3SHQA 2QLTA 3UMCA 4G63A 1RLOA 3SD7A 4EX6A 3UM9A 1RKUA 1TJ3A 1YNSA 4RETA 3R4CA 2YMPA 4DCCA 3DAOA 2IA5A 2JAUA 3L0CA 5AKXA 2WFAA 4BKMA 3WKCA 2JARA 5ALGA 3VAYA 1Z88A 3ESQA 5ALZA 3PGVA 3S6JA 4UATA 5AVYA 3QU5A 3NAMA 4L6AA 1CR6A 2FPXA 3I6BA 5AKKA 2ZBDA 2X4DA 1SU4A 3GYGA 1YDFA 2B82A 4NFLA 1RRCA 4ZEVA 5ALFA 2I55A 3NANA 4XOUA 3IRUA 1WZCA 2HDOA 4BBJA 2IOHA 1XVIA 2YFYA 4HYTA 3U13A 4CNQA 4OCZA 1RDFA 4YIHA 5ALIA 4UMEA 3SLRA 5ALOA 3L0YA 2IYEA 3J7TA 3OPXA 2G07A 2WF6A 4UM7A 1QQ6A 3DV9A 3FVVA 1AQ6A 5AI5A 1RMQA 5AM3A 2RBKA 2C9MA 5ALPA 3A1EA 1RC8A 5IT0A 5A3SA 3U7FB 4FYPA 4Y2YA 5IT4A 3WK4A 2W43A 3OTQA 2HSZA 3KD3A 3QYPA 2I6XA 2EARA 5AVZA 4Y2PA 2FPSA 1RMTA 3WGUA 4Y2JA 5AW3A 3DNPA 4Y2UA 5ALLA 3DDHA 4MWOA 3HYCA 1QQ5A 1Q91A 5AKGA 5ALVA 3OCVA 1RKVA 5AW9A 2NYVA 3QU9A 3N28A 2FPWA 1TE2A 2FI1A 3QUBA 4IFTA 4J2TA 4FFDA 5ALKA 5AIAA 4KNWA 3AR9A 1RMYA 4UU1A 1ZRMA 3L0BA 3ZX4A 2ZOSA 3OCZA 4EZEA 3WKDA 1U7OA 2P11A 5AW8A 4DWOA 3NRJA 4C4TA 3N8GA 5ALUA 3ZWKA 3ESRA 1ZD4A 3MPOA 5AW5A 1KYTA 3L8EA 4AP9A 3W5CA 2B30A 2AGVA 5AW6A 5AM1A 3AR2A 5AVWA 3QLEA 1U2SA 2G08A 3CZ4A 4BEVA 4AS3A 2YJ4A 3QU2A 2YMQA 1XPJA 4KN8A 3SKYA 3QUCA 4BX2A 4C4SA 3SKXA 4EELA 1RQNA 4UASA 1T5TA 2B1RA 1Z4JA 3WK5A 4UMFA 2YJ6A 4XQ0A 4EEKA 1QH9A 3A1CA 4Y3UA 5AVSA 4DW8A 3QU7A 2JAWA 2G09A 2CFSA 4BNDB 2ZXEA 1JUDA 4KNVA 1Z4PX 3IB6A 5AKZA 3CNHA 2AMYA 3B8EA 4Y2SA 3FGOA 5ALTA 5AESA 2P9JA 5ALYA 4QJBA 1U02A 4YH1A 4BX3A 4CF4A 3ZW7A 4YCNA 2B8JA 1NF2A 3WKAA 2OBBA 4HGQA 4XE5A 5AVRA 4F72A 1Z4IA 5ALJA 1ZOLA 2HF2A 2WF5A 2RB5A 4BEWA 5AVQA 2GFHA 4O8CA 1Z5UA 3I76A 1PW5A 3ZVLA 5AKJA 4YGYA 4Y2XA 1N8NA 3N07A 2YY6A 5AW7A 5ALQA 3FPBA 4UMDA 5ALRA 2MU1A 1Z4KA 4YIKA 1Z5GA 2AH5A 3QNMA 4C4RA 3KZXA 3ZU6A 5AM5A 3KDPA 5IS2A 2FDRA 3ZX5A 1F5SA 2R8ZA 2MU2A 3L8FA 3N1UA 3ZI4A 3K1ZA 2GHTA 3U7HB 2G1AA 2HI0A 4E88A 4Y2VA 1Y8AA 3SMVA 1O08A 4BX0A 4CE6A 1T9ZA 2HOQA 5AI9A 3AR7A 2I7DA 2P27A 3QXGA 3PCTA 4JB3A 1Z4MA 1YV9A 3NASA 4UAUA 2C88A 2W4MA 4ZEXA 4KYTA 1Z4QA 3OCWA 4FE3A 2EATA 5AM0A 3ZVNA 1ZJJA 5AM2A 4YCLA 2R8XA 5AVUA 3U7EB 5ALDA 3QUTA 2NO5A 2FUCA 2PQ0A 3P96A 3SF0A 2DQSA 1L7PA 2G80A 2VKQA 3QGMA 3ZUPA 2YN4A 2PR7A 1MH9A 2YBDA 2R8YA 3E81A 3AR3A 3QU4A 3EF1A 1T5SA 4KX3A 4BYGA 2ZG6A 4HGNA 3ET5A 3OCXA 4NWIA 1N9KA 4YCMA 2ODAA 3L1UA
chains in the Genus database with same CATH superfamily
3ZDDA 1O9GA 5G0SA 1SKWA 2QGNA 1U7PA 2LE0A 2PO7A 4NCAA 2F9LA 5J8YA 1RI1A 2GF0A 2C2XA 1N3BA 5KHLB 3RH0A 3BD8A 3BS7A 3RR8A 4XYMA 3H05A 2YXNA 5JBNA 3OZRA 1FFUA 1OI3A 3SC6A 2P79A 4JT4A 4R01A 5JRJA 3M8RA 3GC6A 5KFRA 2B92A 1YD7A 3BWDD 4PN7A 1GNSA 2G25A 4FZRA 3DOOA 5IU6A 1KDTA 1V7ZA 3ROQA 4J7AA 1JTEA 2FNAA 3T5CA 4YEDA 3BHMA 1CRXA 2YMLA 1U4OA 2VAPA 5KG4A 5CA1F 1QRAA 1RZRA 3NHFA 2CFRA 1I6MA 4DYDA 2CLLB 1EJ2A 1N60A 1P3JA 4UZEA 2IHJA 3NVAA 4OHCA 1ID8A 3H2SA 3ZYZA 8ICQA 4KBYA 1H38A 3CRXA 1S9FA 4QW8A 4HRYA 3MWEB 5DASA 4BVKA 3GEHA 3FM9A 3ORRA 1YK0A 1QFJA 4OL0A 2Y99A 1J5XA 3O38A 1LK0A 721PA 4F9FA 2NO7A 1ZHFA 1QVRA 4K6FA 4W7SA 1CVIA 4RLSA 3DE6X 3PVSA 3V34A 4A92A 5BV0A 2I34A 4KO2S 1YR7A 3C14C 5CM8B 2FSPA 2PUHA 4ZPXA 4C06A 3V4LA 1GY8A 3AM4A 3K9BA 1ZYQA 1D5CA 3QUAA 5CYGA 2A6PA 1JE0A 3G8CA 2JFFA 2WRZA 2M6KA 1NNI1 5JWOA 1OROA 1DX6A 5C32A 3ETHA 3M9OB 2D6FC 4EDFA 2OBMA 2AGQA 4B7XA 3V8MA 5GQSA 4IJQA 3ZDRA 4H7KA 1P17A 4WKGA 1T9GS 3CLSD 4I1YA 2JHGA 4A2WA 1SK8A 4JI7B 3PGA1 3E35A 2WSMA 4UNQA 5H1YA 1RFLA 3E18A 2GT1A 4DCJA 4KQEA 3TXXA 3K6KA 2B83A 1ZETA 3PNOA 3UJHA 4YQYA 4Z6EA 2WIFA 4F93B 1ENPA 2ECQA 4P5DA 4BBJA 2AOVA 1W87A 4CNQA 4HLQB 3OSUA 1L5OA 5E3JA 4I6JA 1JLSA 3BM5A 1NBHA 3L1JA 3V4PB 3T3PB 3F98A 1I30A 2R8PA 3G2JA 2BJHA 3LUKA 3HP1A 5TJ9A 2ZUWA 4DR7B 3W1WA 3JQAA 4IUYA 1Y3BE 4RDIA 3IOCA 2O05A 2F1HA 4Y2UA 4TOIA 3SG0A 3IDSA 1XFDA 1T6NA 3QVVA 4K26A 1M54A 2IGBA 3KSRA 2PX6A 1H3EA 3WZMA 1MOQA 3LC1O 3DZJA 1SG6A 2NXCA 3ILSA 4TMYA 3EDMA 4G67A 2XIJA 4FZ5A 3PKIA 1VHLA 4NFSA 4BVFA 1VGQA 5CW1A 2B94A 5GIOE 4LZLA 4G4JA 1N5XA 3HKDB 4HQOA 5LKRA 5FYQA 5HUHA 1RM5A 1HT2E 5A7HA 1Z3CA 1RD4A 1CDOA 3N0XA 3CUTA 4OAOA 4O2BB 3VYTB 2J0SA 1E5DA 6AT1A 1QLJA 4HWRA 2W03A 1FUIA 4PGFA 4RADA 1ULHA 1NF2A 1U8TA 4CM4B 3MILA 2IZ7A 2B5WA 2REQA 3ND8A 4M49A 4B0PA 3ETNA 1KN5A 4Q9HA 3EK2A 2ISSD 2G67A 4KG7A 1T25A 4C4AA 3T9CA 4Y2VA 2D5CA 4CE6A 4P3OA 4UD6A 2KG5A 3FMVA 5FO1A 4PH5A 3IVGA 3AHHA 4PFQA 5HIJA 4E07A 1FTNA 1SIBE 2J4DA 5EZ5A 5BOVA 1VE1A 3H1FA 4N3AA 5KFLA 4NJEB 4L74A 8ICMA 5A5VA 2RJNA 1RJGA 4DV5B 3CNLA 3WIOA 3QVWA 5LD2C 1SHKA 1ZQBA 1CCWA 2C78A 4EUKA 3CIFA 3PHCA 1KWKA 4BMDA 4GX0A 1BXGB 2B6HA 3JD2A 2Q6TA 1ZS9A 5G1OA 3AU9A 2VJBA 1G21A 1KXZA 4OQDA 3DUWA 1YZGA 7GPBA 3DLBA 2QRUA 3D6UA 3GUZA 2JBHA 2P2DA 5JMWA 4BMPB 2FSSA 4IMJB 3KQKA 2VCHA 4B9UA 1KMNA 2QN3A 2DG2A 3HA2A 2IS6A 5FUMA 4FGWA 1GPDG 2XEDA 4QX6A 5FUWA 3HVJA 4I4TB 1XUOA 2OPHA 2YW2A 4MUIA 4AJEA 5KVQA 3CYFA 2UXCB 5EWJB 3T79A 2X0IA 5CDYA 1HDRA 3ZWVA 4QULA 3JPNA 4KN6A 4BV8A 3OKCA 5ALSA 5IG2A 3LHKA 2G5IB 2FFJA 1OWOA 1YI8A 5KQGA 5MGBA 1ZEJA 4M36A 4D0LB 4CQLB 2Q4TA 1BQ4A 2H2GA 5DB7A 2CXYA 2W7TA 2V6MA 2PT9A 3WFZA 3K9GA 2G72A 5L4NA 1T5HX 3VNSA 4J4HA 2GEDA 1YIAA 3OEWA 5B1YA 1COKA 1DZIA 2FFHA 3U6BA 2PKEA 4JASB 2WQZA 1BFUA 4JMUA 4R9UC 1QO7A 1U9YA 3DZKA 4BLWA 2W6CX 4TQAA 4XEHA 3ZV3A 2DUYA 4YUXA 1KP2A 2O6KA 3D4BA 1EUDA 4FGJA 4NG4A 2QTMA 1JBKA 3NW9A 1QGDA 1U5BB 3M6VA 2IOYA 1IBKB 4DJJA 4B4WA 1VXRA 5I7OA 4JBGA 4F86A 1HTTA 1EDOA 2B82A 2JGDB 4CF7A 2HDOA 2GZHA 4YIHA 2JZBA 4UBBA 4Q1AA 4UOEA 4PF1A 3BMNA 1Q7RA 1VIYA 1SVIA 3ORQA 4M47A 1UAYA 2H9AA 2W43A 2XDQB 4MVWA 1GU1A 4NKRA 2JGRA 3SYNA 1OXTA 3RT1A 1RMTA 4YAGA 1UJBA 4ZDJA 4RH3A 1OXSC 4KCGA 4P0QB 4B4VA 1WZIA 2B1GA 2DWPA 4JODA 5KQMA 2E4VA 1TJNA 2NX2A 2C29D 1AB6A 3EGDA 3GP3A 3KJXA 1W36B 2ODEA 4BRSA 3RO7A 4QOSA 1CT9A 2ZPAA 3PD0A 2O5CA 2E37A 3TLXA 4BLSA 1QYXA 1HT0A 1X7HA 3X1JA 2N1MA 3PR1A 1AKTA 2CDAA 3MQFA 1R27A 4Y3UA 2WIKA 1J23A 5IKPA 3F5DA 2XUFA 1VL8A 4MQ4A 5KYUB 1YGPA 1F4LA 3C3WA 4E3ZA 2CXHA 3B5EA 4WA7A 7MHTA 5LNK6 4EY4A 4NBRA 3O3CA 3O91A 2VJDA 2ZAOA 2IV3A 2DWCA 4W5WA 2CLMB 1PNQA 4HRAA 3QHAA 1N8NA 3VHRA 2W7PA 4FUTA 5JQGA 1T5OA 2CY0A 1FVFA 2ZUEA 5J0YA 4M0CA 3RPEA 1XD9A 1IATA 3T3EA 4BDTA 3K9QO 1AUOA 3UJNA 3L7MA 2XGMA 1DKUA 3HCFA 5AI9A 2EHDA 2W8LA 3E7WA 4O3SA 1W73A 1E3WA 2IBTA 5BWOA 4MHVA 5DBHX 1EFDN 2C0CA 3SAGA 1NOIA 4YR9A 1F9EA 5J2KA 4LK2A 3RS7A 4C5BA 1AHIA 2UZ1A 3H4MA 2HB6A 3O95A 3HBLA 3BFKA 4JLMA 5JMPA 1ZM9A 3GRKA 1XALA 5CDTA 3EISA 4FS3A 4DSUA 1BE8A 1L7AA 3TB4A 4JLPA 4B3SB 4P84A 1FEZA 3JARB 4JC5A 5LP1A 4CR8A 5DG9A 3LBAA 2JD1A 4B2LA 3VHXA 2AJCA 4BKUA 3A04A 1Q12A 4Z4QA 1QDLB 4F2WA 3IUYA 3P8ZA 3H0EA 1RKQA 4NHEA 3TNFA 4LYGA 5D87A 1FLAA 2CB0A 2OXFA 3H4TA 1V39A 4TLDA 3RU3A 2BR3A 3QNWA 1U81A 1HUZA 4OUKX 4H1WA 2HBZA 2VQSA 2IPLA 2IHVA 1IE3A 7ICUA 4KP7A 1UANA 4JWNA 5JY6A 1U28A 4PEVA 3OJSA 3B0YA 4HNHA 1AKUA 2AOTB 3IDZA 3V7JA 2VYCA 3DQPA 3D3WB 4ZMRA 2Q5EA 3WDKA 3THXA 3VKGA 4FYHA 5K6RA 2X1HA 4BVHA 1T2NA 3PYXA 1Z7GA 4LYYA 1PT8A 3E53A 1PEYA 3TRKA 5JAHA 9ICAA 4Q5IA 1JIUA 4JL8A 4P2HA 4DQRA 4WH0A 4DMGA 1WZUA 3V46A 1S2OA 3OQNA 4AL4A 5JVDF 2PFPA 4L5CA 3RJFA 4IC9A 3GLRA 4KMSA 4UCWA 2ZRPA 3EZLA 2IEIA 1E64A 4O3RA 2VJMB 3LO8A 1E8NA 4MEXA 5K0FA 4AG5A 2HBYA 4RGYA 4QZHA 2V7PA 3NVDA 4B3IA 1XRNA 3MOGA 2WT8A 3ZBTA 2FOLA 1KAEA 4QU5A 5K03A 3KK0A 1FUEA 1IH8A 4ZREA 4YV2A 5CGZA 4YJKA 4C20A 2ZBUA 1NZPA 2YH2A 3UAXA 4B73A 5KAFU 2D7CA 3COVA 1PS0A 3I61A 1ZVMA 3ZD7A 5KNDA 2GR9A 2CCJA 1G20A 3M3PA 1OYVA 3ETRA 2REBA 1UK8A 4EB8A 1U7HA 3VU8A 16PKA 2A1JB 1B76A 2FHSA 3C5CA 2EZ9A 2JAXA 4YA6A 1N78A 2O8BB 4P4UA 2B4AA 4LGCA 1U9CA 1GUDA 1DMSA 1KBZA 3I6MA 3FBGA 3IEVA 2GGSA 1JAIA 1NJZA 4OHPA 5GADl 4A8JB 3E03A 4XFDA 2HV8A 4AYBC 2QMUA 1H8EA 4TSRA 1SVOA 1KEEB 1ZLYA 5KVAA 1XNQB 3HNPA 1RABA 1H4VB 3ELDA 1NZDA 2BGNA 2J5QA 3E0XA 5DQGA 1HQYE 5GVSA 5I9TA 4ZDKA 5DBAA 3RVBA 4F91B 3A0UA 1B1AA 2HTFA 2PRSA 3PHGA 4L4ZA 5J2IA 2A3VA 3FYTA 1RQXA 2DFLA 3OG9A 3CF4G 1OIXA 2ZSFA 2FG5A 1VIVA 2ZKIA 1OX6A 3O8OB 4UZSA 3QLEA 4MV0A 1R0LA 4XFKA 4X6LA 1A4UA 4IM7A 1A5TA 2ZRNA 1JNXX 1XPUA 2FQWA 4FNOA 3UAVA 1H1LA 2UVDA 1A0OA 2ONJA 4CCWA 3PW0A 3VTZA 3A26A 1YVPA 5KQPA 3PPVA 4QLOA 4BO7A 1TAUA 5FA8A 3QLTA 1XWFA 3L7AA 1FDRA 1X9SA 5AKJA 4E5UA 2PVSA 4TV8A 2RD2A 1BKYA 4LZNA 2PTHA 1H2FA 3A4MA 3A4NA 5IS2A 1LPPA 4J7CA 3A6KA 5C5IA 5KNCD 3PGMA 2VYNA 2HXSA 1WBJB 4D82A 3EW7A 1OD6A 2HOQA 3TPZA 3AR7A 5BRNA 4PR0A 4C7OA 3UJAA 4Q18A 4UAUA 3LUGA 1NMYA 1QG6A 1W581 3K53A 3KEFA 3PJDA 2X8AA 1KLNA 3TOXA 4F1JA 4OK5A 3KJGA 5PNTA 4HTFA 4BP1A 3OE5A 1OLSA 1ZQZA 3QEKA 4OXRA 3C85A 4M8IA 2FCRA 4ZYVA 5I7UA 1AMUA 3CH6A 4C14A 3HGMA 4B4KA 3WNQA 2ID9A 5JEDA 1HYQA 3ET5A 3KWFA 2XIDA 2GNOA 5BSEA 4XDYA 1JSCA 4K6GA 3P0EA 3N0RA 5JTTA 2C9CA 5AI8A 3FPKA 2WFZA 2DTXA 4L0CA 3AU6A 4R2JA 5DB9A 5JS1A 1Y9EA 1V3UA 1IHPA 5HRUA 3DXFA 3A37A 1FTQA 1WCV1 4IOJA 1F4PA 1CEYA 2O1WA 3SQXA 3G23A 1AJEA 1IWOA 4IIJA 3E5NA 3STYA 2BKEA 1KKLA 5EE9A 4J1TA 1I3CA 1XR3A 4R98A 4KFCA 3A70A 3HYTA 2ODPA 2FVYA 1I2DA 1Y6GA 4TUQA 4IH9A 4OKSA 2Q21A 5F52A 5JNRA 4QG7A 4RD6A 1VJRA 3QEAZ 4Q3LA 5KWVA 1M6WA 4IBOA 4X90A 2BFDB 2OMEA 4R8SA 3C23A 4F3KA 3IKTA 4YVZA 5B7NA 2CSXA 1GGMA 4TMWA 4KQFA 3AM9A 3BB1A 4ETMA 2IVFA 1OKKD 3RHFA 2HF8A 1DCMA 2ZANA 4JIGA 2HJGA 2ZI7A 5AIBA 1POWA 1WPGA 4IZOA 3BTSA 4NCJA 3HI4A 1JDZA 5I4IA 1XRLA 4IDCA 1ULUA 4LSZA 2NO4A 2QX8A 4GOJA 4PHPA 1D8BA 4WEOA 5GOTA 4L3WA 4LG1A 1CQZA 3RVOA 2C1ZA 2ZYRA 4BE7B 3GI1A 3NNDA 5CVCA 2C7BA 5L7WA 4XVQA 1V96A 2Q9CA 5MFZA 1UFKA 1PFYA 5ECWA 1KHTA 1VLZA 3UK0A 2SNIE 2P69A 4WZAB 3ZDQA 1TUIA 3IBTA 2BUAA 3OCYA 4IEIA 3VUEA 4AZVA 3LWMA 5F76A 3WB1A 4XCQA 3JPOA 3BSFA 3MTQA 1ZIPA 4O2AF 1DPFA 1B74A 3NDPA 4C29A 4WLNA 1MDFA 2H1HA 5DM2A 1QP4A 4QQRA 2OGSA 3PLRA 4BTVA 4W5RA 3A9VA 1T34A 5AHRA 3J7AC 5K45A 3IP3A 1GL3A 1ZJ6A 1JQLB 3KEMA 1SXQA 1OAKA 3RTVA 1C8BA 1FXWF 5DGIA 3W2EA 4DAEA 4UKDA 4LI3X 4EHHA 4XKJA 2J9GA 3FCAA 3HYCA 4AURA 4Q8EA 2P3SA 4QJ5A 4DA9A 2BPOA 2M6LA 1TFUA 4AYXA 1TECE 4FFDA 2VDOB 4DSNA 4ZC1A 4ZVNA 5I3ZA 1R0CA 1Y88A 3ZX4A 2I1QA 4J3FA 3LYSA 1L5GB 3AKDA 4AYTA 3AGQA 5DVZA 1GPUA 4FD3A 1KEVA 2HA5A 1ZN9A 3T5BA 1JLLB 5CAEB 1QLWA 4WA8A 3T5DA 1EWRA 1PJLA 3G68A 1P74A 3IO3A 4NS1A 3HCDA 5EE3A 5BMOA 4Q4CA 1VKNA 3X1MA 1X0VA 621PA 3QLVC 5CIWA 4A8HA 1T7PA 3F6EX 4O5OA 3D2NA 3N2GB 4PZLA 5FFNA 4YUWA 4CPDA 3FNHA 1WXFA 4RWZA 2GAFA 2KZ3A 2PMZF 4UDXX 4KEAA 5A4KA 4MW1A 3E05A 3NUGA 2XLBA 4FQ8A 4GOOD 4XLTA 2ZSBA 2PBFA 1ST2A 4MQEB 1NZBA 1L5SA 5AVUA 3SF0A 3R7DA 1RM0A 5JU6A 4REOA 1PUIA 1OX5A 4MJ3A 3AF1A 2HMAA 5CVJA 2QN7A 2HK7A 1T5SA 3IDFA 3IPAA 5A71A 5LLDA 4RF5A 5AUQA 1Y7TA 3KELA 4URFA 1L7QA 1BMFD 4ZQGA 1U31A 4GFJA 3RSQA 2ZRBA 2O0LA 5IWCA 2GXQA 3R6GA 4HGRA 2H5EA 4QU9A 5AVTA 2YFKA 3RRMA 1G19A 1U1GA 1AX9A 5D5HA 4LVNA 1KJIA 2G6TA 4Z6DA 1E2QA 2NZWA 2FGJA 3OX2A 2EKZA 1TC2A 2Q1UA 1IM8A 2RGWA 4TQ9A 2GYWA 4U9HS 2GJ4A 4DLGA 2GJ9A 2PKQP 4UVHA 1I9CA 4ITUA 1J2EA 2YHIB 2GCOA 1UA0A 3HMKA 4I4NA 5F64A 3I9V1 2PYZA 3VNAA 1TK3A 1M5TA 3TTYA 4GPD1 4QWAA 2IH4A 3CKYA 1GPH1 2XUQA 3EDOA 1S0VA 2VJQA 3TRJA 1T5IA 2GDJA 2Q2OA 3IAM1 3AY0A 4HQ6A 3Q3IA 2C3OA 1BZYA 1G3MA 1CXZA 2CUNA 4KU4A 3ANSA 2DH6A 1H2EA 1HY3A 3HCCA 2JXJA 4Z7NB 1ISSA 4G5GA 2AR0A 1KQGA 3EYWA 1QZUA 2UAGA 1N2SA 3F7NA 4GL4A 4PW0A 1DAGA 1N4DA 5CR0A 2ZEJA 4L0MA 3OOEA 1WYGA 1WXQA 2GCNA 3MERA 1XP8A 4F97A 5HW0A 5EJAA 5LYJA 4I5DA 2BGWA 2ZBRA 1V1RB 2H4ZA 1USKA 1ZVQA 3R09A 2VCEA 4A8EA 4PG4A 4Q3CA 3PFCA 1ZQ1A 2OC9A 1XZCA 4CM6A 1AQYA 3ON5A 1THGA 2YWRA 3DBHA 4GLFA 4KN9S 4B6EA 1H22A 1E5XA 2W8BB 2SICE 2I0FA 1U80A 1XZQA 3B3JA 2DWQA 1GEGA 3WFIA 4DIUA 1TJ3A 3NHWA 5E95A 4CZ2A 2FK7A 4DDVA 5KFCA 3AP1A 1PZMA 5CFZA 1SFRA 3WL8A 4ID9A 2JRCA 3ZY3A 3VU3A 4NL9C 3ODPA 4DB4A 3WRYC 1U7XA 3NHKA 1NKBA 1B15A 3K9FC 2DPMA 1WXWA 4GSLA 4O2RA 3JQGB 4ODIA 2O57A 2WD7B 2XQGA 4IRDA 3CC8A 4WLOA 4BGUA 1HSOA 1SC3A 1MO5A 3CB2A 5IX8A 1E94E 3ED1A 3GNSA 2W55A 1YB1A 5DLYA 3NHLA 5CA1A 4P0PB 4ADSG 2J87A 1VIDA 4MB6A 4B80A 4CGZA 4CMJA 3KZ1E 1BW9B 1KMHB 3UKOA 4HNUA 2VANA 1PWXA 3Q2IA 4JYBA 1WP4A 3K71B 1JR3E 3UFBA 1AIPA 3JQBA 1FFWA 3A2LA 1XLWA 4QBIA 3Q9SA 3AINA 4G07A 4MP3A 5BMVB 1Q0HA 1XSNA 2C7QA 1UMCB 1JJVA 4LBVA 3QWFA 4LGVA 4KN8A 4C7MA 1NJ2A 2ZTEA 5K8LA 2XCQA 5TT0A 4WLUA 4RNOA 5HIKA 1XVAA 4CQJA 3O82A 5B3LA 2ZXHA 1NI5A 2PWBA 2H2WA 1JLKA 3C7KA 4H9GA 1MJHA 5I7FA 7REQA 4UAGA 4B83A 3QFCA 3VDMA 3WFJA 5IFKA 1KA9H 3WGTA 1TAGA 1ZQPA 1Y1PA 3ZJUA 3TVDA 4FIDA 4L51A 4FFSA 1ZQ9A 1Z5ZA 3H18A 1ZQWA 4F5PA 1U11A 1TC1A 1SL0A 4OU5A 1N4AA 3MK31 1J6UA 1OLUA 8ICYA 2CCKA 4IR7A 2Q3MA 2NU6B 2NU7A 1B0AA 4P32A 1I5EA 4BTEA 8ICUA 2H8GA 1R5BA 5DMHA 3INNA 1SD1A 4L02A 2FPIA 4EG1A 2KX7A 4H3HB 3VSEA 4BMZA 3DE4X 3TLKA 3AI7A 1K98A 3ANXA 4GX5A 1H2XA 4XQCA 2KSOA 2OXRA 1XK7A 2PZ8A 4DPLA 4F3CA 3LDHA 1UR5A 1Q57A 1G7RA 3KJZA 1REQA 5F5NA 5K0SA 2AK2A 4A7PA 1VG8A 4MDYA 4MWTA 3KSAC 1L4GA 5M04A 3BGVA 2ABWA 3VPXA 2RCYA 4OBXA 4H0FA 5HGJA 4N65A 4FBMA 4GBJA 3UMBA 3BBPA 5A0FA 1RYZA 2ZXUA 3IFSA 3W6OA 2IYYA 2HT1A 1FMLA 2R65A 2O4CA 1V5EA 1DUSA 4YP1A 4YCSA 2B37A 2GN1A 4RM3A 4HZUA 2PZJA 4LJXA 2J67A 4WFQA 3CM0A 3OTHA 3BMQA 4DS3A 1JAHA 4BV2A 4EYKA 2EBUA 5CB8A 3NGLA 1SUAA 2HSWA 2DCMA 1DGJA 5L3SA 2J5RA 3T41A 1MO3A 3QSYA 2O2XA 3QFRA 1UUFA 4HWGA 1Z4NA 1KK3A 2ZTVA 2Q9BA 1T6XA 3RTGA 3DLAA 1E9CA 1HL7A 4RJJA 1EP9A 2FZ4A 2KFNA 1H9AA 2BJVA 1IUNA 3UPUA 7ICRA 3Q7IA 1BH2A 4UTVA 5DHQA 1RRVA 3GJTA 3WK7A 2HK8A 1EPUA 1VE7A 1EFVA 3GDHA 1XTTA 3F7TA 3ZDAA 1KAHA 2A9PA 4JKOA 3AEQB 3EY4A 1Z2PX 2XSZD 4GS5A 3NWEA 1TYBE 4OU4A 2HCFA 3TH5A 2IPAB 4WAUA 9ICVA 3WGOA 5C1PA 1J2NA 2C7PA 2YDXA 5DLQC 1MENA 4XUGB 2A4MA 1AU9A 4J03A 1G5RA 2G1PA 3EQ2A 4GPBA 2ZDQA 3U26A 4R8UA 3HC7A 3A0BU 3BRWA 3TRFA 4MRMA 4CMAA 1W2WB 4UCFA 3WJ7A 4MHOA 4GZ6A 2SBTA 4CUZA 1AURA 2R8HA 3IAFA 1WR8A 4RA6A 4PHDA 1UZAA 3HU3A 1DJMA 3LDUA 4MICA 1HLDA 4LRSB 4X97A 4RC9A 3BE5A 3P19A 4P2GA 2PM8A 2R6DA 4M0KA 5I7RA 3D8TA 2ETVA 4FD2A 2QKYA 3OOSA 4FVTA 3H8JA 2Z9BA 2Z08A 1Z16A 2BCJQ 2D1QA 3WB9A 5CD9A 3KL2A 2EQAA 4FYKA 3IQWA 3ADKA 2R11A 1T0UA 3L4BA 4D1YA 5JISA 3B6EA 4PYMA 4WINA 8ICHA 5KG1A 1SCQA 3U4DA 4B2YA 4G5XA 1BNPA 4H15A 1FDOA 1XNRB 2Y4OA 4K5QA 4DLUA 1UBUS 1JU4A 5IVPA 4D8XA 1JDPA 3A32A 2G9NA 1H2ZA 2BFWA 3EBOA 5F21A 3ADCA 2BP7B 4H6VA 1MRSA 3CVXA 2FOIA 5KTSA 3QFSA 1NN0A 4PYIA 4UE2A 5ALUA 4JA2A 1DCFA 3SZGA 1X39A 1ICEA 5IZ4A 3IVXA 1T6BY 1EJ0A 1ZJYA 4M38A 3AN1A 2YVUA 1XHFA 1YMUA 2Q50A 2BFFB 1P2TA 2B9VA 3MAAC 1GA4A 4MCAA 1L5VA 2Q1XA 5IUKC 5DWVA 2P9JA 1W29A 2RC5A 1CY8A 4ZCIA 1JXMA 1YQTA 1LS1A 1OH5A 2PD3A 1X1DA 3T7JA 2V4UA 5AQEA 2MR6A 1F17A 3IEKA 1WSDA 3D0QA 3IERA 2MSDB 4JQSA 2OYRA 3PDIA 1RI4A 2I4LA 3KJHA 4NCXA 2EP8A 3ZIDA 2CE7A 4OK3A 4GKAA 3IPLA 4IJKA 4OP3A 3VR5D 5K4GA 2HOIA 5KOHA 3MGGA 4LDNA 2QUIA 4UFPA 2AW3A 3P96A 3H11B 4QYIB 3RF9A 3SMQA 2XNCA 4Y6PA 1E58A 4EATA 3ORYA 4JLSA 5BR8B 3UZUA 1H2RS 2O2GA 3D8RA 1X9MA 3KKEA 3CVOA 2HXYA 5J2EA 1L5UA 4JLWA 1BE6A 1K1EA 4GG1A 4I5IA 2EZZA 4ERNA 2C2EA 1O8BA 1J8DA 4X41A 5T6MA 4JAVC 5GZ3A 3WVNA 4IG4A 3H5RA 4XYBA 5AHWA 4Q4JB 4PO3X 3IG8A 4EENA 3IO5A 1GTRA 1V97A 5ICEA 1K6XA 1UQUA 3CWZA 2NAFA 3U5ZB 2NSDA 4DNFA 4YLYA 1RXIA 4AF8A 1D8TA 3VHQA 3GJ8A 2G63A 2Z04A 1O97D 1HNWB 1NLFA 5A02A 4XPIA 5KSZA 3AY3A 2YKGA 1D9XA 2FP3A 3H42B 1MO2A 4F7WA 2JI4A 4ZV9A 3NOOA 4FPXA 4HEA1 4N3NA 1S2GA 2WPDA 4ZT5A 4BQNA 4B4OA 1MEOA 4OHRA 1IM5A 4PQGA 2ZTMA 4A82A 3SLKA 1T3QA 1SWVA 2XGGA 4JCCA 4XX1A 1BDIA 4YXWD 2AYZA 1QLHA 3C4JA 2P2SA 4WJZA 1J97A 2JH8A 3SHTA 1J2UA 2P4SA 1IY9A 4BZZA 5IZCA 2PZFA 3CRMA 1JVSA 3U4GA 5FJJA 3V8QA 4BX9A 1JRPA 3JWHA 3DHEA 1LSUA 2XVMA 4HX9A 3OOYA 2JIRA 4G81A 1Y5NA 1CZOA 2UVPB 4Z6FA 4CLXA 1Z08A 4N7JA 1I3LA 1Z5NA 2A30A 5DDYA 3FGPA 2ALJA 4PTZA 4EY6A 2WWRA 4CQNA 1HXHA 2BQ3A 2HWUA 1W35A 3VYWA 4ICAA 2A9OA 1CUJA 2OY0A 3BJYA 1IOWA 2GZ2A 3QE2A 3L8ZA 3FMPB 5DG8A 2CBGA 4G63A 3M9WA 4EUNA 1ID1A 5D6OA 4NECA 3VDNB 3R24A 4MH0R 4XWGA 4JJFA 3PGVA 2Y92A 4AY5A 1MC1A 5JECA 4EYHB 1H1TA 4FKBA 3SZRA 5A0VA 5J4HA 2QN8A 4OEHA 4IGKA 2Q5OA 3EIQA 2GD2A 2JIQA 5CJ7A 1OT3A 4ZYTA 4NF2A 1TK5A 3GT7A 4KXXA 4YJGB 3RD5A 2ROQA 2EG9A 4NMLA 4P4TA 2C77A 4UHFA 3ICWA 4BO4A 4C0WA 3M5DA 4O08A 4BWGA 1LK7A 3HJGA 1IIBA 2RH9B 3HW8A 2VF8A 5DYWA 4HH3C 1GLVA 1R4NB 4QOJA 4EG4A 1UAGA 1PZXA 4ZKDA 3VZSA 1TUBB 4D98A 2NYVA 3CN7A 4RQMA 4YJHA 4ZA2A 4N0MA 3PL5A 1L7DA 4KSCA 1R9NA 4M46A 2AJQA 4C07A 5JVDA 4R0NA 2BTOA 3UANA 3NVKI 3UAZA 1U8FO 5CDFA 2ECOA 3LV8A 4WXPA 4CM9D 1ZFNA 2NVUB 1V3VA 3BHNA 4OK6A 1CQWA 3VVLA 1OGYA 1EAYA 1PKXA 3CRZA 4HX2A 4EEKA 1QBGA 1TCAA 2C5FA 4FZVA 1HX7A 3RSOA 1RQRA 2XZOA 2OO7A 1XEXA 1F2TB 3FGZA 2KP7A 3KSBC 3C16C 3EGVA 4OX9Y 5I9BA 3SZ3A 3AUUA 3WAJA 2IDZA 2HMVA 3GNLA 5AOVA 4BTLA 2WUVA 3QVLA 2IWHA 2O19A 4CW7A 1TMOA 3LKVA 4Z0HO 3HRHA 3E4CA 3D8SA 4QW9A 1HURA 4BFCA 4M9JA 4BVGA 4KK4A 1U2EA 1P62B 3URKA 4G3XA 1YQGA 4QXOA 1M75A 4PICA 1Q14A 4KMRA 4ND7A 3MTGA 2QPOA 3LE8A 2XTJA 2YIVX 1KDOA 2B8WA 5C53B 2OLKA 1EA5A 2HVIA 1LQ2A 3IUNA 4ZOLB 4ISCA 5HEKA 4XIFA 1CP3A 1EE9A 3OLYA 4XD2A 2R8KA 3MAGA 4P5PA 2UVWA 4WEQA 5GVRA 5F7ZA 4P4GA 3I2YX 3SYKA 5L53A 2XNHA 4CKWA 4MVCA 4BXOB 4YAJA 1ZO8A 1FMJA 2JLUA 3H9UA 1GD1O 1XJWA 2LGJA 1F51E 1QMGA 3VOAA 1DAKA 1PTJA 3U2QA 1YFLA 3E15A 3TDNA 2G06A 4Q3DA 1SKUA 3PTLA 1NPTO 8LDHA 1BHO1 2CYCA 1RPLA 1TLLA 3K0FA 3CNNA 3TSOA 8ICAA 2GCEA 3QPAA 2FKAA 5DNUA 3RK0A 3RYTC 2CK3A 1W5SA 2JGLA 4KDRA 2ARKA 2P9CA 1ZRNA 4X8OA 4GPEA 2RGCA 1MRZA 2B7CA 5LMZA 3DL0A 4C6TA 3C3AA 3FDZA 3KVOA 4MP8A 4B8ZA 3ONNA 3HWX1 4D99A 1CUHA 2PGJA 4RZSA 5TMBA 3IP4B 4D3FA 1JGTA 3MZ0A 2GI4A 1Z8FA 1E89A 1A9OA 1M34A 3OTIA 4B3XA 4NARA 1WL8A 3LPDA 2CXQA 4DCOA 4XSVA 1SVWA 1FFEA 2WE7A 3NR2A 2X3FA 1OI7A 3AQIA 4TN5A 4BVJA 4YY3B 2R8OA 5HDBB 3UJ8A 2P4QA 4EYIB 3JPRA 5MGNA 2IYOA 5HTKA 1IY0A 4HZGA 5AJZA 2VWGA 3I8OA 1P2VA 1WHTA 4OJLA 1OILA 1W0JD 3M6AA 2PLNA 3PGKA 4IUBS 2W70A 2OE2A 2QAGB 2FWIA 2ZT5A 4A5OA 2CJYA 3HB9A 1AKMA 4D4HA 1GDDA 3L01A 4M76B 1BCSB 1PN3A 5J3JA 1N9GA 1TZJA 1SV0A 1HC7A 4TKUB 2KI5A 2K4EA 2I9KA 2WHRA 3NP9A 2MSKA 1GEEA 1ZNYA 3QU5A 4D0RA 1VKHA 3VU0A 2IEGA 5BSGA 1YT3A 2NRTA 4BGDA 3VOTA 4W9NA 2II6A 3L6UA 5JZVA 1ZR4A 1N0UA 4AZ3B 3H0RB 3V6HA 5BSUA 3I53A 5IIKA 1RYMA 5EIXA 3OEHD 5AI5A 4NH0A 3ACCA 4UEOA 1NV9A 4Y6QA 2BZFA 3EIOA 2R85A 3ZWCA 3DLCA 3ESBA 4FK8A 1V2GA 2HNBA 2I6XA 4RY9A 2X8JA 3L05A 2R1VB 3OF2A 2AI3A 4BV3A 3Q3GE 3EWSA 2CJPA 1EIZA 4HXFB 2C92A 4MWOA 1WF3A 2MHCA 3KCNA 5KX5B 2GLUA 5ALVA 3MMXA 3WU2U 1SOMA 4JI4B 3EPGA 3C6YA 5ADVA 2GK6A 1YU9A 4I55A 4U7DA 3VQTA 1A77A 1YOBA 1ZVJA 5EUQB 4E12A 4E0BA 4ZCSA 3MPOA 2O4UX 2BGMA 3AOEC 1LC3A 2UUOA 2Q3LA 4XB1A 3RUHA 3HCBA 1RYRA 2BZ0A 3ZY5A 3DC7A 2QKQA 2DUJA 4WT7A 4UM8B 4L95C 3I72A 3TSWA 2W4IA 4X44A 3THOA 2F8MA 4XDZA 4WESB 1UM9A 3VPGA 4WZAE 3FZEA 2E87A 1LI4A 1JEYB 3KPJA 2NU8B 2XA1A 4YP9A 5BWMA 4O3OA 1X9GA 2REOA 5ENZA 4AAYA 4P3KA 2HBMA 3AEYA 3RJ9A 4OGWA 5EQDA 2VP3A 2OFWA 1F2VA 3HLKA 5AO9A 4O2AA 3PF8A 4YDQA 2VAXA 1V11A 3HB4X 5BUSA 2B4RO 3JWJA 3F3KA 4CQMD 1YULA 3O9MA 3G2NA 4LECA 4MFFA 1YR1A 2W2NA 3TEFA 3BFJA 2GXUA 2P35A 5J0TA 4PZ0A 1SCIA 2HFKA 1E2KA 3DH0A 3QOYA 3PQCA 1H3NA 3PIIA 4MSUA 4XLLA 3PT9A 3R7NA 4JCOA 2W42A 4NOJA 4D25A 2EQ5A 4WW0A 2EZ8A 3OTWA 4QELA 1KFTA 4U7JA 1X0XA 1GFSA 4EX7A 4RDCA 5ED4A 5J2UF 4MCJA 2G88A 1E61A 1GG8A 3PW4A 2DULA 2VNAA 1G8HA 2PQ6A 3RS5A 2ATEA 3GCGA 3M6UA 1VLBA 1F4VA 1OB5A 1E1CB 3RRHA 1IUKA 5K0LA 2M2IA 2JJ1A 2B5OA 3IAXA 3BQ7A 4ND1A 5BYKA 1I5OA 2AJDA 2NZUG 4AKSA 2EGGA 4XIYA 1LK5A 2P2NA 1UPHA 4L9AA 3TZQA 3BAFA 1C0EA 3PX2A 5LZ5A 3TIVA 1Z17A 4ZDIA 4R6WA 1Z6TA 3IP8A 3P9KA 4HYEA 4M99A 1DXOA 2KE7A 4HB3A 2YW9A 2OZKA 4P9NA 3UYKA 5BSTA 1ZCZA 3LZDA 3LUDA 2E9SA 4YNBA 5HKLA 3D6FA 3VZQA 3C8DA 3CWQA 3VVBA 2LUOA 3P9ZA 2W4QA 3G7UA 4I2HA 1I9GA 1IBSA 4B17A 3FTDA 2VP2A 3OBIA 1FYFA 1KIAA 3KHLA 4WLFA 2XECA 2DPHA 1BVHA 4B3DA 5M2QA 1FQWA 3CUKA 1SNYA 4EF4A 4A5SA 1EIWA 2PUDA 1H6AA 2DB3A 1NF8A 2AHRA 2VFAA 5GONB 4FC7A 2NQTA 5EJ7A 4FMCF 3DVAA 4B7AA 2OO3A 2ZU6A 2CNDA 3RE1A 2HXGA 2PZEA 4AB1A 3GCXA 1U0EA 4NQRA 5ELLA 3B78A 3R7BA 1YDFA 5JASA 1S01A 2Y1OA 3D8NA 1GJRA 3D3NA 3MCAA 3ENZA 5F73A 3F97A 3SLRA 4MUYA 1JEQB 1E69A 5EWLB 1VC2A 3BQMB 3L9XA 3OQBA 1OYWA 1EWKA 3MLBA 3GLUA 3GRFA 5DHUA 3CX4A 2FSHA 4X6YA 4RVHA 4MEJA 3I2FA 1J2YA 3ZGOA 4OM8A 2EFHB 4M04A 2GM4A 1TRKA 3RKRA 3LCVB 4UEWA 5GPBA 7ICIA 4XX0A 3RWMB 1LNSA 2IYXA 9ICQA 8ICLA 4HC4A 4Q19A 3OY2A 2IY8A 1I3OA 3GD5A 3PSAA 1WW3A 4HS4A 4K3UA 3G1UA 1CR2A 3SBEA 1EUQA 3DFKA 3SKYA 1VPTA 4B3TB 4BJQA 1MNAA 1LV8A 3EVBA 3ZHUA 1JAZA 5AXAA 3WHPA 1MTOA 2GNAA 3NBAA 5DTIA 3E9QA 4JP8A 5F3WB 4PINA 4DS4A 4MVJD 3FHOA 4KSYA 8ICBA 2ATLA 1JHAA 2ID7A 1C3OB 4Z53A 1CKEA 1KBQA 1ECBA 2MUTA 4Y0NA 1E4EA 5E1BA 3K4PA 3GUUA 3NBKA 3ABRB 2O07A 4IXMA 3QY9A 4M22A 1E6UA 4O4IA 2Y67A 5E9AA 2HH9A 1V8BA 4LYEA 3P9NA 2NZJA 3OC6A 1WWUA 3F67A 3TW4A 1NM5A 2E6UX 1V8PA 1V45E 2EZ4A 1KC3A 4CMBA 3T9DA 5J58A 1UBOS 5A7FA 1EX6A 4LYJA 1BHSA 4BNVA 4J07A 5CTJA 4ZO6A 4N5LA 4HNGA 3ISCA 3G0OA 3DMYA 4QXQA 4IQ8A 3W05A 1W5BA 1JDBC 3GMDA 1P5JA 1W59A 1JB1A 1BXRB 3M6KA 4CCYB 4I9FA 3D1VA 1N56A 3TMAA 4JI0B 4RDXA 4TL6A 1B23P 4P2BA 5KYWA 5KT6A 4CG2A 4EJ6A 3KOWA 2BBOA 2DETA 5KVCA 3O7WA 2WYHA 2BLNA 2ZETA 3C1TA 2ZRKA 2FW0A 1MR3F 1UDXA 1Y8QB 3H0MB 4KQXA 1RRFA 4WZBA 2DT8A 3EXIA 5L40A 3PO4A 1ZGAA 1B3RA 2EDCA 3A4TA 1RXEA 3SYLA 4RD2A 5K0ZA 5FLYA 8ICRA 7AT1A 1L4FA 4U4AA 3OMLA 5LXTB 3S5UA 5KSWB 1YBAA 1T2EA 3WGNA 1NOJA 4EI9A 3I6YA 2H1LA 3HB7A 4ESEA 4G1VA 3ITEA 3KB8A 1S2MA 4DTIA 4DDKA 3M6XA 1K9SA 2I9GA 3RU2A 3TLZA 1RLJA 2QR3A 4WCDA 3N8NA 4LISA 4Q7MB 5HM8A 2QMHA 4D3ZA 2GZAA 4BMSA 1GZHB 2HNAA 4OXKA 5IC6A 3ZDXB 1A8IA 3DFZA 2O3SA 2VDUE 4WCFC 3GY0A 4W63A 4YLEA 5F33A 3OZ7A 1C0KA 2FPPB 5IDYA 5L1MA 4QFMA 2IEAA 2FSVA 5JCJD 2MCFA 1RRGA 5CB4B 2ZKLA 5EMKA 4PZOA 1N0IA 2ZE5A 2O54A 1YUNA 4C43A 2I4OA 3EFOA 5F1PA 2IX9A 3J81A 1GPYA 3J81j 4REQA 5AK3A 1U4NA 1KPHA 4F84A 1Z47A 5DHRA 4UXIA 3H5VA 3SHQA 2VF5X 3OIFA 3A1NA 2P4HX 3BWXA 2BGTA 3SF8B 3TAUA 4CLOB 1ADJA 3B6JA 5F2EA 3K92A 4O4LB 1PZGA 1XMVA 5LDHA 2ILVA 3F90A 5JUWA 9ICSA 1X8JA 4WGFA 2ZWIA 1KNQA 2OZLA 4JV5B 3F73A 3B7GA 2WJ3A 5A9SA 2JLBA 4LVOA 1GRQA 4D4JA 3ASZA 1D6NA 1F6BA 2ZRFA 3GIMA 4RL4A 1DFGA 1L5WA 1PL0A 3AI3A 2IXDA 4I28A 4B74A 5TT1A 4LF6B 1WG8A 2J85A 4RF4A 5LBUA 3GGOA 1G64A 4O1MA 3KD3A 1JPNA 1S9DA 5HQ3B 4HDMA 1OFTA 2F59A 3JD1A 1OA1A 3CUWA 1I5RA 4R9NA 3HY3A 5CYPA 4KLHA 3PNYA 1AGPA 1V4NA 4DGSA 2ECPA 4JSRA 3JYOA 2C4VA 5IIOA 4QUBA 1J07A 3JPPA 3ZCTA 3MDCA 3MFHA 1IXZA 1F2UA 4OHWA 1N0HA 4GX2A 4U00A 1JTFA 2OQIA 2YMQA 1B2RA 1VLHA 5TGTA 3IS3A 2WIBA 2FU5C 2PZGA 3MR2A 4ZQFA 2LW7A 5FTMA 4ZYYA 4X00A 1QH9A 5E3IA 3LX8A 1CV2A 3I8XA 3SYTA 5T3UA 2HPZA 2HSJA 5G4LA 1Y5MA 4AJ2A 1A4IA 1UCVA 4H1UA 1O54A 1U8YA 4FMDB 3LW7A 2KVCA 3P4YA 4DJDC 2GJAA 2C7VA 4B45A 2DU8A 5BNFA 2VUUA 3KLBA 3RT9A 4EHDA 1GCAA 1X1EA 5EHGA 2W9BA 3PNQA 2GBLA 5CBPB 1AZWA 2C1XA 4UTOA 3R6LA 1YKGA 4JJ7A 4AJPA 1WEKA 4UBLA 4K9OA 4UB2A 3PGJA 3Q5DA 5A9TA 1TCVA 3OQVA 4NEQA 2P41A 3AF4A 1RWVA 2FPLA 4QGAA 2EAPA 3GLTA 4X6UA 4TL8A 3ZHVA 5AHKA 2R4UA 2VJAA 1ONBA 1YQUA 2CHGA 4CM3A 2QZ9A 2LDXA 1RYDA 1SOAA 2RHMA 3AR4A 3R0JA 1U2DC 4NU0A 1QUEA 3D2QA 3TYXA 3DCNA 3PDJA 1QTRA 1NR7A 1E98A 2FSFA 1S2NA 2Z09A 3M1IA 1EP2B 3GGDA 3I28A 4XUEA 2NUTB 4OJQA 1W2HA 1LS6A 1T8EA 3T61A 1Y0BA 5TSDA 1VCIA 3NTQA 4HQRA 4KB5A 4B3JA 3FYUC 4ZFNA 4PLGA 1SAYA 1XWIA 3LS2A 1P7YA 1GPNA 1G4AE 3AHCA 3EC2A 3GV8B 3T52A 3AXTA 1YCHA 4WBNF 4FR2A 2YQ5A 5HWSA 3SC4A 2JLZA 3AVQA 2JFQA 3OZXA 2GRAA 5JAMA 1MOZA 4PAWA 1T6YA 3KEGA 1CW2B 2A9KA 4F8RA 3FYCA 1MABA 1DRJA 4MPTA 5C18A 2E48A 3O4IA 4R0MA 4DFPA 3NGDA 3GLHB 3VO2A 1WUTA 2HGSA 1X13A 2ZBFA 1RJ9A 1MXHA 4W5OA 3I58A 3TGLA 4F56A 5DYTA 1NKEA 4BQRA 3FUTA 4ZHSA 2Y1IA 3ANMA 1UWVA 4LV8B 2R6FA 5FCDA 1KXJA 3TI9A 1T5DX 2EJBA 2E5WA 4B3RB 1E8MA 2W90A 2XKAA 5AVJA 5CH5A 3BMCB 3FNGA 1R0RE 4DR1B 4EB3A 1DO0A 4U9UA 5CITA 3MF4A 4HWTA 3Q3JB 2WT9A 4RY0A 4OXIA 3O3MB 4BAGA 4CKEB 2BTQA 1JALA 2FETA 2AC4A 5FPTA 3GRAA 2ZUUA 3UMCA 1E0KA 3TL6A 2F3UA 3I0ZA 5LZ8A 4LHYA 5H5JA 1X80B 9ICWA 3AL0B 2YMPA 5C8ZA 4PIPA 2W3SA 2JDID 5C8YA 3NBZC 5TV2A 1TQDA 1VHTA 3H5WA 3L7DA 1JJ7A 1SU4A 3SBXA 1OUQA 1VL0A 2GAJA 1C1DA 1JW9B 3G5LA 1VE5A 4ZCLA 4LV6A 3GMTA 2QRHA 4BGEA 2JB9A 5FBWB 4JQCA 3SSNA 2VJKA 1NUPA 1DU4A 1KL7A 1XZAA 2VPIA 2AQ0A 1AZSC 5D1NA 3X2SA 3TOSA 4A16A 4JLBA 3KQMA 3REQA 1B0XA 1PVQA 1P0QA 1W8DA 1TF5A 2WI8A 3N2KA 4J0GA 4PRYA 3QVGA 4E11A 4GOMD 3R6DA 5LOVB 2JATA 3ADBA 3D2BA 4KQ1A 1RE0A 3DULA 3C3JA 5ESRA 2BMVA 2OCBA 2JGKA 3AR2A 4U63A 2O0KA 3C15C 2KLHA 4B7CA 3AHEA 1MO4A 2QS9A 3CUVA 4UQGA 1YA8A 3AB8A 5CU7A 1ODCA 5DM60 2AJLI 1ZQMA 1PBNA 1E7WA 2ZBPA 4BNDB 1Q22A 4FZNA 4GI5A 3CNOA 4JWMA 1ECLA 3TDMA 4NPAA 1LF5A 4GI2A 3Q15C 1NHGA 5EE0A 3HP6A 3GD7A 2QQFA 4N54A 3LWNA 2LDBA 1XF9A 2JD2A 4KPYA 4C0ZA 2XE6A 1SUEA 4PGAA 1NVTA 3LUFA 3BRCA 1PGNA 3K5IA 4GLXA 4AZSA 4RQ4A 1C80A 1Z4MA 3UAYA 1K6IA 1P1RA 1NWCA 3DHNA 3OFNA 2WV7A 1A9TA 3P0FA 2ZB8A 1P4AA 3DEFA 2AOUA 2IHUA 1C1XB 3ZLVA 2XUIA 1XKTA 1Z19A 2F3PA 2VNKA 4BYGA 2HIHA 3NBMA 2ETXA 4KLSA 5CVEA 3KAPA 3BEOA 2PL3A 2HLDD 4RIGA 2CZGA 3PV0A 3AP2A 1EM8A 2OWDA 2Z8XA 2CWDA 2G3YA 2GVZC 3EEFA 1L3BA 3CSUA 3HNRA 4DR4B 1ZMXA 2V7BA 5K01A 4XWWA 1VG9B 4EJSA 1GKUB 4X8LA 2ZRLA 1OI2A 2VRCD 4C08A 2MAXA 1DEOA 2OORA 3NTOA 1QYIA 3I8SA 1QB8A 4B9SA 1ED1A 4GPTA 1WW8A 5BSRA 3EUEA 1KO1A 1RAEA 1DSSG 3MC1A 1XQ9A 1IRXA 3UIEA 5CJPA 4B48A 2IFTA 3HBJA 4NOMA 1HT3A 4U6QA 4X1IB 2RGUA 2BI4A 1A7JA 2XKJE 4MIEA 3O84A 4MA0A 4MKHA 5HK8A 1IEVA 2P9GA 1I0ZA 1VJTA 2XKBA 4L4UA 2XUZA 2FFBA 1QIGA 3ZWBA 5JXGA 1HPLA 2CW5A 4URYR 4MOWA 5CCXA 2HCRA 1T8TA 3EDYA 2PJRA 3TOCA 3H2GA 7ICGA 5CFPA 2XOKA 3K73O 2QJFA 4Q4HB 3TQSA 3EVNA 3DV0B 4Q4DA 1DK2A 4XUCA 4LFCB 1D6MA 1NNUA 3QV2A 1JR2A 4WWHA 2WF7A 2CLIB 4L7QA 2IZ6A 1RFGE 4FJ1A 2X5XA 2AEJA 1EFKA 2IPXA 6ADHA 3HMQA 2ZIXA 4KGXA 2MOKA 4KX5A 1K7XB 4B75A 5JADA 3DLPX 4WY8A 3HZZA 3TG8A 3RUFA 3KYCB 2VHEA 3TF5A 1AOXA 4PSUA 1ZESA 4BNKA 4MR7A 4X8MA 5CA0F 5IUJC 3S6JA 5MN6A 3E7PA 1D2RA 2EQBA 5T4EA 5EXTA 1D2MA 5CM9C 4HNQA 1ZQQA 1S3IA 1IXRC 3I0MA 1ONNA 4C2UA 4JI6B 3ZS9A 4XTRA 2R5WA 3OP4A 4WOCA 3H2YA 2BMEA 4JNCA 4QBTA 4E7OA 3JYQA 2D00A 2H57A 5H59A 2W83A 1XSPA 1D1SA 5BN1A 1M2VA 4RVOA 4M1YA 1X9XA 3PZBA 2QTGA 4IQ0A 2IKSA 5LQAA 4E15A 4LVUA 5DDMA 2RH4A 2HBLA 1OI4A 4JB2A 1Q8KA 2VHXA 3TLGA 1W5FA 4B4UA 3PIDA 3AEUA 2OGTA 3MUFA 3ZLBA 3ROZA 3BILA 4MYUA 3AFOA 2GN8A 3CXUA 4KLIA 4AY2A 1P0MA 2IXFA 3BS5B 3RS2A 2WDZA 4DOMA 2EWMA 3PUYA 2HWWA 3K20A 3NU1A 3H1PA 4X3CA 1C9JA 5K3BA 2J3QA 4NXZA 2W5UA 2H1IA 2C98A 2EP5A 3O1HB 5KMGB 2HSEA 1AQUA 1E20A 2UZ3A 2BLLA 5AESA 2MRLA 1K7EB 4PHTA 3A31A 4DUZB 4OL9A 1ONSA 2K8BB 1Z4IA 3F4KA 5EXDA 4QWWA 3UMFA 3AJAA 3QITA 5M34A 1NMQA 2EBWA 2VA3A 3LZCA 5L6MB 1JLHA 5A4IS 4UUMA 5K2MA 1RS0A 1DK3A 1N1EA 5HZMA 2UZ0A 4KVAA 1EYZA 4KN5A 3IMGA 4D8VA 2C3UA 4B44A 1CRZA 1E2PA 5ERGB 3X2FA 4RFSA 3PE6A 4KTVE 2QT1A 5BN4A 1T5BA 4LY9A 1RHRA 1VKRA 1UKZA 4DR3B 1L7PA 4HN9A 3A27A 3EHEA 1TGVA 3NV7A 2Q29A 2O8FB 1XT6A 3F3SA 2Q46A 5FIUA 2DKXA 4TMFA 3AF2A 2ZJ4A 3HVIA 1M1YA 2Q6IA 3I64A 4MAAA 4TSFA 1ZA1A 3NBXX 4U7TB 1S9HA 4U3JA 3CMMA 3S7ZA 5AK6A 4KK3A 4U2EA 3TBKA 2BKUA 1ISRA 4F5WA 2VSXA 4JI1B 4DDUA 1D09A 3U3OA 3BRQA 2HIMA 1AHHA 1H6CA 4OAPA 3DLHA 5EHXA 4IJ6A 1MVNA 3OU7A 1YDWA 1SQFA 2CNKA 2EGUA 1L7NA 1JROA 1Q21A 3MW8A 4E03A 4UBJA 5KFGA 2IW3A 3DMNA 4XQEA 3I42A 3A6EA 1JDNA 3H65A 1DO8A 1GADO 4ZV7A 3HXTA 3PDUA 3KE9A 3NC0C 1THZA 1SA0B 3UHFA 3LY8A 3TECE 3TAXA 3HPQA 4IS3A 3F9RA 4CMKA 1L6RA 2A1TR 4F4HA 3OPYB 2ORIA 2WZCA 2JBAB 2HEIA 4FSHA 3EWIA 3H5NA 1DXQA 4RYLA 1RWNA 1XQ6A 2PGOA 2RQ5A 3PNKA 2BE9A 5LQMA 4KLCA 4IL6U 2GHQA 4QJ3A 2FJ6A 4X7BA 3GUVA 3CE6A 4NYIR 2OHHA 4G0XA 2H16A 2KNJA 3A6JA 1TOAA 4R71A 4MEAA 4XOIA 3KKQA 3FPSA 4J9QA 2NIPA 2JGMA 1P7VA 1G8MA 4XCVA 4MO2A 4JJKA 1CNMA 3AM1A 1CVRA 3HABA 4OJMX 2AB0A 4MI6A 3AGPA 1Y8RA 3I37X 3LUJA 4RD0A 3GGCA 3QF7A 4OQQA 4TUYF 2IYFA 3E8XA 1EK0A 4W7HA 1QIMA 1MB3A 2D0DA 4QDTA 3B3GA 3FSGA 2DPYA 1O3YA 3K1RB 3SEIA 2H8KA 4YRDA 5FA6A 1SL1A 5A3QA 5C35A 2A7XA 2G70A 3VR3D 2YZMA 2GF9A 4OUDB 5CLIA 3TTVA 2ISOA 4HLDA 2JH3A 1VE9A 3FG9A 4A8JC 1SKBA 2CZCA 2V9CA 3SC3A 4NFLA 1NW7A 5L3QA 3FNBA 3QWHA 4KXUA 4XEUA 4HUTA 3SXPA 4C7YA 1WKCA 3T8YA 5A62A 2PANA 5DMXA 5GTIU 3DL4A 4BFYA 1PGQA 3R74A 5H0IA 4ENTA 1JHYA 3EMBA 1WUKS 5DISB 5F7XA 3A1EA 3W5VA 4GF5A 4L72A 1XRJA 2HA0A 3VR4A 1XI2A 5AHOA 3QMVA 4ZH4A 1NJGA 4QHSA 2FFAA 2J3MA 2FN4A 1ZM4A 2HLNA 5F35A 3KLPX 3VSBA 4GYYA 5I8WA 3EFHA 1NW3A 4C4TA 2DECA 4L3VA 3WIVA 2W00A 1Z8DA 3K0AA 2L19A 4MTLA 1R6DA 1ACMA 2BFNA 3H86A 4H7EA 2IKQA 5EKXA 1MN8A 5HF5A 4CM8A 5C5EA 4P7KA 2YCLA 2XB2A 1MIOB 4N0QA 1XCBA 1EKXA 1QANA 5DNAA 3LUHA 3P2JA 2ZGVA 1N7HA 5AKZA 3TANA 3TLYA 2PT7A 3Q9UA 5HKAA 4IXDA 2Q3CA 1E3IA 4I6EA 4GYWA 5WRFA 2IUUA 3N6VA 3BMOA 1DQPA 1WMEA 1QSLA 1LRLA 5DRTA 1RP7A 3UG6A 4N0DA 2BM0A 4HYQA 4QTZA 4D92A 2YRXA 1BX1A 1Y1KE 4Z8YA 4H60A 3GROA 4C8NA 5EERA 1QFSA 4JLUA 4HBGA 3TD9A 3TR6A 3W9SA 5CB1A 2W2TA 4HOYA 3PC2A 1ZQJA 1F6DA 4QC2A 3IT3A 1DLIA 3UK7A 4LOHA 5DIZA 4WFIA 3ZE6A 4CMIB 2ODWA 3B1WA 3O8NA 3JAMA 4WKOA 1ZMOA 1Z35A 3GFQA 4HGPA 1MX3A 1X7YA 4L8YA 3WGVA 1II8B 2ASDA 2H59A 4V24A 2CPRA 4GU5A 3RR7A 3LQKA 5JWRA 2F4VB 1K2VN 2XKKA 4F71A 3DM9B 3ZWDA 4J43A 1Y4UA 3WYAA 2MYPA 1G63A 3PQ4A 1G8FA 1G6HA 1RQ2A 4UB4A 2IEBA 4EHJA 2P6PA 2IYNA 4AXBA 1YDMA 3PUZA 1APBA 1Q1EA 4JI8B 4NG5A 1FIUA 1YHYA 2BM9A 3TNDA 4BB5A 1O8CA 3T7CA 2BFEB 3BJMA 4S1TA 5E6RB 1JP7A 4LRQA 2XOXA 1XTZA 2P68A 1NG1A 4IKEA 3FR8A 2DLCX 1AD2A 1ISHA 3WLHA 1QRRA 3V00A 3NHSA 5JZ9A 2FLVA 1FLDA 5DT9A 5F23A 3V72A 1N2CA 4MS3A 1X1RA 1TKAA 2WF9A 1JMVA 2ZUBA 1S10A 3QMWA 1FDUA 3ASUA 3G0GA 4GM0A 1CUBA 5KU7A 1PT6A 4FQ5A 2PKQO 3A3KA 1A8QA 4KAAA 6ABPA 1MGPA 4HSGA 2IE0A 1QX3A 1JFRA 3H9JA 4X91A 3VR6A 4KQ9A 4XD7A 2AJBA 4ALJA 4XGKA 2GKOA 4GUAA 1XEWX 4I8IA 2OM6A 1SXIA 2F1JA 4LX8A 4LGYA 2DKOA 4OSPA 2VWPA 3V8PA 2DEUA 1KYZA 3ESXA 4PS1A 3PVXA 2O8NA 2MSNA 3OA0A 3GFSA 5D3QA 1R4MB 4X71A 4AKEA 1YBMA 2W98A 5JRTA 4FP9A 1UOEA 1EQ2A 2J5KA 1B0PA 5LQDA 2CLHB 2Z3VA 1U98A 5FQOA 1XLUA 4INJA 2I99A 4F38A 3NBQA 4RUAA 3SQWA 3TAPA 2Q5IA 4XDHA 1SVSA 4IDQA 1HE8B 4M1QA 4TT8A 1YUBA 4GLLA 4BLTA 1QC5B 3SS7X 3M5PA 3ZN2A 1G55A 2JIPA 5FH9A 1RMQA 2DSTA 1D04A 1XDGA 1X3SA 1IN5A 1BU8A 5ADWA 2EOAA 3U7FB 3T34A 1XRPA 4RAQA 4XIJA 3IURA 1N6OA 4W1RA 3VPCA 4I08A 4F2HA 2WZDA 1YA4A 5E6UA 3ZQ6A 5EGNA 3UXNA 3I1FA 1UODA 5JSZA 1NYTA 3PUIA 1LSSA 1ZR2A 3NDJA 2P62A 3WWOA 3HKEB 5DTEA 2X8WA 3BTUA 3IOYA 4G5RA 1BPZA 1Z12A 3CSDA 3M1AA 4TQUS 1B1CA 1ES9A 1NG9A 2XTMA 3LWDA 5BSVA 2BCQA 1GO3F 2EJTA 1E9VA 2XWJI 1ISMA 3TJMA 3NZEA 1GYQA 2G4LA 5H02A 2O3JA 1RXYA 3MJVA 1SMKA 1VGVA 4FHFA 1K66A 2QD1A 2V6GA 1TYDE 4UMDA 2JJ2D 1OFIA 4IGAA 4C4RA 1N1DA 5CJJA 1NXTA 4HG2A 2FUKA 1PK7A 1M6YA 4X1KB 4PHHA 3NYIA 3C70A 3EQ9A 5ICCA 5ILOA 4AI6A 1J7JA 3DDCA 1Y34E 5FUXA 3CE9A 4TWAA 4CL0A 3NTRA 3ZVNA 5IHXA 2Q3DA 2QBYA 5JTIA 3CH4B 4M1KA 3O0TA 3B38A 1J39A 1HM5A 1KE1A 3RVDA 4RLHA 1CZNA 2ZDHA 1DIHA 3OCXA 1O6ZA 4PBRA 4EYQA 4P4MA 1ZD9A 3U1BA 1SWWA 1GU0A 3RIGA 1I4LD 1BQEA 3TB6A 2OECA 4MCIA 3O83A 3RABA 1ICIA 4AYBF 1IBCA 1FP2A 5L7YA 2Z2YA 4JHLA 5K0NA 2QORA 3KFLA 3IAUA 4HTAA 4D43A 4IOKA 2FRXA 1GTG1 4MWCA 1EH5A 2BFAA 5IULC 3NM5A 1U1IA 1DKNA 1H8HD 4P22A 3UK2A 2R751 4TYQA 2D2EA 5REQB 4C7VA 2XMPA 1S6YA 4RH0A 3GVHA 3H0CA 2Y1JA 4OA5A 4NZPA 2RGAA 1VMKA 2O8EA 4MJLA 9GPBA 2JJQA 4H08A 2WD9A 4FOOA 2P40A 3PSHA 2F43B 1RW4A 4UUPA 1ZRSA 4OO3A 2GKGA 2JJMA 4HMPA 2RIPA 3GLGB 2RI0A 1X86B 2ZAIA 5JMTA 3AR5A 4ZALA 3WRWA 4B4DA 3L04A 4ALMA 4M53A 1RQPA 1GQFA 2RH8A 4PLYA 2DQYA 3CYMA 3O93A 3OD1A 2AZXA 3OE7D 4ZHQF 1O87A 2HEGA 3OZVA 2PZLA 1W1WA 3DOIA 5LB2A 1H4SA 4M83A 2EP7A 2E1RA 2POCA 3NX4A 5HS4A 2I54A 1PZNA 1YRHA 3Q2OA 4PANA 4P4SB 5L95A 3K5PA 5ALMA 2I1WA 4LMRA 4GAEA 5DLGA 4LVSA 5IK2D 1CYEA 3PNCA 3ZXIA 3SFVA 4C05A 1GGFA 3GEEA 8ICWA 4GC7A 1HDZA 1AXRA 1EEXB 1VJ0A 4OXYA 1EUYA 2HWYA 1NRIA 5CDSA 4RYDA 1RKUA 1JJBA 5JDCC 3I2HA 3L0CA 3E3MA 4TWZA 3JPTA 3OM0A 2WIDA 3DZHA 2GH1A 4Z49A 1R0BA 2CD9A 3EULA 3JVUA 5CXXA 3T7DA 1CR6A 1DAHA 2UZ4A 2XB6A 4DQSA 3RWBA 4HYTA 3Q6IA 3OLXA 3O73A 4UTNA 3GT0A 2ERCA 3NHMA 2XZPA 2EBFX 5KS2A 4OHZA 2FLNA 2EJCA 4WBNA 3TO5A 3VC2A 3E3LA 1ZBDA 1EFPA 1G291 3UB4A 1YCDA 3F9CA 2EARA 1EHYA 1T3LA 4L15A 4NU5A 1U5CA 3ENNA 4DL9A 2ZI9A 4J0FA 5F9MA 1H0HA 2Z8YA 2EJVA 2PAAA 2Y77A 3WL6A 1FXWA 3A58B 2XTAA 1O1YA 4ZAGA 4E5SA 5IAGA 1J42A 4HXGA 4JN6B 5AW5A 2Q6VA 4JYCA 3G5MA 4KSBA 1WUJS 3PXGA 1FO4A 1KI7A 3SE0A 1M67A 3RBAA 1O6GA 3L2OB 5KFUA 1K1SA 3SI8A 4C78A 3MWJA 4OSEA 1DC4A 1ZC4A 3IUJA 1S4QA 4XYGA 2XTZA 2ZAGA 2XXAA 4W6ZA 3B8EA 4EPVA 4R51A 1VL2A 2QQ0A 3QQ5A 5TJHA 4XM2A 4YUZA 3SJAA 1FFYA 2CLFB 4MRPA 3NTUA 3RC9A 3L6CA 3OPYI 4QAJA 1RYSA 1Z5GA 3VKUA 5KFNA 2R25B 4REMA 1VZ3A 2VIXA 4NMHA 4JZKA 5K99A 4RMGA 3SI7A 4S04A 3Q1KA 3IA2A 4LJ6A 4FS2A 1KRPA 5GGXA 4MQLA 3OAAD 1NRJB 3Q5GA 2ZSUA 1FFVA 3C7CB 1M0TA 4RHTA 3I5YA 2MTBA 5G53C 4PZNA 3UV7A 4BP8A 2J7PD 1RR6A 3CR3C 2Y0PA 2GLTA 3FLMA 2ZRGA 1X8XA 4OD0A 2JNWA 5KNIA 4L4RA 5DN9A 1MC8A 5IF9A 4CTMA 3ZV4A 2Q3JA 4PRZA 5C81A 1X42A 1IG3A 3A6LA 2ZJBA 1RBZA 1T9CA 2C3YA 1I2MA 3CN9A 1V8ZA 1EDEA 1II9A 2X1LA 1E32A 4P54A 2UUPA 3V33A 3PQDA 4KQCA 4DIKA 1YJQA 5JD5A 5LQJA 3UK6A 4UEQA 1G66A 4DAOA 5EZYB 4Q7LA 3DAYA 1W0JA 1GRNA 3PA8A 5E7JA 2FX3A 4Y7CA 1UADA 2WU3A 3EGWA 4TV9F 3I4CA 1DJQA 1ZN7A 5DX1A 1U48A 4JC0A 1SUBA 3OT5A 4LMPA 1NXOA 5JNTA 4RULA 3ZZ1A 5BQ5A 4NZNA 3FZYA 2FMTA 1PRYA 2FWRA 2MINA 4ND8B 4PQEA 4C7BA 2YB4A 3LYHA 3D2CA 4RVCA 1R0KA 2OO5A 4E7PA 4NAUA 3ZJVA 2QRNA 4LRXA 2OC4A 3W06A 3COPA 5DI9A 3PD1A 2ZIZA 3L0IB 1BRTA 4MGEA 2YXDA 4AN0A 4H6XA 3TL2A 1TMKA 3R7AA 4Q45A 1VYVA 4YPVA 1VKOA 1B8UA 4G5HA 1Q0RA 1RE1A 2JASA 1NRWA 4MAFA 3C3YA 4NZMA 4I1PA 3TZHA 4QZIA 1R0SA 3AK4A 2HKIA 1R6XA 3MS2A 4V0LA 1UINA 1AQJA 4UHCA 2HX1A 1HZJA 2IBMA 4AX4A 2ALZA 3ZZ0A 4JEMA 4R2IA 1NLYA 3L6BA 1KMQA 3DV2A 1QJCA 2CXOA 2V9PA 4EJ0A 4CL3A 2C2MA 2FB9A 3BFPA 1L4KA 4AZ0B 1TZBA 3NXKA 1CB0A 1G7SA 1EGHA 2V74B 1FFCA 1S96A 3G2OA 2WLSA 3IQDB 1JG4A 1GOTA 4M1ZA 5CT8A 2HU8A 1GZ4A 5HHHA 2Y6UA 2D1FA 2BSQA 1LGYA 2ZXFA 4KMUA 1Q3KA 2W6OA 4ISBA 1B16A 1WOYA 4M0AA 3CG0A 5IN4A 4GOXA 4ZVSA 2Z1MA 2Z2XA 1N7GA 1SBYA 4D3SA 3VH1A 2HD4A 2W2QA 1BXZA 1OH8A 4O4JF 2PD4A 4NYMQ 4RQ2A 1OC4A 5KFXA 4ZAYA 4AO7A 2BEWB 2GXSA 2J4CA 1KDZA 3F1LA 4WE3A 2ZSKA 1ADGA 1NXXA 4ZU1X 1YR6A 4XQGA 3ZGXA 5DB8A 5B12A 1DRGA 4L9WA 3DNPA 2X13A 2X22A 1NBIA 1JYFA 3LPMA 2FSIA 5KTMA 3AUJB 3CRVA 3QUBA 1A69A 2QN2A 4YV1A 4PXSA 1GHTA 3KKAC 1DBSA 2E4ZA 5IHPA 1A7KA 4KH1A 4M37A 5AQ1A 1WD5A 2NZ8A 5CFRA 3QKSA 5JYEA 1OBOA 2IXGA 4P80A 1RBMA 4CIXA 2HREA 2X42A 3QBTA 3HDQA 5DGBA 1U2QA 3BXOA 2A0WA 4GR4A 9ICGA 4GEKA 3CH7A 1Z22A 3CNQS 1NDHA 4U7HA 1QZ3A 5IDVA 3KB1A 1ISPA 4YROA 3VZCA 3UFXB 1AQNA 1ZN2A 1MMFB 1GQYA 3HCOA 2V0CA 2Z4SA 3MCZA 4X1OA 5ECGC 2QTBA 3U7QB 2XYGA 4HAYA 2G1AA 1F3LA 4BJHB 1R9MA 2XW6A 2I7DA 1W88A 3TADC 1JA9A 2J33A 2W4MA 4R7TA 4P3NA 1RXUA 2BT4A 1R9GA 1WUIS 5KFKA 2FGKA 2W6JD 1ZJJA 4YCLA 2R8XA 1XCPA 3RANA 2R1TA 2YOHA 1JQEA 1V9SA 1Y5LA 5EIHA 5BPFA 2EFJA 4A36A 4C0JA 3E9NA 1YJ8A 2JEZA 5ALEA 4JJZA 2P2LA 5H83A 1J5PA 4EA8A 3HA3A 3P9CA 2QB5A 3FI0A 1KZ1A 1DBQA 1R8YA 1NP6A 5T14A 4ND2A 2XDWA 3OIUA 2LR0A 2XCIA 5HFAA 2GBFA 4UVDA 3W4IA 1Q84A 1NVEA 1BS9A 4M9GA 3FHCB 5AW1A 3KXKA 2OZEA 1RHMA 1P0CA 3R9XB 3FFXA 4MV9A 4NTZA 4UEKA 4M9LA 2AG6A 3NOQA 4G8JA 1JEAA 3NEJA 2RGGA 4GBED 1Q1GA 4ENPA 4X62B 3UGQA 2H06A 4DT1B 1FNNA 4Z2YA 1VA4A 5EMLA 5KWIA 2I8LA 3UXPA 3NS1A 3RH5A 3U4IA 5KOIA 4B7ZA 1OOEA 2I87A 4HS9A 4RELA 3WSVA 1CS0A 2ZVDA 4AMGA 1EFLA 4J0JA 3F4LA 4FYVA 3JATA 4FTWA 4O25A 3LK6A 2AUMA 1COZA 3UXEA 1IJFA 4DNOA 4YUAA 4J94A 5AKIA 4F5ZA 3MJCA 3VJRA 2HA6A 1FMCA 2YNMC 2NV0A 3JQ8B 4F60A 4XH9B 3W9UA 2D6FA 5C1OA 4O5EA 3N2ZB 4BATA 3TCNA 5GJVC 3V7FA 3NONA 1W47A 2DZDA 4P31A 3EGOA 3S1AA 3A05A 2P67A 2F2TA 1YDEA 1DINA 3HX0A 3KC2A 1W52X 1HFWA 4L73A 5KHAA 4QDJA 1BPBA 4CDRA 5D3MB 4RVUA 3D6HA 4X3OA 2Y1XA 2ORWA 1TNDA 1T8PA 2BBWA 3IXMA 2WJJA 3OFKA 5KVVA 4TXLA 2DJIA 1M0EA 1K8RA 4HDNB 4N48A 4FSDA 2B4YA 2PX8A 2CRXA 4JEIA 4NXNB 3EH1A 3DZGA 4GSYA 5H9VA 4R31A 4BRUA 1VL6A 4BCBA 3S5JA 1X14A 2V5UA 3ABQB 3LNTA 2BFOA 4F8JA 1OAOC 5EG5A 3IIKA 4EKEA 3JZFA 5EPUA 1C7EA 4UM7A 4C7XA 1T0PA 1J00A 1NXSA 2B4QA 1NK6A 1TU0A 3WYFA 4ZI7B 3RG2A 3U4QA 1U4BA 5AYVA 1UBTS 4RH1A 1UT8A 3AV0B 2AE1A 3ICOA 1FU8A 3ICEA 3RAFC 1ZIYA 2JW5A 1EWVA 2O6LA 4S3MA 1P81A 2XMGA 3B1XA 4EA6A 3EXHB 1EFTA 1PWYE 1Q0QA 2AN3A 2G8NA 3VBEA 2QG9A 3M3HA 3H5IA 1SN7A 1KO7A 4A1OA 3AWIA 3ANNA 4H31A 3NRCA 2C61A 4V0KA 3NBUA 1QG2A 4HBZA 2TS1A 1KSHA 1Z6YA 2ZTUA 4ENVA 4DFMA 1E2GA 3WMXA 4DQXA 3LKBA 3HKZC 2UXDB 3ENQA 1T1JA 1X87A 2JFZA 4JLOA 3STUA 3V8RA 1L5QA 4L22A 3ZTTA 2HRDA 1GSOA 5JH7B 2REXB 4DKJA 4B09A 4Y2SA 1E2BA 1KTVA 3AETA 1E0SA 4TUYA 3RIXA 4CV2A 1DC6A 4O8CA 1Z5UA 2Y2UA 2WYUA 3B60A 4WK2B 1LB2B 3L1KA 2OD9A 3JQRA 5SYAA 3KKNA 1E2LA 4QUAA 5CHYA 4A2PA 2IMWP 4BP9A 1MLDA 4KFSA 2YB1A 4NM1A 3UJBA 2ZUFA 1EB8A 3DOUA 5I7EA 3VC8A 1SJ9A 2FUG1 3H4DA 1GRCA 3KR0A 4DQIA 4YCXA 5A6SA 4DWVA 5DX8A 4BFUA 2Y66A 2XVTA 4AU1A 5HTOA 4KAXA 3WHIA 4J1NA 1C7RA 1PFWA 5K1ZA 5IYZB 3I1JA 2W6NA 3ADOA 1QQBA 1EFRD 3JVEA 2L5YA 2M6SA 5KJEA 4PFSA 4LF7B 4OHFA 3ZQKA 4ZCMA 3H9QA 4ZVLA 2R4TA 3MCUA 2OD7A 3W5IA 2RDIA 3DMHA 4DFDA 5JANA 3V9AA 3UQ0A 3WRXC 3H83A 4LVCA 5TDHA 4D9NA 4GBMA 1X70A 2PD6A 5L4LA 5C1IA 2NRWA 3BX1A 1SC4A 1GKIA 4YGXB 3GBSA 3HR4A 4PC2A 3SJBA 3K4HA 4MUEA 5GAJA 5FBKA 2AFIB 2ZT6A 2FUEA 2GPNA 3GCZA 1U9ZA 1RU3A 1JHXA 5ABPA 3KOOA 1A7AA 1Y5IA 1A95A 5COQA 1BVSA 2A4KA 5ITWA 2V3VA 3NDRA 2IGTA 3S1LA 1ZD1A 1CY6A 4R69A 2BHSA 1DTWA 4OQLA 3RK1A 2IZ0A 2IX3A 1YR2A 4I2DA 3A9WA 5BR7A 3BD6A 5CB0A 1TK8A 4JI2B 4QEKA 1K0UA 5HA5A 5F9NA 4UNIA 2NVWA 2HHXA 3K0KA 4OFWA 4WFKA 4NIMA 2YZKA 3OZWA 2CXPA 2EANA 3N87A 1C5KA 5KNCA 2WF8A 1T2AA 1L7EA 1UJNA 2PX5A 1U1DA 1Z0KA 1MQAA 1QOZA 1W0CA 1RT9A 2ACEA 1E7YA 1HMPA 4AKTA 4O6VA 3N0WA 2CBXA 3MWKA 3FRHA 3H6KA 1YDHA 5TQ0B 4N7BA 3C6XA 3L5KA 1JL3A 1PJ3A 4EHLA 1XGKA 2R2GA 1K7YA 5ALXA 1OY1A 4MFAA 5BOSA 3C8HA 2Y93A 1E6WA 4S1OA 3C5VA 4O5CA 1GKLA 4GFDA 3FI9A 4ED6A 2ZTHA 4EKIA 2FMKA 3FWKA 3EQ8A 1LW6E 2AJTA 4FFWA 1W94A 4M7RA 2FWNA 2VOEA 2Q1YA 4QQNA 3HCPA 1NL3A 4CRWB 4XYEA 1RYYA 1UIRA 3K30A 2CNWD 5DCYA 3VSDA 3QVUA 2IYTA 1T4BA 4D9BA 3AJ8A 2UZAA 5DBIA 4MQFA 3KTDA 3NKLA 4RTLA 2WAQC 5JJLA 1T1GA 2OXTA 1CWUA 2N1RA 4DMRA 1JIVA 2YJTD 1J06A 2FMPA 2PK3A 4BNIA 4X84A 1NN1A 4AYWA 5HR7A 2WFLA 5EP1A 3RAPR 2KWIA 4OJTA 4J90A 3QYPA 4ED9A 3NVYA 5AVZA 3I2GA 4L4SA 1OZAA 1HJPA 2EF1A 4MP6A 3HJCA 1QRSA 1OKKA 1KAMA 1BWRA 2IYRA 1TJYA 4PCLA 3Q7PA 4L8FA 5JS8A 4DLAA 1WPXA 2QZ4A 1VPVA 1W5EA 4PAMA 4Z0PA 3DVLA 4CTJA 4K6OA 1JQJC 2R66A 5FPHA 5IAJA 2COKA 1WXHA 1UMDA 5EPEA 4A15A 2DAPA 2PNJA 1JEOA 3PFNA 1E1DA 2Y0BA 3M6MD 3R5JA 1DEAA 4RK7A 1T0IA 2BDPA 4BJ6A 1MG5A 3ZCXA 1P4JA 4OREX 4YCAA 5DX0A 2X9QA 2EDUA 3WK5A 1GITA 3AX6A 2PZKA 3VR2D 4FFMA 3VKWA 2PPVA 3WDLA 4RPXA 3INRA 4C9BA 3T54A 1U94A 1M73E 1O96B 2PMFA 1KJZA 4R66A 3FFTA 4EHKA 5JDIA 4ROTA 4LA4A 2YWHA 4QUGA 4KR7A 3WG9A 2EFYA 3GIKA 4M1MA 3VA7A 1WB9A