2I6XA

The structure of a predicted had-like family hydrolase from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
205
Chain Sequence
AMIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRFLPSGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLLREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a predicted HAD-like family hydrolase from Porphyromonas gingivalis. (CASP Target)
rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
molecule keywords Hydrolase, haloacid dehalogenase-like family
total genus 73
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2006-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2i6xA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i6xA01
2IOHA 3SLRA 1YS9A 3QU2A 3OPXA 2RBKA 3EPRA 5AK6A 3VAYA 5ALFA 4GIBA 4DW8A 2R8EA 4YCNA 3A3YA 2W43A 1RKQA 5A3QA 2O9JA 1Z4LA 2GMWA 1TJ4A 2FUCA 3N07A 2Q5EA 3KOOA 4UW9A 2EARA 2YFYA 3S6JA 2P27A 2Q4TA 4ZEWA 1VJRA 3WK9A 2ZBGA 3SHQA 2WFAA 4FYPA 3AR9A 2GHQA 2B1QA 4HYTA 3ZX4A 1WZCA 3L1UA 2YJ5A 1YDFA 3CNHA 2ZBEA 4IG4A 4YGYA 4XE5A 3QLEA 4HGNA 1J97A 2IOFA 1L7NA 3ESQA 4NAVA 2C4NA 1RLOA 2FUEA 2FPXA 3OCUA 3U13A 5AKYA 2CFTA 1YJ5A 3OCZA 5AKGA 4HGPA 1ZD5A 3AR5A 2FI1A 4O8CA 4MWOA 3ZU6A 1ZD3A 2P9JA 2GHTA 2ODAA 2P11A 5AHXA 5AM4A 3WGVA 1RMQA 3KC2A 5AKZA 4Y2RA 2G0AA 2AH5A 4EENA 2YBDA 4RETA 3ED5A 4C4RA 3QUCA 1RDFA 4RESA 3ZX5A 3QU5A 3QUQA 4J03A 1VFPA 4BNDA 3IB6A 3EWIA 3QUTA 3R9KA 1N8NA 4UMDA 5AI5A 4Y2UA 2FPWA 5AI8A 2HCFA 2ZBDA 2G07A 3ZVNA 5ALYA 4YCLA 1XPJA 3W5BA 3ESRA 3I28A 5AVVA 5AW1A 5AW7A 4F71A 3I76A 5A3SA 4Y2PA 5AVRA 5AKLA 5AW3A 4CF5A 4L6AA 1QQ5A 2B82A 4C4TA 2HEGA 2I34A 3QU4A 1X42A 4KNVA 2AUTA 3HLTA 1RRCA 5AW0A 4C4SA 1U2TA 5AVZA 1S2OA 5ALQA 3N28A 3L1VA 5ALNA 1ZD2P 3HYCA 4G63A 2MSNA 4BBJA 2YJ3A 2W4MA 2DQSA 4EEKA 1RQNA 5AICA 5ALJA 3NUQA 1PW5A 1U02A 3A1EA 3L0BA 4KNWA 5AVQA 5AM1A 3U19A 4UM5A 1NF2A 3ZVMA 1ZRNA 3B8EA 3RF6A 2OA0A 2I55A 3FGOA 2CN1A 3WGUA 3ZTWA 1AQ6A 3N5KA 5AW4A 1Z4MA 3MN1A 3OCVA 3N1UA 2JAWA 2WF6A 1Z4QA 4BX0A 5ALKA 3FM9A 4EX7A 2D2VA 2PKEA 4UM7A 2G08A 3NALA 5AVTA 5IS2A 3U7HB 2YJ4A 2FDRA 2R8XA 3KD3A 5IT4A 3A1DA 3WKEA 4YIHA 4YCMA 4UMFA 1L7PA 1SWVA 4KX3A 2W11A 2I7DA 1RPZA 2MU1A 4FE3A 1RC8A 3WK5A 2ZBFA 2FPSA 1VJ5A 3E81A 5AVXA 3PCTA 3AR4A 4H1WA 3L8HA 3B9RA 2OYCA 2CFRA 2EATA 4UMEA 4XQ0A 5AIBA 4UARA 2WF5A 4UATA 4Y2SA 1Q92A 1RMYA 1CR6A 5ALSA 3ET4A 2O2XA 2G09A 3L0CA 1NNLA 2ZXEA 3ZWKA 4F72A 2C9MA 2B8EA 2ZG6A 3OTQA 5ALPA 5ALUA 4ZEVA 3OCWA 3KZXA 4BEVA 2JARA 4BEWA 1QQ6A 1Z5GA 2Q4RA 4DCCA 1L8OA 5ALZA 2I6XA 2YN4A 2EAUA 3ZUPA 1ZOLA 1RLMA 2BY4A 5ALWA 1WR8A 3FVVA 2C8LA 5ALOA 2JAUA 4OHFA 2VKQA 2YJ6A 4UU1A 4UASA 4EX6A 3SKXA 3QNMA 4L6CA 5ALMA 2C88A 1J8DA 1JUDA 5ALVA 2G1AA 5AKHA 1XVIA 3AR8A 4Y2TA 3W5CA 3BA6A 1TJ3A 3UMCA 2NO5A 1YV9A 3WKDA 3SKYA 1SWWA 2FPRA 3ZI4A 2YMLA 5AI4A 1QH9A 3ET5A 2BDUA 3B9BA 1T5SA 3ZW7A 3WK6A 4PNHA 1S8OA 5AKJA 3NIWA 5AI9A 2AMYA 4AS2A 3MPOA 4CF3A 2BDEA 2G80A 2GO7A 1Y8AA 2IA5A 1Q91A 3F9RA 5AW8A 3DNPA 4BKMA 1TE2A 2HO4A 2WF9A 3M9LA 4E88A 3BWVA 2YMQA 3AR7A 3QU7A 2OM6A 4AP9A 3L5KA 1K1EA 4Y3UA 4CF4A 1F5SA 3MC1A 5AW9A 1EK1A 2WHEA 3GYGA 2JAOA 2ZOSA 3QXGA 4UMVA 1Z4NA 2I33A 2WM8A 5ALGA 5AIAA 2R8YA 3P96A 3E58A 3U26A 3E8MA 1MH9A 5ALXA 5AKXA 4XOUA 1U7PA 5AW6A 3RFUA 4FFDA 4CE6A 2JGAA 2PQ0A 3PDWA 1RKVA 3UMGA 2FEAA 3QUBA 4HGOA 2NYVA 1QYIA 3DV9A 5ALLA 5AVWA 2WF8A 4KX5A 4DWOA 5AVUA 5ALHA 5AM5A 5ALIA 3FPBA 4ZEXA 1T5TA 5AM2A 2B8JA 4UU0A 3L0YA 5AW5A 3WK8A 1L6RA 4JDPA 3D6JA 3J7TA 1YNSA 1QQ7A 2AGVA 3R4CA 4Y2YA 5AKKA 1CQZA 5AVYA 4XPZA 4EZEA 4QQFA 1Z4KA 1RQLA 4CNQA 3PGLA 4NV0A 5AVSA 2HF7A 3QU9A 1O08A 1WPGA 2G06A 1XP5A 3U7GA 2RAVA 1O03A 1RMTA 3NANA 2QLTA 2HI0A 1ZJJA 3WKCA 3K1ZA 4IFTA 5ALTA 1RKUA 5JJBA 3R09A 4DFDA 4I9GA 3EF1A 4NFLA 1U2SA 4OCZA 2CFSA 1Z5UA 3WK4A 4I9FA 1Z88A 1N9KA 3WK7A 5E0OA 1Z4JA 4NWIA 3OCYA 5AKIA 4Y2XA 5FP0A 2B0CA 2IOFK 2B1RA 2HF2A 5AW2A 5AM0A 2X4DA 3IJ5A 2HX1A 1WVIA 2HSZA 3OCXA 5AKEA 3I6BA 3PGVA 4J2TA 3DDHA 3WKAA 3QGMA 4MUMA 2OBBA 3SD7A 5ALEA 1T9ZA 3U7FB 4HGRA 4OFZA 3M1YA 3ZWDA 4HAIA 2I54A 5AM3A 1RLTA 2WF7A 1LTQA 1FEZA 2GFHA 2IYEA 3KDPA 4Y2QA 5AI0A 3L8EA 3UMBA 5AESA 2MU2A 4YH1A 4KYTA 1ZS9A 1L7OA 5AK3A 1L8LA 3W5AA 3L8GA 2RB5A 4KN8A 1SU4A 3SF0A 4Y2VA 3A1CA 3L8FA 3KBBA 3WKBA 2HOQA 3AR6A 1TJ5A 4NABA 4BX2A 3ZTYA 2HDOA 4HGQA 1ZD4A 3ONNA 2P69A 1TA0A 2YY6A 4G9BA 4UAUA 2C8KA 3DAOA 1YMQA 3I1YA 1NRWA 2R8ZA 5A3RA 3IRUA 3E84A 5AK5A 4AS3A 2YMMA 2HHLA 1EK2A 2B30A 3FPSA 3NAMA 4B6JA 3FZQA 5T41A 3QYPA 4OD0A 3AR2A 5IT0A 3MMZA 4UAVA 4EELA 2FPUA 3N8GA 1LVHA 4BX3A 3W5DA 3NRJA 2PR7A 1L7MA 3ZVLA 4Y2JA 2QYHA 2YMPA 3NASA 4BYGA 1KYTA 2NO4A 3TLMA 4GXTA 3QX7A 5AK4A 3U7EB 1U7OA 1Z4PX 5ALDA 1ZRMA 2RARA 4QJBA 3AR3A 1IWOA 3EF0A 3SMVA 3UM9A 4L57A 4YIKA 1Z4OA 3L7YA 5AI6A 5ALRA 4BNDB 1Z4IA 4JB3A 3CZ4A
chains in the Genus database with same CATH superfamily
2FEXA 3Q8PB 2GFQA 3LHFA 2ZIUB 4IAOA 2V59A 4RL4A 1WRBA 3SLRA 5I7FA 3SZMA 3DZHA 1FTWA 1XR3A 4ALNA 1YK1A 1W0CA 4TUYB 2XKJE 5KSYA 5EHNA 1PJCA 3PXBA 2FWPA 1NF3A 1F20A 1FDWA 2H1VA 3OIWA 1YE3A 2PPVA 2VWPA 3RW9A 4DQXA 1KYVA 1XTJA 2JI9A 4HNAB 2WHRA 3A3YA 3ZJ4A 1DJQA 1S02A 4G65A 5BSWA 4XSGA 4IJ5A 4QJ4A 1XAGA 1NVTA 1AMOA 2BMFA 2Q4DA 3E3AA 4BMVA 1X19A 4YQZA 3M5CA 1JSRA 5F2KA 2BFOA 2AQ0A 1GPNA 2GN9A 4BNIA 5TQ0A 4I2FA 4YJ2B 3WSTA 2NXJA 2IEGA 1C1DB 1GGMA 4FEAA 4JITA 4RK1A 4EOGA 5KJCA 5LQJA 2EARA 1GRQA 4GOMD 3MR5A 3T5KA 1M2HA 2W9AA 2FSPA 2Q4TA 3AI7A 2XUKA 3R5KA 4QYTA 3G02A 3OEYA 4MR9A 3VM6A 3FRIA 4B7AA 1XMIA 4WAUA 4ZPXA 4CCWA 3GVCA 4UNRA 3V8NA 5CW2A 2Z1MA 1D09A 4D4GA 2R0QC 1M34A 1C4KA 2CMFA 2IHYA 2AZ4A 3EXEB 4N40A 4BB6A 3CNHA 2Y9MB 5JARA 3TPCA 1ZYUA 4Y8VA 5HKKD 1ACMA 2QBYB 3V42A 3T12A 3T5MA 2Q1YA 1IM2A 1VQ1A 3BQ0A 4Q7EA 1QFXA 3E82A 5E3HA 5KFKA 2NXWA 3MJDA 1WXQA 2GM3A 4J9SA 2XCOA 3PR3A 4OIFA 2Y68A 2O8CB 2FMSA 1PUJA 1H8HA 3EXIB 2WVAA 4LOAA 4PFSA 3ITEA 1UKEA 3ANTA 1Q74A 1R8YA 3PQ6A 1RC1A 4I5IA 4P7JA 3SJCA 4QEZA 3EGXB 2ZE6A 2H3VA 2FI1A 2Q8QA 3PPXA 5DEIA 4TQUS 3SOPA 1BPDA 3VU9B 4R0NA 5IZ4A 3RB6A 4MOWA 5JH7A 2VA9A 4EJ6A 8ICZA 3ODGA 4C0XA 2YICA 4J4BA 4FJ0A 3A1NA 1RZVA 1J0DA 1GCOA 4QLAA 3SVZA 3VR4H 3BBPA 4S2EA 5BXQC 4WXYB 3C3JA 1T15A 4C4RA 2BELA 3VNSA 4RE5A 3UT5A 3PFWO 5KAPA 3R3JA 1BPXA 3X3HA 3ZPXA 3THWB 3WOHA 4UD2A 5KWEA 1CZLA 2IGTA 1A9XB 4EB8A 3V46A 3PUJA 2HCFA 2QE6A 2P0AA 7ICOA 2XZTA 4GVPA 3MUNA 4HB4A 3GUVA 3RC1A 4B9LA 4YCLA 5BRAA 3U6KA 1QHGA 3HUTA 5ADWA 1QWSA 1SH7A 4YMNA 4RF5A 4UJ5A 1HDEA 4QUBA 4PHFA 5HEKA 2FPIA 1JIUA 2ZTHA 5DTEA 1FVXA 3ZGLA 3DTVD 4Y2PA 1CUKA 3JAKA 2Q5OA 3GT3A 3DMRA 3PL1A 4KP7A 5C53B 5LR6A 4AQ7A 4ZTUB 2B2CA 1PDVA 1SOUA 3HZRA 1LBSA 2VPYA 6Q21A 5LQUA 1V5FA 4KSCA 4ENWA 4PYRA 5KT3A 1QGDA 1TL7C 3CVWA 4F3TA 2C2RA 1S76D 3PR5B 4FWIB 3N0XA 4LKOA 1QZZA 1PR4A 1OBHA 1U2EA 1GUAA 5EVCA 1D2RA 2Q8NA 4KHZA 4C7XA 5JD4A 5P8WA 3RR2A 4EI2A 3WYGA 2DUNA 3EE6A 3KT0A 3OEHA 4RSRA 1PW5A 4NLKA 1MRZA 2BM9A 3I01M 3M33A 1L5HB 4MKXA 3Q8LA 2BM0A 2DM6A 1FRQA 5CVCA 3VHRA 2QMHA 4LE1A 1QANA 1T8RA 1U8YA 3HGMA 4HWSA 5AXBA 3WZMA 4E70A 1A50B 2TMKA 3W5SA 2ZJ5A 2QR3A 1J7JA 4B35A 4XWAA 3ZVMA 1PU2A 1I01A 3RF6A 3ROEA 2PIDA 2V5VA 2AYYA 3HJBA 4HZUA 1Y3CE 1E3SA 4HYYA 3UW3A 3EWAA 3DEZA 1ZUIA 3L5OA 3D8UA 2R48A 1GUYA 2VHQA 1BD3A 4M1QA 4NCHA 2FSVA 4UCQA 4FDVA 4DZZA 4ZJPA 3WLKX 1EFUA 2JAWA 1N0WA 2C31A 2PBFA 2DHCA 3GRVA 3RR8A 3WSWA 4BU1A 1J00A 5E3JA 3VZPA 1JKJB 3KHGA 3T3NA 4Q21A 1L9XA 3V1UA 4A6DA 2P5YA 2VBCA 3INNA 1HDXA 5AVTA 1I7SB 3ZDXB 2Q62A 1SC1A 1DDOA 3B5EA 4OOFA 2NO1A 4YPVA 4LHVA 4TV9A 2ENUA 2VK8A 3D4IA 2RC5A 1GTZA 3DO6A 2ETXA 2KI5A 1SBIA 1J20A 3H86A 4M7PA 3ADPA 3VC1A 1KAMA 4DCUA 2A1AA 1SBQA 1X6VA 2OT3B 3SSOA 4R8UA 2XGGA 5L51A 2ZR0A 4BN4A 1AKYA 4FCVA 1G8MA 4ARIA 1GPWB 3KKAC 3LK9A 1X74A 2ATCA 1QK5A 2FSGA 3MRTA 3PPWA 1SC3A 2W6OA 2ZRKA 3PQ8A 3VBCA 5IEJA 4DB2A 4TXLA 4OHMA 1B6SA 1F17A 3ZS8A 4QIWC 1KO8A 3C43A 3M6LA 2DBVO 4MEYA 4XSVA 1XLWA 3I8OA 4EVSA 4GT1A 3KPVA 4FCWA 4Q39A 5DM0A 1XT6A 4YC7A 1NPDA 1V5EA 2VPIA 5JSYA 2OGSA 1B6TA 4LJLA 1N5WA 1F9EA 2ZIVB 1BE1A 3ED1A 3OICA 4HDKB 3HCBA 1T9KA 1H6BA 4NBTA 5CFQA 1H4QA 1IM5A 4DQVA 2O8DA 1ZY2A 5EJ5A 2IYXA 1OVMA 4G9GA 4RLQA 3QLVA 1HWYA 3L7NA 2X5KO 5ALSA 4ENUA 3MS7A 4NJ8A 5F98A 2GAFA 3HKDB 4Q4AA 3CZAA 3JTEA 3E3NA 3VOBA 3NCHA 4G6ZA 3CUTA 5TEVA 5JCOA 3PD1A 3WGTA 1CERA 3I04M 1GYPA 1XEFA 5ALUA 2Z6VA 4RM2A 2CYBA 1UJ4A 4FXPA 4LX0A 1ZGHA 3EHEA 4MWZA 3HR7A 1CETA 2O0LA 2P4SA 5BNTA 4K46A 1VB3A 3THYB 4CLXA 2VQ6A 1M6YA 4U2KA 1PLKA 3Q3HA 1FJ2A 3VVCA 3N87A 3B85A 2QTHA 1ZHHA 2KPOA 1BPEA 1PT5A 2FWJA 3M6KA 3D7RA 3GLFB 1D7AA 3DOFA 1AM4D 2IBSA 4PQYA 2F8LA 4NCXA 2OO5C 3WZ2A 2EG5A 1ORWA 1PEDA 1SD2A 2WK1A 3FWPA 3F73A 2WU4A 3R8CA 2W6MA 4ENRA 2ZJ1A 8LDHA 4YN3A 5F4BA 4G0WA 1UXHA 2A7XA 3NKLA 4K9LA 4QUGA 5F2OA 3CBQA 4G5QA 4NYJQ 4CL8A 1GU0A 1E2FA 2VPZA 3BA6A 4K6MA 1PNQA 3NEAA 2J4CA 2QW1A 5DKFA 2C5GA 3L8DA 4A03A 5LQAA 1NNI1 2X3FA 3MRSA 3RS0A 4L2IB 4RJTA 2ZJ0A 1RVV1 2NZUG 3PU6A 4XM1A 2YMLA 2C0PA 2JH9A 2ECPA 3ET5A 3A9CA 4IG9A 3KJZA 3KLMX 4S0ZA 3VPSA 2LPEA 1Z6QA 2IWRA 2BONA 3AKDA 4M6WB 5IAKA 4ZT7A 4PNHA 3ZQUA 4MVJA 3TZBA 3L0PA 3NIWA 4CLRA 4FYMA 5L7WA 4C7OA 4WW0A 1M2FA 3F6PA 4XUCA 4YCDA 4DXAA 2ACKA 4ZHSA 4FN5A 5B64A 5L1JA 4F4KA 5FNVF 1QP8A 4XPIB 3QZ7A 1JSXA 5CLJA 1N4DA 4P4SB 4QGBA 3IODA 5HP4A 1SUWA 2UVWA 4RCZA 4Y1FA 3RVKA 3L4KA 4F5QA 5KNDH 4AF6A 4BKMA 4MEXA 1T6YA 1JMYA 1UZMA 1CR2A 2AXPA 3LK6A 1NJFA 4L76A 1X7YB 4JLSA 1R27A 4Q1AA 5KNBD 4PSCA 5E8JA 2ZUFA 1EXVA 2JGFA 1DB3A 1Q0ZA 2AB0A 2BGLA 3A2MA 2FUG6 3EXFA 4II7A 5LXTF 3X1DA 4GMDA 4N41A 4XVRA 1ZQLA 3R6TA 2E87A 1V2GA 2PGDA 3AG6A 1XIVA 3IUPA 4Z3KA 1BRTA 3SZLA 4DBZA 3KJHA 1JWLA 3CM0A 4IUYA 5KFAA 1LDMA 3SQLA 4E1VA 4IICA 3W9YA 4RTOA 3HP4A 5DHFA 1JI3A 1IUNA 3JQDA 1EXMA 3DWIA 5TMDA 3HDHA 3SYRA 4DOMA 3MGHA 1BS9A 1Y8RB 4OBBA 5H7XA 3T3HA 3ZXSA 3A9TA 2J3IA 2PWPA 4KAXA 4MI1A 2C1EA 2Y3IA 3U16A 1XSPA 5E1OA 1I3CA 5LYJB 2ISOA 3KQUA 1QS0A 3WIOA 5FPHA 2MYUA 5KNCH 3EDRA 5H82A 1X70A 1RKVA 1RQRA 1TYBE 2B4QA 3IUBA 2JGDA 3I4FA 3H8WA 5IDQA 1KL7A 4YCBA 1KVTA 1OSNA 3UBMA 3TXAA 1ZA2A 4P54A 4LTNA 5IZCA 5DO9A 3VTFA 4CQMB 4FINA 4JJ8A 4I2AA 2YQZA 4NMXB 2QY9A 1Z7GA 3THWA 3NJ4A 2XCLA 1CB0A 5AM5A 1FVHA 2C5EA 3AM9A 2C5FA 1M2NA 1YZUA 2B5OA 5AM2A 2Q5FA 3LYLA 2VF2A 3QVTA 4HWPA 2YHIA 1HYBA 1C8BA 4N3AA 3C2LA 1FDSA 5CRIA 1CUDA 4K88A 3D6JA 2QUIA 4C8OA 4FYKA 4RGBA 4C3ZA 3W5JA 4P58A 1KMCA 2XMBA 3H75A 4GC6A 2BT4A 2VRBA 3G68A 1XZQA 2FPGA 1FB5A 4X5OA 3MINA 4X45A 4CM9D 3T3OA 2Z3VA 5KG1A 1E2QA 1K7FB 1A97A 1XGKA 1P2BA 3I2JA 3K1YA 3ZE7A 1OXVA 2B1JA 3JALA 2H1IA 4DLEA 1N48A 4PC3A 2DPHA 1ZITA 2FEWB 3T1YB 4I4TA 2IPLA 4ZJYA 1MOSA 4DSJA 2NQ2C 3PFCA 4E21A 4Z49A 4FKZA 1DRJA 2BL4A 3TFSA 2DKFA 1NYTA 5U4QA 1GL9B 1OW5A 2Z56A 4I3FA 4JT8A 5B1EA 1XNSA 4WGFA 2HBMA 2SHKA 3IP6A 4YRLA 3VJLA 5JFGA 2WJ4A 3SDSA 2AYZA 3CN7A 3A1TA 4IL5A 5ITSA 5J4KA 4GFJA 3GL9A 2EAOA 1KXJA 1ZM3A 2FEPA 1D07A 1XWWA 2J48A 1TA9A 3BGSA 2YWRA 3DPIA 3DWEX 1DOQA 4I9GA 4QGSA 5HKBA 2QN6A 1CBUA 2V65A 3HKCB 2G3YA 5JH7F 2ASDA 2WJYA 1ZUNA 3FZNA 3HDVA 1JSZA 4NNJA 3T7CA 3BM5A 1ZK1A 4D3XA 4EYGA 5CDYA 1W36C 1CEYA 1LI4A 5EXDA 5K7SA 2F1IA 4I81A 2JLZA 1K88A 2ECQA 4Y2XA 3JPTA 1RWPA 2VTDA 2JLUA 2A9OA 2YIMA 1GHTA 1KJ8A 2Q21A 3EVZA 3LS2A 5IBQA 2Q1SA 5TC4A 4ZVRA 1EIZA 1AMUA 1OV4A 2EZYA 1JJ7A 3W4JA 2FZ4A 721PA 2GJSA 4PSUA 2B6NA 5FTKA 1J2RA 2CNKA 4AULA 3SD7A 1DLJA 1Y0BA 3LP8A 2H63A 1YA4A 3UPTA 1KFJB 5EKXA 2JG3A 1LKYB 4CL0A 2A1TS 4FOTA 4RCYA 5A4FS 2QLBA 3BSFA 5CDTA 1MA0A 1JPUA 4D26A 3RAXA 4PNPA 5KPDA 1ADJA 2MMCA 4B9NA 4S1NA 1MO5A 3P52A 4NAHA 1E3EA 4CMEC 1EWQA 5DB8A 2IYEA 3KZNA 4W8OA 4EM6A 3KDPA 2KW5A 1SQGA 1KH3A 4TM7A 1NBMA 3AOEC 3ZXUB 2V7WA 2IEIA 4YH1A 1Q3VA 3WFJA 2DT8A 4KITB 1YL7A 3OLVA 4R98A 4UUQA 4LZDA 2CNNA 1EPUA 2JCYA 3ILXA 3KALA 1P1IA 3GGOA 1FU8A 4ALJA 4E08A 5JW6A 3RJMA 4AY3A 1YZFA 3GJTA 3OJOA 1OGYA 2IY8A 3D8BA 4KFTA 3WGKA 1SCUA 4X3PA 3GO4A 2B94A 3W8FA 4FHEA 4RQBA 3HLKA 5EQFA 3JS5A 2HDOA 2ADOA 1TZMA 4H60A 1ZD4A 2ZJ6A 4TWRA 1AB6A 5AJTA 3VR3D 5LIRA 2ZB3A 1MX9A 4DL9A 3BQ2A 2JJQA 3KKMA 4OM7A 4PFJA 4BO5A 2V6GA 5FR2A 4KLSA 4A73A 1LBEA 4P34A 3DDCA 3P9CA 2WNSA 3E84A 1NLMA 2H1HA 4KRXA 4H7FA 3T0IA 4C06A 4E11A 4WJKB 3WDSA 1RI1A 2AE2A 1LSSA 5CLLA 4DFPA 5KX5F 4JYZA 4J3JA 5A5DA 3RSSA 3PQ7A 4NR0A 2NACA 1H9BA 1YC2A 1MAUA 2CBZA 2WD8A 3AL3A 3NBAA 4Y6OA 3D4BA 2XE6A 3O4RA 1OZFA 4FI3F 4LGMA 4ARBA 2RH8A 1EDEA 1SPBS 3N8GA 4JP8A 4V1CA 4RKFA 1VL5A 1ZNZA 3KEMA 2AR9A 2Z57A 5KFIA 3N8DA 1OH6A 5CJ2A 3S1AB 5JZMA 5IKEA 3MCZA 1T6ZA 3NS1A 1WZEA 2FXIA 4HBGA 3KSZO 3RV3A 1YZ7A 4E13A 3R9XB 1JKJA 1NR7A 1P74A 1UAGA 2HO5A 4MRRA 5DCYA 4BYGA 4YLYA 4ZGWA 1C3VA 3D1JA 3GT7A 3HWRA 2R44A 5E3IA 4R81A 3UMMA 1DTWB 2GZ1A 3TSWA 1V8ZA 3GRRA 2VNSA 5ECYA 1XE3A 3V72A 1YS7A 2O4CA 5TV2A 2Q2QA 1XTQA 3HCRA 1ZUHA 3OFSA 1P2TA 1LFDB 2PMKA 3GX1A 4G4JA 1USGA 4AJHA 3PI6A 4YP1A 4INJA 3LPAA 2J5BA 3D4LA 5CT8A 5IKPA 3QVMA 1V97A 2BFCA 3FLEA 4H3KB 4K1LA 4QT0A 4Q1EA 3TMKA 3K75D 4QVKA 2JIMA 4RHXA 5CM9C 1FP6A 2HBKA 3VMMA 3CUEF 5GONA 3WTBA 4UBKA 1FP4A 4TT3D 4OAQA 1JQ5A 3ETGA 3T3FA 5G3YA 3N70A 1Z4IA 3H9JA 3KE9A 3BK2A 4I2VA 4HQ0A 4ERXA 4WGGA 2A6PA 3AHGA 4FI3C 5BVHB 1TM5E 1NG9A 2N1MA 5AVOA 1IVYA 1W73A 4MYHA 2QMUA 2V7EA 5LZ7A 4F93B 5L3VA 2WZQA 4MYSA 1AVTA 3TE7A 2CHVA 3UCFA 4U2FA 4Y1RA 1YE5A 1NULA 1QRRA 2VHEA 4RTLA 3Q8KA 4QXRA 4W1QA 2OO7A 4KLMA 2QZSA 3FNGA 4KE8A 4XGIA 2VPXA 4YRJA 5A9TA 3I2YX 6REQB 4Q43A 2DFTA 3IAUA 4F5ZA 5B7NA 2QDXA 3ETHA 2O50A 1CUHA 3FWKA 5A03A 4A8JB 2EFCB 2IE0A 2QZ4A 2LE0A 4M54A 1XJCA 4BC1A 1G18A 4I8IA 4QOHA 2V96A 1BQ3A 3H8SA 4LDNA 3O8CA 3KOOA 4ERNA 1ZSYA 4NEHB 4BMXA 4CI0B 3FGZA 1NW8A 3FSGA 3IPCA 4YWHA 2E1RA 2BQRA 2ZBGA 4IJ6A 4M1MA 1H1TA 1Q50A 1Q11A 1QFYA 1XI2A 5IABA 1PT9A 4AX4A 2QN7A 3QXXA 1ONNA 1PE0A 1WEKA 4FW9A 1KU0A 4B6FA 1N2ZA 3V6HA 4WXEA 2PBZA 4LY9A 3QTBA 4LQ4A 4UTNA 4HGNA 1LC3A 2Q6LA 3FBWA 3KOMA 2XOXA 3BIWA 2MRLA 1SZHA 3UH0A 1NVFA 1WEHA 4LMAA 3WYAA 4TSKA 1KZ4A 1V71A 1EAYA 2QVZX 3Q2KA 5JSKA 3U13A 1CIJA 3H18A 4A6XA 3T99A 4RXMA 2O6LA 4CEHB 4M47A 5DEOA 4H77A 4J7AA 4Q9NA 2I4MA 4NZNA 2I3BA 5JZOA 1C0IA 4OJOA 1EUDA 1UMDA 1E1CA 2QLJA 3R3SA 2GF2A 4L02A 4EYSA 3PRJA 4F2WA 1J8FA 1QO0D 1TAMA 3HDGA 7ICSA 3DTTA 3KSMA 3WGVA 3LUBA 3D6HA 5CNIA 1T2FA 1X7DA 2GZRA 4IGIA 4Y2RA 1ZQBA 3R24A 4W7HA 4KR9A 2PX2A 5BWBA 5H02A 1AB5A 1XCPA 9ICRA 3LWLA 4MUEA 2CDAA 1M8FA 2QM7A 3KE8A 4LISA 3QUQA 2V6BA 3H2HA 4X8OA 4WHMA 3O2SB 2YWBA 4NHOA 4D45A 1A76A 1K4YA 2ODBA 4ZZIA 5BNIA 4JUFA 2X1LA 2BF7A 3IJPA 3KQQA 4H6VA 3RM3A 3VPFA 2HHXA 2VNJA 2G8NA 1KHTA 4C7VA 3JVUA 4RC9A 1U8CB 5B6IA 3ZV4A 3HU1A 2H18A 4Q1FA 3T1QA 2CNBA 3OE7D 1IMJA 4Z1MD 1SHKA 2VLIA 2YHAA 4F3YA 1JAYA 3BJRA 1TYCA 2ID4A 1W88B 3ZVRA 1WB4A 1Q7RA 1M0SA 1WMEA 5L45A 4WXPA 4GVLA 4PXSA 1EJBA 2A2ZA 2ZTSA 3CNNA 3ALRA 3IT3A 1MAWA 4HBZA 2K8CB 1LEHA 1SUDA 2PLRA 2DGZA 3ANNA 3AVOA 1JTEA 5P21A 5LJIA 2VUTA 3EDOA 1QDLB 3JATA 1E99A 7ICFA 4IQTA 4QLBA 2I66A 1FXWA 4JWTA 4ZFNA 1P1JA 4UREA 5TQ2B 1R9MA 3TK1A 1MQ8B 2W4MA 2VBFA 5JPDA 5JTUA 2D1RA 1RQNA 5TZVA 4WASA 1KU6A 1VYTA 2I4TA 2G71A 2ZBVA 3CR8A 3TQQA 5JNRA 3H9BA 5BR4A 1P4HA 1CZRA 4EDHA 3FFAA 3ZK7A 4D98A 4I2DA 1A9XA 1JXLA 1Q1BA 2N3ZA 3M1AA 1HT2E 3RVLA 3R0ZA 4GWGA 2XTMA 4FFPA 2XMDA 3FGOA 4R16A 1YA8A 5DT9A 4ZHQF 1TD9A 1VLZA 3VKWA 3ZTWA 4N3NA 2KJ5A 4D43A 1ECJA 4DF4A 3GEMA 2RH4A 3RAGA 5D00A 3AEKA 1UOEA 4AZ3A 2M2IA 3GQBB 3QHPA 1EFCA 2X15A 3EA4A 4WKCA 5DMHA 3U2QA 1G63A 1U1FA 1K5GA 4D9GA 4PYLA 1AKMA 4FS8A 4F8JA 3V7LA 2SKDA 3RWBA 5ALKA 4CMBA 3FM9A 3H4DA 3O82A 5BSVA 2FB9A 3OLWA 1Z2PX 4CIWA 1FYVA 1WB5A 3X1ZA 2BW0A 3L6BA 1KDRA 2GXUA 1E4YA 4BU0A 4K4IA 4K6HA 3DBVO 3I05A 1ODLA 3A1DA 4BNKA 1I2CA 7REQA 1KC1A 3ZKWA 3NKFA 4ON9A 4FD2A 2ILVA 3T5BA 4ES6A 5EJ6A 3TW8A 2ZANA 4MAAA 1R8JA 4RW0A 3D0QA 4V0NA 3V80A 4CW7A 5FNVB 1UK8A 4L78A 2XZPA 2I4LA 3QNUA 3FA2A 1ODIA 3HCFA 2EKDA 5HYVA 1L5LA 2OBXA 2WU8A 5IAEA 3T06B 1Z26A 3HEAA 2CLCX 1DC8A 3C87A 5REQB 4CGZA 2FPSA 5KG4A 3WWEA 1F9AA 5AVXA 1TCBA 2VWHA 1NLYA 3QW2A 5DULA 1L7VC 3GLIA 3VO2A 1D5WA 4FZ5A 2C83A 2WABA 3L43A 1IXRA 1GU1A 3DFUA 3KK0A 3NTLA 1U1IA 4CGYA 3LC0A 3BS4A 4ALKA 4AF8A 1BMFA 3L1KA 4KL8S 3ZLBA 3NRWA 4UATA 1QX4A 2HMTA 3IAS1 1RKBA 4YYZA 4ARCA 1HRDA 3E9QA 4L15A 1CR6A 1NMSA 2COEA 2AN4A 4G0UA 4B83A 9ICIA 1XUOA 3L0CA 2WC1A 1ZNXA 4FWTA 3ZWKA 3GELA 5CP2A 4JSYA 4UPDA 1P5RA 2AX4A 4RQ5A 2HJVA 4GZ5A 4K9QA 3G0GA 4PQRA 2ZRLA 2V7XA 1XYYA 4JLAA 4O59O 2L82A 3A4NA 4BHTA 5ICSA 1KIMA 2OZPA 2XUFA 3DAYA 2Q4RA 2FZLA 2YR0A 3F3KA 3IV6A 3LCCA 4RLHA 3SU8A 3I5YA 1QYVA 2WAXA 1BH2A 4E33A 3JPQA 2BYTA 2PD4A 2RGGA 4LJ6A 3DLHA 3E9EA 3SJ7A 4IZIA 5M34A 1Z5OA 2QL9A 2J3MA 2NUTB 3GLHB 3AEXA 3EWSA 1SBCA 5L6MB 1J9EA 3VDNB 1DLIA 3NT4A 4P4UA 4L9RA 3ZDZB 1L8QA 3TCKA 4QYSA 2OXFA 3AMVA 3KQWA 4MJXA 4BWFB 2F8MA 2X40A 5FO0A 1ZNYA 3C3EA 5IHPA 5A4MS 1UR5A 4EX6A 1T9GS 2CEKA 4RHEA 1RE1A 5BR7A 5CB0A 4B2IA 3DMYA 3N9IA 2IL1A 5JNSA 1Z7WA 2WYHA 3R3WA 4OXQA 3AM1A 3VNUA 4BV8A 1U65A 4JBHA 4NZYA 2P41A 5COBA 3KYDA 4YYEA 3UQZA 3CLTC 3DP7A 4V24A 5ED4A 2RDIA 1PL0A 1NN1A 3L6DA 4GPTA 1YB6A 5ENZA 2AD5A 2JAHA 1D7OA 3C3KA 1JJAA 3L4BA 4OA8A 4WN9B 2CE2X 3BQ7A 2XY6A 3E0QA 4LN1A 1UCFA 5AFSA 2F1OA 5KOYA 5KDDA 2V7PA 4MR8A 2JD0A 3BXXA 2YZMA 4AS2A 2AJLI 3KOUA 3E4DA 1U5BA 2ZETA 3DWGA 3GRFA 2ZRCA 3DQZA 3KUDA 3BDVA 2QB5A 1ZGJA 5CTJA 3UCXA 2P35A 3OJUA 2I91A 1DCMA 3F6BX 5DGTA 3V2IA 1T4GA 5K3EA 2R6ZA 4QFBA 2DGDA 4PSKA 2CXPA 2PD3A 5FL3A 4A0QA 1OBVA 3D31A 1CJMA 1IY9A 2YDXA 2DECA 4LNUB 1HLPA 4E88A 2QLNA 4G24A 4QXAA 4G8BA 2BRUC 4P98A 2K89A 5KYWB 1K6IA 3W6OA 5F33A 5A62A 4EUEA 4JVSB 1OLUA 2EQ5A 4B9TA 1P4JA 2QTRA 1W8DA 1Z0KA 4FGJA 5F23A 9ICLA 1D9ZA 2RH9B 4J4HA 5LB2A 4ARVA 4RPZA 2WHEA 1FFYA 5C5EA 4BC0A 1CJKC 3BFXA 3T5HA 1YFKA 4JL5A 4NG5A 4UMVA 4KIGA 4MV0A 2O05A 1SIBE 1ONOA 4HZGA 3T3EA 5ABPA 3S1AA 2UXDB 4MHVA 4NCJA 2VCYA 1KP2A 4NBSA 4F5PA 3AT1A 2M9MA 2FEMA 2X4IA 1QQAA 3NRCA 1NV9A 2NVBA 1FF9A 3JWHA 1ZQNA 5E6SB 5BW8A 4B8YA 5KFUA 3BMQA 3FOBA 4GOLD 3WQRA 2IZ7A 2FEAA 4C30A 4P32A 3WLOA 5HW0A 2Q9CA 3ZW8A 1MB9A 4F21A 1EX6A 3GZ4A 2WF8A 3RB3A 3FYTA 4G1EB 2FQWA 4R7GA 4DLTA 5EE9A 2FSHA 5EZYF 4PZOA 1MVNA 1A8SA 1AN9A 1ZMOA 1J0XO 3A3OA 1GNPA 1UBMS 4QOFA 4TRRA 3VYUB 1ECPA 4ZEXA 4YRZA 2O3QA 3WL8A 4LDAA 4M1SA 2JEZA 4L4YA 2NTNA 1MO2A 1RJ9B 4N49A 4R2HA 4FEEA 1L6RA 3C6BA 3CURA 3PHIA 4PZPA 5E7MA 5GOTA 1YNSA 2WYWA 3FX2A 4YJ3B 2Q3EA 4RIGA 2PN1A 4L8LA 2XOKA 4BO3A 1BA3A 1YVDA 3E7PA 3OURA 1EDOA 1KH1A 1JFLA 3BDIA 3LYAA 3C23A 3ZDEA 5G1PA 4QQKA 3STWA 4JU9A 5DLPA 3SYZA 2NP6A 1NW3A 4PYKA 5FHQA 1B41A 4V0MA 2R68A 4P83A 4GOOD 2IH2A 1RQLA 4CNQA 3MCAA 2YCLA 1DBPA 2D4HA 3RUEA 4PZ0A 5AJYA 5KWJA 3QU9A 3LUHA 5IVKA 4W5NA 4DGQA 4MVJP 2BCGY 2BFFB 1YULA 3BQMB 2VYFA 4B4KA 1IEWA 3ND5A 4KSYA 5G1NA 3A0UA 3ZHYA 4EYIB 4PPFA 4B6EA 3NANA 2KZZA 2FQXA 3MNFA 3SAJA 1C4WA 4MTLA 1J8VA 1IPEA 1E0KA 4DM3A 5J3JA 5BOMA 3U3MA 2C57A 3OEED 4EKEA 3MJ4A 4BMDA 5HZHA 3BZKA 1IY2A 3I6QA 3BG5A 3ITNA 5KFBA 3G6VA 5KUTA 4MJ7A 3P9XA 2A84A 4UHFA 4QGFA 3WL4A 3AV3A 1SKUA 3SS9X 3OLZA 3UO8B 2ZM6B 2HGZA 1FP2A 4XA5A 2O8EA 5KL8B 5KAIU 4F2RA 1N9KA 2ECKA 2VA8A 3QZ8A 4R4JA 4BO0A 3RIXA 5F35A 1M66A 1NW4A 4BX3A 1NZJA 1P5JA 3CUKA 4JKYA 3RVRA 5D86A 1UZUA 3OJSA 5BWOA 3IJ5A 4I36A 3U9LA 4JBYA 1U90A 1UQUA 4LBVA 1ORRA 2YXPX 1DWOA 2GBCA 4WNIA 4LV8B 4BIMA 4DBLC 4EYQA 2OAP1 4LTMA 5FD8A 5IJWA 1R6DA 3DE1X 4DBLE 1DRVA 2CHEA 4LXGA 1TGVA 5EMHA 3UG6A 2JJ8A 4BMOB 5KSWB 4MULA 3ELWA 4MUGA 1PV2A 1W8IA 3N2ZB 5KFSA 3LCMA 2COKA 3H0LB 2YJGA 4C7BA 5IANA 3TGLA 2A5YB 3K35A 3ZV3A 4CCAA 2BD0A 1I5EA 4UHHA 3DT8A 4F9FA 1EEHA 5ILQA 5FB3A 2V45A 3DXZA 3RH6A 2REBA 2OLKA 5LXTA 3ODPA 4YR7A 4BP3A 5ELXA 4XQ9A 3ADDA 3OQNA 4UBBA 5DHQA 3C3AA 4LHYA 4QPPA 2VP0A 2GHRA 3BKWA 2BR3A 4OUKX 1HEKA 1UXJA 2R3SA 4GR4A 2N1BA 4JI2B 2FZGA 4FQ7A 5FUBA 4CM1A 9ABPA 1E3IA 3O3MB 2B98A 3TZEA 1NX9A 2HM7A 3L8GA 2GWHA 3FMGA 2EU8A 2POQX 4HO1X 2P9CA 4DA0A 3KQPA 2XADA 1U8XX 3WIUA 1CNMA 1Q0RA 1O5OA 3JV7A 4RTRA 5JJIA 2J5XA 1OFUA 4IRCA 4GWKA 3KBBA 3EW7A 3NOQA 4NABA 5FOVA 4AXBA 4ECYA 4B80A 1XMQB 3B36A 1PNOA 4PO8A 4ND1A 4QYWA 1PWHA 1E7RA 3JWIA 4DLAA 5CFNA 1QIDA 4MJLA 1AXEA 5K4GA 3JYNA 3OMLA 4BY9E 3ZHZA 2VQ3A 1EJ6A 5BP7A 4ND4A 4FDMA 2NNLD 1H2ZA 3N6RA 4ZQBA 4J94A 3AF2A 4YRQA 1F2UA 4DS4A 3PX7A 1OAAA 1NXOA 1FZTA 2YB1A 1SIOA 1FMJA 3G17A 4NICA 3SZRA 3PFFA 2Q5LA 3U37A 1J06A 4ASUA 4BVJA 3W4KA 4R0MA 1RNLA 4NLBA 1PN3A 2YIDA 3A1FA 3B5JA 3K9WA 1FO4A 3PKJA 4HLCA 4KQXA 3CCCA 5TMEA 1K8YB 1PJRA 3U4HA 2HJSA 4I1IA 4EA8A 3V9PA 1EFHA 1JI7A 4Y6SA 5DN9A 1OZAA 3ROTA 5A9SB 1SC6A 3TINA 3PNYA 3VR5D 4D0RA 1YIOA 1N5DA 5ITZB 5EJAA 1USVA 1C0LA 1RHUA 2I67A 4HNVA 5HQTA 1K9SA 1KSPA 4Q3CA 2EFEB 4CV2A 3ISDA 2Y1DA 3ZVLA 5L4SA 4JYBA 4BXOA 2DLNA 1H2RS 4QQNA 4F4UA 4AKHA 4GE0A 3OTWA 3S2IA 4H7PA 1WPRA 2YWEA 3IDSA 4QC2A 1LSOA 1CQWA 1ZQGA 3HSYA 2D8MA 3KFXA 3IIEA 2FKNA 5LQNA 3WY9A 2G04A 1GPJA 1T4CB 1X7HA 3D6AA 4F8EA 4E5MA 3HXTA 2YJZA 1UP6A 2CY0A 4L5JA 3ZH9B 2P68A 4UUOA 4M9HA 1IWOA 3Q1KA 4N8DA 3K71B 1QQTA 2OCGA 3BRSA 3SMVA 3FCEA 1HNZB 5JJKA 2PX5A 4QZCA 3L7YA 3KRTA 3LA8A 4WLOA 2ODWA 2R6GA 2XDQB 2XDAA 3WJAA 1RPAA 2KICA 3SC4A 1UJNA 3H4BA 2Y1EA 3F2VA 5DXJA 1A9TA 1YRWA 1P3DA 1G19A 3K2IA 1E18A 4BZZA 1W1IA 1T5LA 5JPIA 4CI9A 1VCNA 1ZG3A 3K1RB 1BCSB 4IS2A 1PS8A 4O5OA 2WIBA 1XTRA 1LV7A 2H1SA 2W2PA 2K8AA 3O8OB 4LI3X 4PSVA 3TSCA 3VMFA 4CKCA 5JQGB 4INAA 3ERCA 1NXQA 3KCNA 1FYDA 2R8IA 4UAJA 3P9SA 4NOLA 5C80A 3EC2A 2JHDA 4YMTA 2ONYA 3O5AA 4X93A 3FXAA 1N75A 2H2AA 2DUYA 2ZDGA 3P20A 4A82A 1R0ZA 5IK2A 4GLOA 3T41A 4BV9A 5L1KA 3KLOA 1E1RD 1HQDA 8ICTA 5DIZA 3AUOA 1IM8A 2WIJA 3BXEA 4ZU6X 1N4AA 3LT4A 5EWFA 1Q7EA 4IL6U 1FFXB 3EARA 3R5SA 5E4TA 3N07A 4CKBB 1E9AA 1S7CA 4O6VA 5HR6A 1A2OA 1O5TA 2Z6AA 5LMCA 1ZQ1A 2NZ8A 2XWBF 5J63A 4CTNA 1Z6AA 1A4UA 3P32A 4KDCA 2N0SA 4MQFA 3O8RA 4GPIB 3TLKA 3OA0A 2CLFB 1I2ZA 1S2IA 4RMIA 3R7LA 4RX1A 1KFBB 4RQ0A 2XSZD 1T94A 1G8HA 1UHUA 1GIAA 2IODA 3JW8A 2IV2X 4ED3A 1OR8A 3K4PA 1I2AA 3DKKA 2NGRA 1MFPA 2ATEA 3I53A 3NTRA 1SUIA 5C1OA 1SXIA 1QS0B 1FJHA 3QVXA 1TJNA 1TMGE 1XCOA 1S0OA 1J4AA 1NUAA 5LP6F 2I5HA 4IYJA 1T5BA 4R2KA 4UDNA 4ENPA 3WGOA 1KK3A 5I51A 4GRDA 2C9BA 3CZ9A 5AKGA 2OXEA 2EOAA 2IYSA 1RXIA 2R18A 1YBAA 3NP9A 1I2BA 4BBAA 5HIKA 3C7CB 1VIDA 1NI4A 4BCDA 3I2IA 1XL0A 2A19A 1RMQA 1B76A 2ZSKA 4RU9A 2HK8A 2DH5A 5A05A 1YFLA 3HMKA 1NW6A 3IBFA 3AF0A 1XZDA 1BG6A 1C81A 1CX9B 9ICVA 2VT2A 4AK9A 4J03A 2B21A 1VRCA 4V3CA 4F4FA 2UYOA 1DCKA 4JUBA 1NG1A 1ISFA 1E3LA 3AFGA 5CAEB 3WE7A 3PFKA 1NBOA 4BE4A 3R9KA 4L95C 3M81A 2O0MA 5FQNA 2UUAB 4KLEA 3OFND 4F5EA 3CG0A 9ICUA 3GP3A 3NR2A 4CL3A 3ACBA 4ND3A 4WOPA 3AXTA 1ZQ1C 4L3OA 3UGTA 4MKIA 4JFRA 3TZKA 1ZH2A 2XHZA 1OI3A 3D5EA 3Q10A 4N5DA 1YZKA 3B2NA 3PUWA 4JC5A 4L4UA 4QNLA 3EVFA 3G13A 2IEDA 4FGLA 4NFHA 1SXGA 2XMPA 1KRHA 1HT1E 1UC5B 3TQOA 1V6CA 1X1SA 5K3BA 4FHCA 2WBLC 4JBIA 2VXCA 2VUHB 1PUIA 2YZKA 1NJXA 1VHLA 1CVLA 3CPJB 4P6VF 4Z4HA 4JH0A 4PNZA 5CT6A 3R9XA 1YGYA 2P67A 2GZ2A 5AW0A 1IJBA 3FUVA 4DDKA 1F51E 1KO4A 4NPHA 1XK6A 3SE0A 1BOOA 1V3TA 3DVAA 1GFSA 2H7XA 1JJIA 4GW3A 4DDMA 5ALNA 3M6XA 3LSYA 1U8AA 5T4EA 4DCTA 2NSJA 3STHA 1T3NA 3W8RA 1ND6A 4YP5A 1ZISA 1DXYA 3W3ZB 3BEDA 1TV9A 2I87A 5BN1A 3CF4A 3MTGA 3TZCA 3ROGA 1V3VA 1NUUA 1ZRSA 2YX8A 2R1VB 4GZMA 3A1EA 1X13A 3LA6A 2DB3A 2FRVA 4QUEA 5GJWC 3O2QB 1IHPA 4BFSA 2JLBA 2IFTA 2VQFB 3JAWA 2JH3A 4NCKA 2Q1TA 4MQBA 1UKBA 1J1UA 5FTJA 3GLTA 4F4ZA 3KZCA 2JGIA 3EJ6A 4J0QA 2FN8A 4OLFA 4XFDA 4CPDA 4ENQA 3AIOA 1GG9A 1NPYA 1V96A 3HV0A 1HE5A 4CV3A 2ZRMA 4A2WA 4X84A 3OE4A 3KVRA 1F14A 2AFHE 5JQGA 2DG2A 2BFEB 2PWYA 2W9BA 3UCEA 2RGNC 1VKZA 3OCVA 5J2IA 2E4ZA 3T54A 4WA8A 3RSGA 2GD2A 5BQFA 1ESDA 2RBGA 3MVEA 4BX0A 1H4VB 2MYNA 4EQ6B 4NBKA 2IV3A 1ZR2A 5DT2A 1FRZA 2JLRA 1VLLA 4DL2A 1X1TA 1JVNA 2F3UA 2YASA 3G8CA 5JXJA 1Y6FA 3U7HB 2A7QA 2DFLA 5C32A 1QOZA 2UZ1A 3PDIA 1XZJA 2GARA 3BA1A 3GBSA 3IPAA 1NFRA 2XBLA 2HBZA 3LY7A 5DTMA 4RULA 4Q9LA 5LWQA 2TMYA 5HGXA 1TZCA 2W6ZA 2YW2A 2PX4A 5HGJA 1JEYB 5I7UA 2QR5A 3I9MA 2C7RA 3AFHA 1YRBA 5FUXA 1JR6A 1SWVA 3ZV7A 1W46A 3O8NA 4D41A 3S0JA 3KZOA 3KJEA 4X8MA 2WE8A 1UKZA 4Q37A 2I0FA 2IEZA 4PS1A 1LD3A 1D8TA 1HOXA 2HK7A 4Y6QA 3ZIAD 1QO0A 4B3SB 4L3VA 2VANA 1EUCB 2L69A 3B13B 1VI5A 4HAUA 4HRXA 4BJHB 3EG9A 1YWGO 1KRPA 5LP6A 3NGXA 2IUUA 2PZFA 8ICCA 2ZRFA 3SBEA 2HCTA 4M0KA 2I71A 2EZ9A 2ZBRA 4DIUA 1P5ZB 1ETHA 1XLTA 3N97B 3NLLA 3VR6D 1ZCAA 4EHHA 2WJHA 5DGBA 3EXIA 4IJUA 4FX2A 1JKIA 1DBRA 4ND2A 5TPWA 2R62A 4BGVA 1L1QA 2YWGA 3RRNA 3D64A 2CF5A 3KR9A 3GCGA 2J59A 3ND6A 3W7VA 3OFJA 3BHJA 2D8AA 1CY4A 2ET6A 5DU2A 2HWUA 1HDGO 1XJ0A 1W19A 4LNUA 3AL2A 4B3BA 1KZHA 1Y4UA 1AGPA 1X3LA 3RU2A 2EGGA 2B34A 2FPPB 4EVQA 3BMOB 1O94A 1E9RA 1NXXA 2QM8A 4A5OA 1Z7YA 5BV8A 4I1PA 1ZQZA 1E7MA 2ZYWX 3CVJA 3IKVA 4N0DA 4WNAA 1NBWB 5M04A 3L18A 4KBFA 2QT0A 1SV4A 2ZI4A 5EFOA 1E2UA 3LRTA 3W2IA 4DY4A 4OB8A 3E2IA 4FZJA 3ZHRA 2HJ9A 2VKQA 2KKPA 1MJNA 1FXWF 1O7JA 4YJ3F 3SKXA 5IK2D 2XLCA 1QBKC 2Q9UA 3PIRA 1MC1A 4CHGA 2NNWB 3ICQB 1SCUB 3Q7PA 4BKRA 1ITZA 1VB5A 3KDAA 3BPSA 1SBYA 1RKXA 1FPQA 4QVIA 1XJQA 1U3CA 3AJRA 4XIFA 3P9KA 2EEPA 1BX0A 3OZBA 3ZCRA 4B71A 5D1HA 4BDTA 3AB3A 3IQHX 1L3VA 1N6IA 3MS4A 3DBHB 3VYSB 1I5RA 4WE3A 2QZZA 2WUDA 1H3NA 1V1JA 2IPOA 1X9WA 2R79A 3B9BA 3ZW7A 3ZQJA 1YVPA 4TLEA 3OPYB 3H5AA 3FHJA 3C6YA 3MQ4A 4AYTA 2IZ1A 2OK7A 2QN3A 5J5CA 4CF3A 2H4WA 3Q9LA 3VNRA 1NP7A 3FI9A 2EHJA 4GNRA 4LJ4A 2IP2A 1HO3A 1QIIA 3TL6A 8ATCA 3JVEA 4YO7A 1NXTA 2P0YA 1N57A 3RYFA 5DMXA 3DNMA 4RTPA 3PMLA 2XO7A 1WSBA 1X7WA 4L3WA 1JG7A 4Q4LA 3SEZA 5JXWA 1F2UB 1FU4A 2GK6A 3UJ6A 1RPTA 2BJHA 1K3UB 2OHOA 3KHRA 1FTYA 4R68A 1RXSA 3OEEA 1AE1A 2JIDA 1T5IA 5TQVA 1EE2A 1R6XA 4JI3B 2CMGA 2YNMC 1A0PA 4KLNA 2GZDA 2AQHA 4TLAA 1B1AA 1AUOA 2H4XA 2YNMA 3K5WA 4HAVA 5HF9A 4ETMA 1FFXA 2F6RA 3IBTA 2HRCA 3IBGA 4L27A 1ONBA 5FOWA 4U9UA 1XTSA 2BFBB 3E61A 4TXMA 4EF4A 5IG2A 4PZYA 3C2QA 4RL6A 1GGHA 3B9PA 1P0FA 2YFKA 5H80A 3ZW9A 1UP4A 1CQXA 1Y37A 2WKRA 4XD2A 3E8MA 4B8ZA 4D8YA 1X9XA 4O5CA 2NPIA 4JR0A 2ZVJA 3PNCA 4KJXA 1TPZA 2R751 4RAQA 3W2FA 4B4DA 3VBEA 3FPJA 2RGXA 4CE6A 3KTFA 4RDIA 3ZY5A 5GJVC 3TQ1A 4V02A 4G8CA 2IBMA 2ZT8A 2C8JA 5SZJA 3ZE0B 5EHXA 4PX3A 3K5PA 1I3OA 2I2BA 2WR8A 2IXBA 3QYJA 5E2IA 2VHZA 5J2JA 5AVKA 3OU2A 2SKEA 1DQYA 3PZRA 3NH6A 4FZNA 3OKFA 4EGJA 4LF4B 4CU2A 2Y1LA 2G9ZA 3L01A 3TAPA 3FTEA 3RR7A 2POCA 2W2LD 3BWMA 3N2NA 2EZTA 5DTIA 5CDFA 1FDUA 4KTQA 2H8KA 1K2VN 4W1RA 1ZC3A 3VA7A 1SMKA 5EZ5A 1DG3A 4QARA 4CMKA 2FETA 3N53A 2XCIA 3OIGA 4XYMA 5AW5A 1MN8A 1CU1A 1QQ7A 5CA7A 3DGFC 4I4NA 3R4CA 2QVYX 3OE7A 1Q6YA 2C61A 2KFNA 4HATA 1A6SA 3GN2A 3MTAA 2X22A 2C00A 2VJQA 3CSUA 3NATA 4K26A 3UYLA 3ISVA 4HMPA 1QPBA 2MSLA 2P3OA 2EZ8A 2R6AA 1S8FA 3I3OA 3TMYA 1JAHA 3FNEA 2XVYA 4MUIA 1K6XA 4JX8A 1ESZA 2HHCA 2ZBUA 3BWCA 4CDRA 4EB6A 4H59A 3ZHUA 1MEJA 2P90A 3ECCA 5EQTA 4YONB 3FHOA 4YRSA 3HDTA 4Z9BA 3CV3A 2PL5A 3AJAA 3IN5A 3P9RA 9LDBA 2RAVA 4KPUB 4BVEA 4J9NA 1VHQA 1F3OA 1VPTA 5AJWA 2P78A 4UE6A 4YWJA 3V5NA 4CTJA 4DIBA 2JIQA 5K0CA 4TYMA 1E3QA 3GQCA 1Z0FA 3CX8A 4KQFA 3K1ZA 3LJKA 4ED8A 3HN7A 2FFHA 5E7JA 3OCJA 3CF0A 1GSOA 5FQOA 1LJUA 5JWRA 3CH7A 2DXIA 3CMMA 2XTAA 4P3OA 3QXJA 5J4YA 1RHMA 3MD9A 4ID3A 1CRLA 1HE2A 4YCXA 2FMFA 2GK7A 2JHAA 2KSQA 1Z5UA 4KMRA 4MS4A 4KDRA 2V7GA 4PHGA 3SICE 3T0FA 1CEQA 3H05A 1NTOA 3GEDA 3C4VA 3NIGB 5KYVA 3DBLA 4NWIA 4J1TA 1JEYA 3RC8A 2B4AA 1GQOA 2BV3A 1VPEA 3BULA 3EIFA 4GYWA 3Q7EA 3MRVA 2OBYA 2J67A 3DVQX 3OBBA 2HX1A 3BXZA 4B6SA 3TR6A 3G7UA 3W9SA 5BSEA 4FOLA 2ALZA 3BCSA 4FZRA 1GEGA 3OKAA 4KAFA 1HDRA 5DBEX 2G1PA 1IN4A 5KFXA 1WD5A 3WYCA 4NL4H 3AF3A 5FYQA 4HTAA 2BEJA 3JTMA 2PEZA 1V7CA 1NOKA 3JXEA 4IMPA 3R4VA 4RBNA 3VU8A 5B4UA 3OJEA 3BS7A 5JYBA 4EMUA 2CLDX 1SL1A 4UBJA 1B4DA 4QG7A 5LIPA 3RVBA 3O8BA 1NBME 2FSIA 4Q93A 5ANRB 2M6SA 1X0XA 3M6WA 1H42A 3PD7A 4W1PA 2ZE5A 2D13A 3IQZA 3RO7A 2XNCA 3EUWA 4YI3A 5KTPA 2GZMA 3I42A 1FSPA 1MO3A 4AJIA 2RH5A 4JLBA 3DXXA 2OCBA 5DBIA 3GLQA 4EABA 2O54A 3JQ9A 5DLYA 3IE2A 2R65A 2BIFA 3N2YA 3SBDA 1G5PA 3K0AB 2O0HA 1PVQA 4PQGA 4WBNB 3LV8A 3DBOB 3G2OA 3NTXA 2NX2A 3HB1A 4N5NA 1J9GA 1DXHA 2O2GA 3FDFA 4JX9A 4DCVA 1I14A 4CEJA 1KH2A 4OFWA 2EBUA 3L0IB 2DPIA 1WHTB 2J0UB 1IY1A 3A58B 2O3SA 3IHQB 2OLJA 3AJEA 3EXHB 4ZQHA 1JXAA 4M8SA 3K70C 3UGJA 2OTCA 3IKMB 4BNFA 4OSEA 1LW7A 2V0NA 4WFIA 3GV0A 5KEIA 2A9VA 3B1XA 7ICUA 3KEGA 3PF8A 1RWQA 2NAFA 2AZDA 2E9SA 4GM4A 4B6RA 5JXGA 2KS6A 3NOXA 2QMOA 4P7BA 2EF0A 4MFFA 5I6DA 1WUKS 2XE4A 4HN4B 3SR4A 2YMMA 3BZUA 4NNOA 4E5VA 1Z5NA 5E1MA 2JIRA 4UXJA 4AW9A 1NQ5A 2ES4A 3VSBA 3GG9A 1B0ZA 1BDBA 3NW9A 3HRHA 3JWGA 3CF4G 3M6UA 2D3DA 4UJ3A 5CIQA 4EGCB 1CQIA 3ONFA 4EUKA 3AERB 4MCHA 1VJGA 2RHGB 5SY9A 1A96A 1QLNA 4ZOHC 1NJGA 3N0VA 4R1QA 4M83A 5BQPA 4UM9B 5JR3A 4WCVA 2RG1A 3JQFC 1W5AA 2AK2A 2QD1A 2LYHA 2WAYA 4B7ZA 1L4UA 4K3VA 3MABA 4TM8A 1YBVA 1ZESA 1IPHA 3U9SA 3LECA 1JRPA 4QZAA 1IAVA 5JO0A 3EDYA 5TQJA 2IC5A 4GXTA 1QRTA 2OB1A 3OZAA 4Z54A 3ITDA 3H4MA 5IDXA 1Z4PX 2MHCA 2J0SA 1NI4B 4N01A 3FYHA 1E9DA 3JR7A 3C85A 4IIGA 4JN6B 4QUDA 2IPNA 5A7FA 4FR2A 1CD5A 4KQMA 3RIMA 1JX6A 3HKEB 1BEEA 3WL7A 4A8TA 2OG1A 4DR7B 2JGKA 3P2JA 3PFHA 4RT2A 1CB7A 1G7CA 5DM2A 2UXCB 5K03A 1V4BA 1CNFA 2XKKA 4RA9A 1UQTA 4O4LF 4XARA 3OZGA 4JQZA 3NP7A 4K3UA 4EITA 5BURA 5EJMA 3JQGA 4PH5A 3FWZA 2MOKA 3DSRA 1ZZGA 3PGMA 3O4IA 4G0XA 3UK2A 3HK2A 5TSDA 1XTZA 4D6XA 3E23A 1S3FA 4MB2A 4B5KA 1TW2A 4NYMR 1DAPA 5HPYB 4MI3A 2R1ZA 3N0TA 3V2GA 4CCYB 1P2UA 4FBTA 3HBAA 5ESWA 1JAZA 1YS9A 1G3MA 1T1EA 2UUPA 4PANA 2W2OA 1H8HD 3TLCA 4ZI7A 1OXUA 4PGMA 3OHSX 3QTLA 4OKIA 2DP4E 3NAGA 4OOEA 1AUQA 1TF2A 1QGYA 1OA1A 2CXYA 2F77X 1SIUA 1P80A 1WY7A 1MGOA 2PLFA 2XQFA 1Z2AA 3NH9A 4LNHA 4ZT5A 3NWPA 3S4YA 4D46A 5BPFA 1TA4A 1ENPA 5M3BA 3S5UA 1ENOA 1DBWA 1Y4DE 3A0RB 5MDHA 1DHRA 1X8XA 1NJWA 3X0DA 1PWYE 2JI6A 1N32B 2W4IA 4YUWA 4MWSA 4CT0A 1IOVA 1KSHA 1RHRA 3BUSA 3ZEAA 2PZJA 3T3MB 3KWJA 5K0FA 2BFNA 5KU7A 2WVJA 1BEZA 5B3LA 5FOUA 2IY7A 1ORTA 1XJ5A 2C4TA 3B6ZA 1DMRA 3GYBA 4K8RB 1YZNA 4PNEA 5KHOC 1TUBB 2GN6A 2XZDA 4B79A 4M0MA 4MV4A 1BS2A 2QTMA 4GOJA 2X3YA 3TRHA 3UJDA 4LBZA 3R3ZA 2Y6VA 3E3OA 4PFKA 3PGXA 1DXOA 4CLHA 1H4TA 4XR9A 4YP3A 2Y1KA 2QMZA 1XTUA 3RTEA 2ECOA 4QDUA 2N9UA 3B6EA 3I09A 3P2EA 4P8RA 3ZKWB 5C51B 5IVHA 1R18A 3M49A 1L7NA 4FHFA 5AOCA 5TS2A 2RHTA 3RSZA 4A0SA 1TEZA 3B3FA 4FSDA 5TVKA 2CCJA 3PC4A 1YS4A 2A0YA 5JRJA 3TGWA 4ED9A 3BRQA 4INOA 4AMUA 4GBGA 3WL5A 1BWSA 1AS2A 3CT6A 3L0SA 3G0OA 4NH4A 4EH1A 4JGIA 4EJSC 1L4NA 1KJZA 3GILA 1JHAA 3ETCA 4HGPA 3CRNA 3OT1A 3Q9UA 3OQIA 3WIEA 5KQSA 2ZQ5A 3HJFA 3QELA 4ZMSA 1O97D 3T9BA 1HYEA 2XMSA 5HS6A 1V8BA 3HFSA 3HM2A 4Y6GB 1NI5A 3T1OA 1B7GO 3U80A 2AH5A 2CXRA 3U1BA 4J2OA 1JJBA 2WTBA 5FWDA 2HREA 3F8WA 3QUCA 2QP3A 4IOJA 4KOEC 3TEMA 2P65A 4XD7A 2R4TA 4EPVA 3ETEA 4YHHB 4BO7A 2FZCA 5JTTA 3IOCA 4OB7A 1MX3A 1ISPA 1GA1A 4GRIA 1SL0A 2A1TR 3PD0A 1NU6A 2HBQA 4IWNA 3UMFA 5JWHA 1SQ5A 1F6BA 1L7QA 2FW6A 2PIAA 1KKXA 3ASUA 4KXMA 1Q0HA 8ICEA 2BEKA 4EG1A 1XZLA 4I27A 2WZCA 3ESRA 1DP4A 3T5GA 3D2NA 1Y42X 2I8LA 2VA3A 4ZU1X 2ADMA 3R5XA 3W6PA 4PVCA 1T7PA 1QZXA 3SP1A 3I76A 4MQLA 5K3SA 2C3OA 1G5RA 3T4UA 4E7OA 1KEEB 3G3EA 3DFIA 4MP6A 4GC5A 4I14A 1POXA 5KTMA 3U09A 1PLJA 2DT5A 1DV2A 2ZQYA 3JQ9C 2G82A 4TT3A 4ZVOA 2IPAB 2P2ZA 3ILHA 1TU0A 2BFPA 3JD2A 4WD3A 4EJSB 1W93A 1U9JA 3Q11A 2WU3A 3DHVA 3TS1A 4Z6EA 4HLNA 3OZFA 3ANSA 1Q0UA 3LYHA 3NWOA 5EMNA 3K9FC 1ISHA 5EWEA 2DHEA 1EZZA 2H48A 4L8VA 1MOQA 4WFKA 2YJ3A 4YUYA 2HAEA 2F62A 3OZIA 1CQIB 5DN6A 1XA0A 4FONA 3I12A 4J3NA 1VM6A 4XX0A 3ZBQA 2X1HA 4EY3A 1R6VA 5T4BA 1CJSA 1W5BA 1ZXBA 4Y7DA 1J8QA 2AOTB 5C1PA 2E3JA 2OZEA 4O5KA 5NULA 2M98A 4EMBA 4YAKA 2MUTA 3GZFA 1PEAA 4F6CA 1ZK0A 1JEDA 3DE2X 3E53A 4RF3A 1A7JA 3VR6A 1WDLA 3IUYA 4BGIA 3AONB 3RJGA 1Y6RA 3C1ZA 1IL0A 4AJLA 2X14A 3TLYA 3H40A 4G3IA 5KNCA 1V37A 2ZR9A 2JBHA 4EHIA 2XF2A 4NVRA 3WLNA 1QONA 2JEJA 1FMLA 1IN5A 4RQ6A 1Z4MA 2VQSA 4OHPA 1A8PA 3K4GA 2K2WA 4LHXA 4YY3B 1EX9A 3V8BA 2PU5A 2QTVB 1E1CB 2WF6A 3K6SA 3QEBZ 4RWZA 3V3TA 5L4NA 1LY1A 3B5IA 2VLBA 3C3WA 4BO9A 3FAKA 4GMFA 4JB0A 3NALA 1XYGA 2C2HA 1GLVA 4GMGA 3IYLW 3A4MA 2A67A 4MLDA 5KVCA 4KXYA 1IN6A 1YZ3A 4G01B 1MPXA 3GG2A 4UQPA 1I3KA 3G88A 5D3KA 3WBFA 5HRCA 3FPFA 4L1KA 3VVLA 5KFGA 3BWEA 4DDTA 5H59A 4M60A 3BB4A 1TKRA 4DSKA 3DMHA 2HLDD 3SFZA 5BSRA 5CK5A 4Y9DA 3CO0S 1Q2XA 4KX3A 4P1ZA 1JH8A 1Y48E 4WRRA 4EF6A 5EOZA 3SENA 1R4ZA 3PEFA 1DJNA 1KYWA 3L40A 3R3HA 4QZIA 2AS0A 3CSSA 4ZOLA 2R25B 3BGIA 5AQEA 4DR6B 3PC6A 2NRVA 5FOQA 3JASA 2LM4A 2NV3A 4N0MA 3UWOA 8MHTA 3RDPA 4EBCA 1CY0A 1CCWA 3B9RA 3HYNA 4IHKA 5B1SA 2ZYRA 2EATA 1ODFA 1RYDA 4J3FA 4B48A 2AEFA 1CDEA 4G67A 3DR3A 4L8YA 5KFWA 3RNLA 2AZXA 1T6NA 5KG7A 4ZCSA 4DILA 2B92A 2QX8A 4NENA 1COWD 2GOLA 1YRYE 3TJRA 5JECA 3ET4A 1EP3B 4O3OA 4J16C 5GQSA 1CRXA 1QJCA 1W581 5I8WA 2OQVA 3RC2A 2H92A 2Y0PA 4YCSA 1GCIA 3L79A 3ZHVA 2WW8A 1QORA 2QUZA 5FUMA 3PR4A 4KIFA 1EINA 8ICXA 1JAXA 2PPLA 2DZDA 2PR2A 3AETB 4TWZA 4YBZA 3H1FA 5CYFA 5E1BA 1TU4A 1Y7HA 2HNBA 4J8PA 4XI9A 1TUEA 2W9CB 4BDSA 1QYCA 2A1UA 1GPMA 3RAPR 4IQVA 4OVKA 2GJKA 2OWEA 4OYYA 1ZIDA 2KLBA 5KKAA 1UWLA 1W2WB 4JUZA 1LVGA 5I7SA 2C59A 4ZQCB 1HKHA 2EC5A 3Q2IA 3QLTA 6ADHA 3BTUA 1SG9A 1FOEB 1PL8A 4IH9A 2C9YA 2Z8YA 4YRNA 1L1RA 3ZJUA 5CEFA 2ANCA 1R8SA 3BE6A 1CDZA 4WI1A 5FUWA 3OIVA 1KVQA 3GUCA 4G81A 5F1PA 1JS1X 1VSUA 2XVMA 5SYAA 4RFLA 5HZGA 5CB4F 1GKUB 3MBIA 1P7DA 1FNMA 1WMFA 3SAFA 3SZ2A 2VUIB 4L6CA 4LGCA 3UB3A 5JANA 4KV7A 1JWAB 3WO0A 2ZLBA 2N42A 3WRYC 1E3DA 3JD1A 3OJFA 4JVNA 4FR5A 2JGJA 2R6FA 4S1VA 1N1DA 3OE5A 2BCQA 3OKCA 2UXBB 4MZXA 2QGFA 2VAPA 4L72A 3ZI4A 1GZ4A 1SCIA 2LTAA 5AI4A 1YIAA 2YXDA 3KSDO 2BDUA 1JDVA 3ZDQA 5LMNB 3EIWA 1SOWA 4H31A 1MXFA 3D3JA 3AILA 3EC7A 4DCGA 5SY4A 1ZMRA 1S8OA 5AKJA 1TZBA 5EWJB 3AEVA 4ZYVA 4CIBA 4PXYA 3A2KA 3CVOA 1JXEA 2AG6A 2I6FA 2Y66A 3FMVA 3T4EA 1S3SA 1Z82A 4DUGD 2D54A 2G80A 3GA0A 2BP7A 4G97A 1OIVA 2IIVA 2ERCA 2VSOA 3A9VA 3L92A 2QD5A 4PBRA 2OQRA 4D9IA 1JFFB 1UDCA 3IAM1 4QZEA 5AYVA 4BNVA 4MA5A 2BVNA 2OFOA 821PA 2DBYA 2GESA 1HUZA 2QT1A 3BSSA 4FXOA 2XAAA 3QFTA 1M6NA 2OHGA 3TAUA 5CA0B 1LJ8A 1MAHA 2Y1WA 1KFCB 3Q7RA 1TYZA 2AYXA 2CV0A 4AUKA 4LZOA 1V85A 4US9A 1NVKA 2H9IA 2V5AA 4UD6A 2GK4A 1OJLA 5E6RA 4CF4A 5SICE 4Q1VA 3DC2A 2FRXA 4MX8A 2WWFA 3JQ7B 1OXXK 2EYQA 4WVLA 2SNIE 1WPXA 1C80A 2IHKA 3LAWA 2MDTA 3QEMB 4TYWA 5CHYA 2H59A 4HEA6 3RH5A 4EQ6A 3O8LA 3PG5A 4X54A 1U4BA 4KO4S 4C0BA 2GPYA 2CVZA 3WBKA 5B30A 2O8FA 3THSA 3JAKB 4C7ZA 2IX9A 4WZ6A 1XRQA 1IHUA 2HCRA 3N8NA 4BLRA 2BCSA 3FMOB 3RSCA 3WLPA 5LDHA 3G5MA 4MUBA 1AQIA 1RU3A 1U7PA 3AP2A 3DD1A 4W6QA 3U4DA 4DVJA 1CVIA 5CIWA 3BK1A 5KSPA 7ICPA 5KFMA 1NURA 5EHGA 5CGZA 1ISSA 4EYEA 2DL0A 5KG6A 3ICVA 1I1OA 8ICNA 2CDBA 3FFBA 4WECA 1ZYQA 3GJ6A 2PDAA 4IXMA 4IIJF 1OWLA 3K5IA 4CM4A 2JLWA 4ZT4A 1E94E 3PWZA 4GU5A 4ZODA 3VR4D 1T34A 4WOBA 3IEVA 1G5FA 2W2XA 2Y05A 1AD2A 4M21A 3LPLA 5KQLA 4I2BA 4A2PA 4WBNF 1ABBA 2PZGA 4J6FA 2F48A 4ALMA 1PL6A 3CIOA 2V4MA 4J9UE 4ABTA 2QM0A 5FJJA 3GUUA 2OH2A 2W2VA 2OXOA 3NT5A 2PEYA 4WXMA 3RVJA 4BLUA 4BRSA 4DMUB 4Y2YA 1JG6A 2FV8A 3IAEA 3WLMA 4CODB 2QOEA 4U2EA 3VV2A 4BOYA 5A0LA 4DV2B 1I51A 2UYQA 1UPAA 4JLKA 1R0CA 5HE8A 1RLJA 1FY2A 4F2SA 2C22A 1E1LA 2LRHA 3DV2A 5FI0B 4QXQA 5A0TA 2QE7A 3MYRA 2F76X 2C07A 4KN4A 1U2PA 4EYHB 4GX0A 2I9KA 3LPDA 4AZSA 2HBYA 5ECDA 4QYMA 1DIRA 3R3UA 5LQCA 2FUG1 1Z6XA 5HQ3B 5I7WA 5JZ9A 4QZFA 1W76A 5CB6A 1S8AA 4TLDA 1M75A 1BCSA 1Q84A 2VKTA 3TW8B 2PX0A 1ZJJA 4B4OA 3FWNA 3RHSA 2BTQA 4DSEA 2JHCA 1P1KA 3O1JC 5AXAA 2W8BA 1VKRA 3D0KA 4OX9B 5JSUA 4J9QA 3QJGA 1QPZA 3H1PA 3JZAA 4ZT3A 2MUTB 3CVUA 2GJAA 2PH5A 3O9ZA 2HJWA 3MDAA 1C3OA 4YB8A 1F1JA 1NMQA 1SC4A 3PJFA 3AWDA 3RGWS 2F59A 2VIXA 2D1QA 4WNYA 3OJCA 1PSZA 4FFVA 3TD2A 1TC2A 4KMOB 1BKYA 1F0KA 1X92A 2AMFA 3OX2A 4U0KA 1KEKA 2VJOA 4V0KA 1IIBA 4MJ3A 4WN9A 1MT0A 2YZ7A 1Y3DE 2EF1A 2PKCA 4K05A 1Z28A 1O57A 2AFRA 3MJHA 2Q5HA 2PSEA 1W75A 3FRHA 3Q8XB 4G0YA 1H65A 5EVJA 3WWDA 4G0VA 4R8RA 1NZPA 3BBLA 3IS3A 1Q1ZA 2YRXA 1EBUA 3BXOA 3ZU2A 1AKVA 4ELTA 2PAFA 1G1MA 1UBFA 3V6JA 3P4XA 2P77A 2GNAA 2P2CA 5BRJA 2CV2A 4H0CA 4JI1B 4AC9A 5HUJA 4CM8B 2C7PA 4HNGA 4JLNA 1OC4A 3W5UA 4QT4A 1P60A 4JL8A 4PVDA 1CULC 4IOMA 1M5TA 1YKSA 1H2YA 1T9AA 2GFHA 1L3CA 2PBLA 3E9MA 2EZZA 1SVKA 4RXTA 3T7TA 4PGGA 2J6CA 3GZTB 5LMUB 2GKOA 2JFXA 3AQIA 3MS2A 4B74A 4AUMA 4UB6U 3NEPX 1QRUA 2EDCA 3PUVA 4MPTA 3LIIA 5AK3A 1R9GA 5HTKA 1D2CA 2WD7B 1ZQKA 2FMIA 4RT3A 3WYBA 2W3RA 3VOAA 3G2MA 5DWVA 3SM3A 5TT0A 5M29A 1ZHOA 4O08A 4URHA 4OLHA 3Q3CA 4LJXA 2IHNA 2P9YA 3FDZB 3UHPA 3I39X 4D6YA 1SKQA 1GTRA 3ZBUA 1TM4E 4MW7A 4O9MA 1MDBA 3EQ9A 4NYJR 5C5DA 1XN4A 2A33A 2E89A 1T3SA 2ICAA 1PF7E 2GEUA 3D6FA 3F49S 2XCSB 4HWGA 3AZPA 1GV1A 4G85A 2OC4A 5GVRA 5BOSA 5JCJA 2P69A 4WA7A 1C7ZA 3CLUD 4TQSA 3J81A 2QJOA 3FGNA 2MA1A 4B1FA 1C3OB 4ECRA 1IN7A 2EWVA 3ZEIA 1AKTA 1FLDA 2IOQA 1AQYA 5CGQB 5KG2A 1X87A 2BKEA 5YASA 1RZRA 4YAEA 3BL6A 1RXCA 3FNFA 3LLUA 4KAAA 1T43A 1HGXA 1YDGA 4XM0A 3PR2B 3KB2A 4KQEA 4M7WA 3GJXC 1T9BA 2B30A 3PUZA 1JPNA 4XQCA 1QYWA 5AP9A 3CZRA 1Q1GA 3LUCA 2EZXA 2O0JA 4ZCPA 4BX8A 2IZ0A 2ZYTX 2VHXA 4XLZA 2C5LA 2A0WA 1UFQA 1IULA 1SVOA 2OUIA 3K2EA 2OHHA 4V0LA 2AXQA 3W06A 2ZM5A 2W9MA 2FZEA 3D5TA 1RYBA 4MIYA 4AZVA 5KOHB 5DN6D 1Y9EA 4QZBA 1O0BA 1QKKA 2KM1A 2OOSA 4GYKA 4DIDA 4OHYA 2VOEA 1LBTA 5J2BA 4OEHA 1T3GA 4XIYA 3WO1A 5CEEA 2C95A 3TD6A 3COZA 1Z6TA 3Q5DA 1Y8QB 1M76A 4WJZA 1JHZA 2JI4A 5A4KA 1DJPA 1YZQA 5LP6B 3S68A 1C30B 4DREA 4P80A 2C1XA 4IIYA 2J0QA 2GAIA 3NC1C 4KN5A 4Y9UA 2X7JA 1KYIA 4M04A 2CXHA 4NH0A 3DHYA 2F7SA 5EKTA 3T95A 3ZZNA 5TGZA 5BUZA 3SJAA 3M6VA 4O4HA 2PLNA 1MF7A 3PX6A 3K09A 3KKAA 1F3LA 3GIKA 3PFIA 4CM4B 1XTPA 2WDZA 3SIWA 4ISCA 3WMFA 4RZSA 5ALRA 3FOEC 4RQNA 1T4DA 3F0TA 5LPNA 3GCXA 3ASZA 3LDGA 4ZOEA 1M2EA 3FHCB 3K0CC 3GFQA 1CUCA 3KEFA 2F4VB 1MA7A 1YC5A 3M4YA 5FX2A 3E9DA 3EEQA 2J9XB 2XMRA 3F5DA 2XXJA 3IVAA 3WWCA 4XFKA 5AHOA 2PTGA 1H2AS 1RSZA 2BUCA 4C2UA 2H1CA 1EM8B 1T1IA 2P0EA 2QJFA 5ALFA 1SN7A 4IGKA 4MLZA 2GD1O 3F7OA 1R6TA 4DW8A 2BMAA 3RB8A 4B3DA 4U6PA 2Z8ZA 1OUQA 3F3SA 4YCAA 3RTDA 2QGZA 1L7XA 4Q47A 3V33A 3BWDD 4ECQA 3F6CA 1IZYA 1TIKA 2X0JA 3ONWA 3P9IA 2WV9A 4DO9A 3W04A 2EP7A 3IAAA 1S0VA 1XSNA 4WOKA 5JJCA 3COVA 4R9SA 1YKFA 2W2MA 3FJOA 2IX3A 4QTYA 1BXKA 1NHGA 1GVNB 3U0BA 2FZ5A 2FMTA 1IQPA 1OF1A 4D42A 1IXZA 2UVPA 4UUNA 3RYIB 8ICAA 4U7GA 1NQVA 5JFOA 3HC7A 3S6JA 4X1OA 3U5ZB 2VT7A 3HJHA 1MG5A 1H2WA 3KQYA 1DEOA 4I1RA 3KVYA 2IRWA 3ZHCA 3ZZUA 3PLAE 2OV3A 1ECGA 3OTHA 4MRMA 1UEXC 1YT5A 3SV4A 1JFFA 2BHLA 2HPZA 2PWBA 2W9XA 2J0EA 2Z2YA 4UHCA 2YZNA 2HA2A 4HPXB 1WZCA 3TKAA 2IHMA 1RT9A 6LDHA 5F3XB 2WJJA 4A1FA 1BN7A 2B35A 3O38A 4ZAYA 3DONA 5BSUA 5CDHA 2ZWOA 3O8DA 4U6SA 2H00A 4PZDA 1P81A 1JDSA 1RZ3A 3JAWB 1OTHA 4GVXA 4QNMA 4DARA 2C4NA 2BMJA 2O5RA 2QVCA 3H9CA 3A37A 4GQBA 4M9XA 7ICLA 1CP2A 2R6DA 3DEAA 3DVRX 1SELA 3GGPA 3H3FA 4GI3A 4QXMA 2IYUA 4X66B 2HHHB 5TVGA 1OBCA 4KO3S 2HN9A 1N2EA 4BLWA 2C04A 2PRZA 3PIDA 2G5TA 1EVZA 2BZSA 3AHDA 5MFZA 1OILA 4RGVA 4F96A 3OOHA 4N7RA 2FW8A 4BFTA 5JSFA 1VSVA 3KJIA 5EIHA 4O5EA 2Q2VA 3VPCA 4KZPA 4TGLA 4U9IS 2X0IA 5MN5A 3FNHA 3RKRA 1Z0JA 4CEJB 2M6KA 3ICPA 2GBIA 3O26A 4ZQIA 3VX3A 1JHUA 4O2BF 1P9NA 3O3NB 4IQ8A 3T4PA 2QAGB 4YMVA 3VI3B 4MKGA 1U5AA 4NFYA 1JROA 1G5HA 1U8FO 1IZ0A 3M89A 1OBFO 4GSYA 2WJ3A 4O2BA 1ZINA 4L0CA 5K0LA 2EKQA 3FUWA 4CEHA 3V1KA 3PGA1 3EX7C 3KB8A 5IUNC 3GA5A 3HCCA 1H3FA 3TKLA 1O6GA 3QEJA 1GXSA 5B36A 1OIXA 2OMEA 1M1UA 4WVFA 2ADFA 3FDIA 5DWDA 4I2IA 3LY5A 4EY7A 3IOMA 3UYKA 5AW1A 1J42A 5LA6A 5LL6P 3LHDA 2PT9A 5BYJA 3T94A 4BNGA 4W5OA 4HI0E 3IQWA 3EGEA 3F74A 3KAKA 4Z0PA 4MRMB 3H1EA 2HLDA 1Y82A 3GFRA 1AGNA 2I34A 5DJ5A 2WSLA 3SMQA 1YAHA 2ZAMA 5M5BA 1X42A 2HA7A 3AHIA 3D7MA 7ICIA 1Y3FE 1EESA 3HLTA 4P0QB 1X39A 5KFOA 1YGPA 3F4LA 5K8CA 1Z63A 2ZBPA 4E3WA 2G0TA 2YYYA 3Q8WA 3CGWA 1J0BA 3CRRA 1EB9A 2CK3A 3ZE8A 1JG2A 2X5OA 3HYCA 1N92A 4BV2A 4MUXA 4BBJA 1R3UA 1THZA 3ZCSA 3A31A 5KYGA 1DC5A 1C1XB 1UBUS 2XYVA 2A94A 3DZFA 3ELUA 2HRRA 2BSXA 2ZTVA 3D8SA 3HB0A 5ULLA 3ELBA 5CA0F 4I66A 3H7IA 4OL9A 1QYRA 3V32A 5U9CA 5I4KA 2XB6A 3PUXA 2WU1A 2IOYA 2VJNA 1ORVA 2IDKA 3HHEA 3I0ZA 3ST7A 2ATLA 4ACOA 1JA1A 1U7WA 4HQRA 5FCDA 3ROMA 2WINI 5KHAA 3ZVKA 1HFJA 1Z2NX 2WKSA 4HDQB 4OREX 3I92A 2I55A 1L5SA 3WGUA 1QG2A 5FPKA 3CUSA 2DUUA 4I5FA 1RYSA 5DG7A 1XVLA 5CTAA 2ETVA 4P9NA 4CKBA 1LLQA 4NLNA 1Y1SA 4TKVA 2QL6A 2NRWA 1KEJA 4MEBA 4MUKA 3H0RB 2QTWB 3A1WA 3JPPA 3GHHA 4DLXA 1LNQA 5F3RA 3W7BA 3P8ZA 4KDEA 4D4LA 2F8SA 4C6TB 4EX7A 4M9UA 4R0VA 4DWIA 1UC8A 1DU4A 3ENKA 4Q7QA 5T4HA 3N3BC 4FDUA 4WKPA 3IDOA 4BJQA 1JHVA 3UMJA 3BD8A 2KJQA 4E5NA 2QXTA 5K09A 1ENZA 2O8CA 4MPDA 5DIFA 5KB3A 1CIVA 2P6MA 1WZNA 4LCEA 2QN2A 4QPZA 4TUSA 1AQUA 1YI1A 4REOA 5BOVA 3WKEA 1QLHA 2E37A 1MTOA 1WX1A 1A8IA 1QFZA 1VSTA 1XTBA 4UMFA 2BTEA 1M72A 1GUBA 2ZGVA 4IR9A 1KMMA 4RGQA 4O1HA 4ZYTA 1IQRA 1XNHA 1ZH0A 3KFUF 2BKAA 4I6EA 4DWWA 4IQUA 2DY0A 3QUSA 2XRZA 3AFIA 3DFZA 5FF9A 4IXWA 1VBMA 1QOQB 3K9BA 3V7JA 2MU1A 3L1JA 3WL3A 3GV8B 1FYEA 4HDCA 4LRXA 3WMWA 3KKQA 1SKWA 4LYDA 2H07A 3FOAA 4MQ4A 1WSDA 3H6GA 4MI6A 4KU4A 2F3RA 4D25A 3UUFA 1PFVA 1N8TA 5ARBA 2NO9A 3AKZA 3DLBA 2HHQA 1V6SA 1JLLB 1G7TA 4OHRA 4YLEA 1T1RA 4G09A 1IK6A 4N4AA 4XA8A 1RWBA 1BS1A 4ER7A 4MARA 1KF0A 2VZ0A 3L49A 5CFPA 4XD7D 4BQRA 3QG5A 4Q48A 4R1SA 2D0IA 1U31A 1VL6A 4U7DA 2CJXA 3IE0A 4W5WA 1NRXA 2XBUA 4RJ2A 2DLDA 3F6YA 3IPLA 3HBLA 3KYCB 3NJ8A 4OXRA 2Q3CA 4QFDA 1K7SN 1XRSB 4JMUA 1PR1A 2ZXEA 3G9XA 3ICOA 4YP7A 4C43A 2OY0A 2Y1CA 3OTQA 7ICMA 2H3QA 1HFEL 1L1FA 5LLDA 4JV5B 3VU3A 2YS6A 1T1GA 1XRMA 4YP9A 5GZ6A 2J3KA 4QYIA