2I6XA

The structure of a predicted had-like family hydrolase from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
208
structure length
205
Chain Sequence
AMIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRFLPSGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLLREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title The structure of a predicted HAD-like family hydrolase from Porphyromonas gingivalis. (CASP Target)
rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
total genus 73
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2006-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2i6xA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i6xA01
2MSNA 1EK2A 2MU1A 1L8LA 3R4CA 5IS2A 2G0AA 3QGMA 2AGVA 3DV9A 3NIWA 2WF5A 3ZVMA 2W4MA 4UATA 4L6CA 5AW7A 2BY4A 2I55A 4YCLA 3WK7A 2IOFA 2WHEA 5AVSA 5ALKA 2D2VA 3WKAA 3ZVLA 2HCFA 3WKEA 3CNHA 1Z4PX 1YDFA 5ALLA 4EX6A 2GHTA 2RB5A 5AI8A 5AW5A 4Y2JA 1S8OA 5IT0A 3E58A 5AI0A 5IT4A 1QH9A 4HGRA 2YFYA 1SU4A 5AKGA 4MUMA 4FYPA 3QXGA 2ZXEA 2CN1A 4UW9A 5AVRA 2R8EA 3PGLA 1LVHA 1CR6A 4L57A 2JAOA 1O08A 4KNWA 5AVYA 3SD7A 4DCCA 4UMVA 5ALMA 4CNQA 3FPBA 4BX2A 4C4TA 4KNVA 4EEKA 2I33A 1ZD5A 1U02A 5AVZA 5AHXA 3R9KA 5E0OA 1SWVA 4Y2UA 3MMZA 3L0CA 1QYIA 4NABA 4J03A 1QQ6A 4HGOA 1VJRA 3DNPA 2Q5EA 4Y2TA 4NV0A 4NAVA 4L6AA 3PGVA 1XVIA 2FUEA 3SMVA 3NANA 3WKCA 3ESQA 3WK9A 5AKJA 2RBKA 3TLMA 4Y2XA 1PW5A 2EATA 3L0BA 2G80A 1TA0A 3WK6A 3L7YA 5AKKA 3KZXA 3MC1A 4HGQA 2B1RA 2ZBDA 4BEVA 1S2OA 1ZD3A 3BWVA 5AW2A 1T5TA 3F9RA 1RQLA 2G1AA 5ALUA 4Y2RA 1U2TA 4BX0A 4HAIA 2HX1A 3L1VA 2W11A 2AH5A 2I54A 3WKBA 2HI0A 2YMLA 4CF4A 3U7GA 2HHLA 3ZU6A 4YIHA 2FEAA 3I28A 4G63A 4F72A 4QQFA 4GIBA 5FP0A 3HLTA 5ALXA 3SF0A 3RFUA 2B30A 4NFLA 5AESA 3AR8A 5AW1A 2I7DA 3R09A 3FVVA 4XOUA 3U13A 3A1DA 3U7FB 3L5KA 3N07A 4J2TA 5AK4A 3L8GA 2C9MA 1RLOA 3U19A 3HYCA 5AM3A 1L6RA 4HGNA 5ALYA 1RQNA 4PNHA 2CFRA 1EK1A 1N9KA 2WM8A 3QUTA 4EELA 5ALIA 1VFPA 3N1UA 3ZWDA 2HF7A 1T5SA 3UM9A 2G06A 5ALHA 3ZX4A 2R8ZA 1YV9A 2FPRA 3ZVNA 4E88A 1Z4LA 1Y8AA 2ZBGA 3N28A 2ZG6A 3ZX5A 2O2XA 2NYVA 2C8LA 3KOOA 1Z4NA 2GFHA 3ED5A 3RF6A 1J8DA 4UU1A 2NO5A 1J97A 2FI1A 4CE6A 2YJ4A 2IA5A 2DQSA 4NWIA 2YMPA 5AW0A 1L7OA 4YCMA 2YN4A 4UMFA 2W43A 5AK5A 2P9JA 4QJBA 2IYEA 1TE2A 3U26A 5AKXA 1YJ5A 1ZS9A 4Y2YA 3KC2A 1X42A 4MWOA 3EF0A 4UAVA 3AR6A 5AI4A 3AR9A 3WK5A 3QU2A 4XPZA 2P27A 3NAMA 3AR5A 1RLTA 4BKMA 4I9FA 1ZD4A 3NALA 3B8EA 2C4NA 4UM7A 2PR7A 5ALRA 1YS9A 4OCZA 3OPXA 5ALSA 5A3RA 2JGAA 4UM5A 4UAUA 3E8MA 2FPUA 3WGUA 1ZOLA 5ALJA 4Y2SA 4ZEVA 3L8FA 5AKYA 1TJ4A 1Z4IA 3KDPA 1L8OA 2G08A 2G07A 5ALWA 2G09A 3E84A 5ALEA 3W5BA 3WK4A 3QU9A 3GYGA 5AK6A 5AKHA 5AVQA 2QLTA 1TJ3A 3ET5A 3AR3A 3KD3A 4AS2A 4IG4A 3OCZA 4RETA 3QNMA 3IB6A 2OYCA 4EX7A 4ZEXA 2O9JA 5AIBA 3L8EA 2B1QA 2QYHA 4HYTA 2PQ0A 5AM5A 1K1EA 3S6JA 1Z4OA 4DFDA 3SHQA 2P11A 5T41A 3M1YA 2JAUA 3NASA 3AR2A 2JARA 3MPOA 4UARA 4F71A 1YNSA 1WR8A 3B9RA 4AP9A 1RPZA 1Z4JA 1TJ5A 4BNDA 4KYTA 1RKQA 4EZEA 3OCXA 5AW6A 3ZUPA 1ZD2P 1RDFA 5AM2A 1N8NA 3FGOA 2X4DA 3OCVA 2OM6A 1F5SA 4JDPA 1Z4KA 3QYPA 2R8YA 4BBJA 4B6JA 2PKEA 3QUBA 4AS3A 5ALQA 1Z4QA 4UMDA 4C4RA 5AI6A 5AVUA 3WKDA 5AW3A 2I34A 2Q4TA 3I76A 4BEWA 1ZJJA 2JAWA 3K1ZA 2MU2A 4BYGA 1U7OA 2CFTA 2HO4A 1RLMA 2C88A 1ZRMA 4XQ0A 5AVWA 4G9BA 5ALFA 4YGYA 1SWWA 1NF2A 1RKUA 5ALOA 3MN1A 2GO7A 2B8EA 4UU0A 2AUTA 2RAVA 3W5CA 5ALZA 5AIAA 1FEZA 2OA0A 1T9ZA 1U7PA 2B82A 5ALDA 2FPWA 1Z4MA 3P96A 5A3QA 3ZWKA 4KX3A 4H1WA 5ALGA 4YCNA 1WVIA 2YY6A 1RMTA 3QX7A 1RKVA 3AR7A 3UMGA 3KBBA 3B9BA 3L8HA 1NNLA 1WPGA 5JJBA 3A3YA 5AW4A 4ZEWA 3M9LA 1Q92A 3N8GA 3D6JA 3ZI4A 3OCYA 5AVVA 5AVXA 2YMMA 1VJ5A 3CZ4A 4DW8A 3I6BA 2IOHA 1MH9A 3SKXA 5AW8A 2FPXA 4EENA 1KYTA 4XE5A 1QQ5A 3DDHA 3QU4A 4RESA 3UMBA 5AW9A 3ZTYA 4FFDA 1NRWA 3VAYA 3ZTWA 3A1CA 1RMYA 4OD0A 3DAOA 3QU5A 1U2SA 3A1EA 2YMQA 4IFTA 1RRCA 1L7MA 1XP5A 3EPRA 2HSZA 3AR4A 5AKLA 4DWOA 2Q4RA 2WF9A 5ALVA 4HGPA 1L7PA 1QQ7A 1JUDA 5ALNA 2I6XA 5AVTA 2FDRA 4I9GA 5AM4A 4FE3A 2WFAA 3EWIA 3W5DA 2NO4A 1RMQA 3FZQA 4CF5A 1AQ6A 1O03A 5AICA 2FUCA 4OFZA 4UASA 4Y3UA 4O8CA 3QU7A 2P69A 2EAUA 1XPJA 3SLRA 3SKYA 4JB3A 4KN8A 3QUQA 1Z88A 3U7EB 3OTQA 1L7NA 5AI5A 1Q91A 3PDWA 3FPSA 2YJ3A 2WF6A 3U7HB 5AI9A 3QUCA 1LTQA 2WF7A 2C8KA 2R8XA 3ONNA 4BX3A 3N5KA 2CFSA 3IRUA 1WZCA 2B8JA 4BNDB 3FM9A 3WK8A 3WGVA 2GMWA 1ZRNA 4Y2QA 5AK3A 4UMEA 5AKEA 4OHFA 2WF8A 1Z5GA 2ZBEA 3L1UA 2HDOA 2YJ6A 4YIKA 5AM0A 3NUQA 3OCUA 2YBDA 2IOFK 3I1YA 3UMCA 3NRJA 3W5AA 4C4SA 2BDUA 2BDEA 3L0YA 4KX5A 5AM1A 5AKIA 4Y2VA 3ET4A 3J7TA 5A3SA 3E81A 3BA6A 2VKQA 2HOQA 5ALTA 2RARA 2FPSA 4GXTA 3QLEA 4YH1A 3ESRA 2OBBA 2AMYA 5ALPA 2B0CA 3ZW7A 2ZOSA 1YMQA 1CQZA 2HEGA 2HF2A 3IJ5A 3EF1A 4Y2PA 1RC8A 2ODAA 3OCWA 3PCTA 1IWOA 2GHQA 1Z5UA 4CF3A 2EARA 2YJ5A 5AKZA 2ZBFA
chains in the Genus database with same CATH superfamily
3GNQA 1GFWA 5F51A 4V1CI 3KQUA 1EFCA 2NSJA 4ZDIA 4QODA 4X8OA 4QQKA 1ZC3A 2ZRCA 2ZAGA 2Q1WA 4GSYA 4HFMA 4KUGA 1E0DA 1WUJS 4LJSA 1NNI1 3FYUA 2YHBA 1R15A 2JDID 2B2NA 4CQMB 5ESRA 3FCEA 1R5OA 3IX7A 3UWPA 5EQTA 1OOEA 1K7CA 2PFSA 5BQ3A 2PL3A 4F8RA 3I45A 3AUOA 1TM1E 2JLWA 2O2EA 2ASEA 1HURA 3P27A 5LB2A 1SWVA 5BT8A 1Q0PA 1MRNA 5HF6A 4LECA 1TQ8A 4YFKA 1HYEA 2W6MA 4KK3A 1G8MA 2PWYA 5GIPE 4BNVA 4OUDB 4OF4A 4H60A 3LC2O 1VGQA 1EUDA 5EC8A 4MUHA 3PC3A 2VK1A 2NVBA 1U6JA 2PR2A 1ZLYA 2AEEA 3SIXA 3E7DA 3TX2A 5LXTF 4IXWA 1OFVA 5IM4A 3GDHA 2JVKA 3TTYA 3X1YA 1SN7A 1TA4A 1H5NA 3GH3A 3L7KA 1JDJA 2Q6IA 4PGMA 1QG2A 1ZXBA 4R16A 4LYFA 4N3NA 4UUAA 2OCEA 4YPVA 3KJGA 2X9NA 3HFSA 4K26A 4HAYA 1MGOA 4PC7A 1IYZA 4KLZA 2V4MA 4YFVA 2ZIWA 3HABA 5BPCA 1T1RA 3NEJA 2J46A 3HSSA 4UTPA 5FWYA 1V95A 2ORIA 2H7XA 3X1DA 4YBRA 1PBTA 3N9IA 1PTKA 4OSPA 3B60A 4BATA 1K75A 1OLOA 1ZQRA 2XDYA 3DPIA 3RWBA 3ZH2A 3GDXA 4BKMA 3FOCA 1KI8A 4XUDA 1JE1A 3A27A 2QTMA 1BX1A 1LLQA 3GT7A 1G3MA 4JASB 3ND8A 3OZWA 4W6QA 1E77A 1QRDA 1CCWA 3QU9A 4CTJA 3TKLA 3EZLA 1K5PA 2G9RA 1SHLA 2HZBA 5CW1A 5JAZA 1HE3A 2VYNA 5C1BA 5FO1A 5EY5B 4QWEA 2AN5A 1XS9D 1E6KA 4NYMR 1J8YF 3T1HB 3JPTA 1NN3A 4JY7A 4X7RA 3HU1A 5HR6A 1IVYA 2O7NA 2ZU6A 3G0CA 2M6LA 3QYPA 3O7WA 2FZGA 5JCPA 3KAQA 4Y6PA 3HR7A 4BEWA 4GP9A 2D1RA 2JAWA 5B53A 5K2OA 3IBCA 4G9BA 2C2DA 4GOND 3MCTA 4RELA 1WYGA 4BKRA 2VP5A 1DC7A 1RYNA 3L0SA 1I3KA 1XKTA 5EJAA 4Y9TA 5A3QA 3VMMA 4ZI7A 4H15A 1QC5A 1TCUA 5F7XA 2O57A 2FMKA 1XG5A 3B9BA 4U7TB 1KC3A 1VBNA 3LT2A 1SQGA 2YWHA 4MWZA 1JLKA 1E4VA 1S3IA 4C8LA 5HUHA 3NEPX 1CSEE 2XVXA 4L51A 3FFBA 4QZFA 4IXNA 3RUPA 3W90A 4MS4B 3EPRA 5EZYF 1YH3A 4IIFA 4QRHA 4EHIA 2ZP1A 4GBGA 3H16A 2LW7A 1S4QA 1IU9A 5JALA 4C03A 3ZI0A 4CM8B 4JI0B 3CGWA 2VTKA 4CMEC 1VG9B 2XQIA 3EZ9A 4G97A 3FYDA 4KIUA 3PDWA 4BXOA 1L7RA 2VTVA 4KWCA 2NMVA 1A96A 2ZUSA 3CLRD 1E2GA 2QAGB 2XE8A 5M3BA 1FFXB 1L5HA 7ADHA 2ICAA 4AD8A 1X8XA 4DR3B 1MC5A 2N42A 3D4BA 3I1YA 1S3GA 4OXNA 3UB2A 4E1BA 3RRFA 2FPSA 4RV5A 3NONA 5A5FA 1T4GA 3IJ5A 3NWPA 4QYXA 2EKPA 2HQBA 3DVSX 2FY8A 4J0DA 1QOZA 4U00A 3NTLA 1RI3A 3PR3A 4KG7A 2Y1XA 1IN8A 5DM1A 1GWNA 4EKIA 1U47A 3W8FA 1UKZA 2D2VA 5CK5A 1QZZA 2V6IA 3MT8A 3SQXA 5IAAA 2P77A 3GBVA 3ZEIA 1HX7A 5C4MA 4JXJA 1JQ3A 4Q4HB 3E5HA 4E08A 3VZSA 3F7NA 1Y6QA 2DULA 3IO3A 4CF7A 3VX4A 1WNTA 3TZCA 2F62A 2P1RA 5B55A 2XIDA 3T95A 4ESEA 4X6UA 1KI2A 2FFQA 1QSLA 4PTZA 1Q77A 3HCEA 5DX8A 1YRWA 1ZNWA 4BWVA 3P9KA 4LW8A 2NRXA 3W3AD 2JBAA 3Q9SA 4TM8A 1A4UA 3KFVA 3EYAA 2VJKA 2KFZA 3G2KA 5DN6D 2WHYA 5AW2A 1ECFA 4X60A 5KNIA 4XQ9A 2BC9A 1W0JA 2GEDA 1NVFA 4NDNE 1QPZA 2YHAA 2M9MA 1I32A 2GCOA 4UNIA 1JN3A 1BN6A 5DM0A 4LZGA 4LWQA 2FN3A 2PE5A 3NO4A 3KT6A 4YAUA 3ITNA 1PJ2A 4UQLA 1BN7A 2XUKA 1U3FA 4JT4A 4M86A 3M7DA 2NIPA 1F6DA 1QHFA 2DUUA 1BC5A 3R5HA 4ZI5A 3RYFB 3LKZA 1ST3A 2I9PA 1N92A 4LYAA 1PJLA 2BMJA 2FMUA 4PQFA 1YJ5A 4RY0A 2D5CA 3QA9A 1NY5A 3VUEA 5C4IA 4JCCA 4BMCA 3GQVA 5EWLA 2PCJA 3HRIA 1XWFA 3BS4A 4J1TA 5ILGA 5G5HA 4PC2A 5CT5A 1WMBA 3MHTA 1VCNA 4LC1A 1IIPA 2N1RA 1H3FA 1IZ0A 3ICOA 4OI2A 2YYSA 2ZS9A 5KU7A 3RBVA 1T8RA 4D4HA 1R0RE 3F97A 2H9IA 2HHVA 1LRLA 2IYWA 4YCCA 3D8UA 5AM5A 4ZYZA 2DSTA 4UNQA 5BNZA 4UUOA 3JWEA 1FUEA 4KLNA 4WOKA 5GPBA 4PXSA 3AVYA 1I7NA 3QPVA 4BKUA 1EDDA 3T38A 5T7BA 1RXIA 3TI0A 1GTVA 3TPFA 2ZTSA 3FRHA 1PJ8A 2L2QA 5FDFA 2O48X 2ZKLA 1KZ4A 3SZMA 1JB1A 3TO5A 1M0SA 2CHEA 3BDVA 5AVUA 1LEHA 3S99A 4PSKA 1F6WA 4M0UA 2LM4A 2QUBA 3ABSB 5B1IA 1Z1VA 4COKA 3ACBA 5A1TA 3LTEA 3U3OA 3H0RB 3BIOA 1YOVA 2VHCA 1KFJB 1JV2B 1EBFA 1ICIA 4RYDA 3KB2A 1MC8A 3GC6A 2VJDA 4IHJF 1AUOA 5EJ2A 4DS4A 1OROA 4DCJA 4EI7A 1DX9A 2VHYA 2CCGA 2XNSA 4EM6A 4AJPA 4C04A 5BSKA 4ED6A 1N6NA 2BGJA 3TIIA 3ZTYA 3GFTA 1LJUA 4FZVA 1VRVA 1RM5A 5L1MA 3VYSB 1U9CA 2FPOA 1T5IA 3GEEA 3PQ4A 2OZLA 2O0LA 4ZIRB 3DE7X 4QZ8A 1GG9A 2F67A 4ZOBA 3ZBPA 5I3ZA 3H2IA 4WDQA 1GKUB 3MW8A 1XCBA 3ONNA 3RVOA 4ECUA 2JH9A 3QX8A 2QRMA 5F4BA 1YR2A 3ZKWB 1J2YA 5E7JA 2PDAA 3V1UA 4X7MA 3HJNA 2ZYUX 2I4OA 5FBWB 4BCCA 4BNKA 3PZPA 2GYUA 3SM9A 3DOFA 2HHSA 3HGTA 4BTEA 1U2PA 3QUAA 2KBFA 3LRTA 3Q3EA 5K8TA 3CYFA 3HCPA 3HVHA 1P7PA 2WYVA 5BO5A 4ENQA 2E7ZA 3TQTA 2HHWA 1R5JA 1KBUA 1ORRA 1G20B 5IBRA 5IU6A 5A71A 2RBGA 4EKEA 2A94A 2P3QA 1BFUA 4NL9C 2ENWA 2C4VA 3PEEA 5JSUA 3AZQA 3KR0A 4FZ5A 3QHPA 1DIRA 4C6HA 4ETNA 2VYVA 1YCDA 3LT0A 1EFPB 3TADC 4YV2A 3V6MA 3VYTB 1NF8A 3ZDZB 2AEFA 2I3DA 3ZTTA 1FQWA 3GZNA 1KP3A 3GLGA 4RVOA 4OJOA 3ZDEA 4LWOA 1OTYA 3BMQB 5DBOA 5EIHA 3NBFA 3E27A 1M1ZA 3D1JA 8ICFA 1RHMA 2C2YA 1KO8A 1W5BA 1SR8A 3HILA 5JBNA 3BMCA 4Q3EA 2HFKA 2YWCA 3HQ4O 4X63A 2ECOA 3OIVA 3L7CA 4JYAB 1OYOA 4RIEA 2AMLA 5HCNA 3L4SO 5B2EA 4CV3A 5KYGA 2PSJA 4PSAA 1NTOA 1W73A 1XZJA 2GZSA 4BB5A 5KWJA 2UVRA 4CF4A 2O6LA 4KZKA 3WY9A 5AJYA 4XOUA 1JFSA 4I55F 4F6CA 2QD4A 1AF7A 1LZKA 1RLOA 4G1FA 4PZDA 1N2OA 1K1QA 2KHQA 4PQYA 4RNOA 3SJUA 4DAEA 1V9LA 4A1FA 4HTFA 3VU9A 3ZX4A 1OU0A 2CUKA 3UFXB 4E1AA 4LBWA 1Y8CA 2V6FA 1H3EA 1AY0A 4ZXPA 3KQNA 1XBTA 4MGIR 2BISA 5L1LA 1K08A 2BYTA 5JASA 1AC5A 1EFRA 1OREA 1UBMS 4IZOA 4FGSA 4QOJA 1RWKA 1GKIA 4WW0A 3TZLA 5EHGA 5DI9A 5A4KA 4CV0A 2ODTX 3S28A 4UAYA 3K1AA 2OFOA 1BXRB 2A1JA 3WSVA 4AS2A 1VKRA 5KT2A 5T57A 2OFFA 4BN5A 2F2AB 3A10A 2W2LD 5E6RA 5CB4B 3B6ZA 4AY4A 1J8MF 5DNUA 4MVJM 3GEPA 5JNLA 1QV9A 4AZ0B 1O6ZA 4IJKA 2IZ1A 4KYTA 4AZTA 5J2UB 5E6SB 2J6HA 1LWNA 4BE4A 2Z98A 3FGOA 4AKSA 5H3CA 4QJFB 4LBYA 4HUTA 1EM6A 3QUBA 2VZEA 3N2GB 2NM0A 4CR7A 2Z5VA 4EYKA 3L0ZA 1AGPA 1SXDA 3BFXA 3WRXC 1N6HA 3A1VA 4KH0A 3K1ZA 1PVRA 3QY9A 2E1RA 4BBPA 3MK31 3M4NA 3PBKA 4GXKA 1RCUA 4X61A 1UP4A 2P6PA 1F48A 1Y1SA 4UVDA 1PZFA 3QV1A 5D3QA 1SCKA 1ZSVA 3E7PA 3O8QA 2ZQ5A 2FW1A 3LKDA 1DKOA 4UVEA 4J6FA 2HCBA 3UJ9A 2ZDQA 2GCGA 1C3VA 1TQ4A 3CUVA 4DNOA 4WWHA 1IAQA 4O4LB 1U2GA 4F7DA 3OQMA 4IVNA 2PMCA 1NVEA 5J0OA 2R86A 4RQMA 4F9TA 3HVJA 4BWFB 1LNSA 4DCVA 2AJDA 3AU8A 1BXZA 2DWCA 3ACDA 3VO9A 3VU1A 3HL0A 2Z1NA 5ICGA 3FFTA 3DWEX 1L1FA 2OK7A 1OI3A 5CX1B 3EAQA 1AK2A 1IQRA 1MORA 1V7PC 4I2IA 2RJNA 4C5AA 3E70C 2GPNA 1OYVA 2XMZA 5C0OE 1YB2A 1W1UA 4O6VA 2D62A 4GXJA 1NVKA 3REQA 2O7QA 2AF4C 5E9QA 4US1R 5MN5A 5A3SA 2RCNA 1T4BA 3TOXA 3VC2A 3VX3A 4D74A 2IZZA 1IY2A 8ICGA 1ZM2A 4P7KA 2F17A 5EPOA 1RCTE 1XNHA 3ZG6A 2H54A 2ZI4A 3X0DA 4KMSA 4J9VA 3EGXB 3BL5A 3TI7A 1AKNA 3DKVA 2WICA 1RVV1 1L4KA 5F21A 3KYBA 1UPUA 1TU0A 1ZZGA 4I2NA 4F12A 4EB6B 3UJBA 2V96A 5BV2P 5LNK6 1FNSA 2QB1A 1W4ZA 3R0VA 5BUQA 1XNRB 1DFIA 4RQ1A 3U31A 3ISCA 4MP3A 3JARA 3ZZ0A 3D7SA 3M6WA 3JD2A 4XJXA 3JZAA 5LQSA 3EPHA 2H0AA 4PXYA 4TLCA 1U9IC 4KLAA 2AHOA 3ZV5A 4X44A 5TARA 3DFFA 2FA9A 1CHNA 4HGOA 3LFTA 5KOHB 1QPBA 1T2CA 1OHHA 2HIHA 4K46A 2XUZA 3HHEA 3IH5A 1DIGA 4QZ9A 5G02A 2FE1A 1MC1A 3MYYA 5D86A 4PZ0A 3OP1A 2Q29A 1XJ0A 4H3SA 5KFHA 2XGPA 1TM4E 3MELA 2IYXA 1CUCA 4OSEA 3ST7A 1FP4B 3H65A 3U39A 4NBUA 1MA7A 5J0UA 3WXMA 2XCRB 3M70A 3CH6A 2ANCA 4PRZA 4OQEA 4YRKA 4LZZA 3ITKA 2CSXA 1OKKD 1UADA 4CLOB 1E6WA 4DJJA 3CN9A 5A5VA 3I6ZA 1M2FA 2WPNA 2G06A 1LF5A 3HR8A 1R4NA 1XTBA 4LDPA 5T6MA 2CJPA 1MVLA 3RYHA 2Y0EA 3H5RA 1VLBA 4GLLA 1P18A 4QTTB 4ZOAA 4P3YA 1ZQJA 3THRA 3RUCA 5KX5F 1GGFA 3U81A 1NSYA 4JS0A 5KG6A 3MBKA 4F45A 2ZYDA 3GEMA 3CYMA 1WM1A 3L8FA 4MHTA 4DS5A 2R8HA 3ETCA 2G07A 2HMXA 5D87A 4NE7A 4QPDA 4AWBA 5LPNA 4DG5A 3VPFA 2D5IA 3WAGA 4M60A 4DIFA 2O19A 3OIFA 1DUVG 1PJ3A 2XWQA 4L3WA 3HUDA 2O8EA 3G82C 3CLKA 1XVVA 3N2YA 1S2LA 4H6PA 1S01A 3QE3A 4BNDA 3VR3D 3DQPA 2I6QA 2HMYB 3QIVA 3EGWA 5DLGA 4XWAA 5AOBA 5EIOA 1GPDG 3I01A 5ETJA 4EQ6B 2VDKB 1PJCA 3D3KA 1N2IA 1Y5NA 3T3OA 2HIAA 2WSSD 3TPCA 3NT4A 2C1ZA 1Z26A 1TK0A 1DC8A 3ABIA 3TW8B 1J0XO 1CK4A 4H4EA 4UB1A 1T6ZA 1W46A 1U98A 5J59A 2J08A 3DGEC 1XZHA 3D02A 1KDZA 3ISDA 4G0OA 2NTEA 4LCBA 1KYQA 4DCTA 4TS4A 4ZT6A 1K5GA 4GLJA 3QX7A 2ZYRA 4FMBB 1G8SA 1F8FA 2GYWA 3JWHA 3LY5A 3GJ5A 2XB8A 3CCBA 5KVCA 2WAMA 3Q10A 1GGHA 1PNOA 1G21A 4H3KB 3PGXA 2C2OA 2PA0A 3NYWA 2WKQA 4NZNA 1PD0A 4ZARA 3KFUF 2RHJA 2WKRA 3K94A 1RZRD 2RH4A 5I9LA 1I01A 3DMDA 1R6AA 4OHWA 1SV4A 1H2YA 1KSFX 4U9UA 2VN8A 2YFQA 3FZQA 1UQVA 4BNLA 2CMKA 1NMXA 1S2NA 4DL4A 1LBEA 2XCIA 1OWPA 2WG2A 1EP3B 1TW3A 1FP7A 2V45A 2J3IA 1WKBA 1Y1QA 3MINA 1V3QE 2DZDA 4MAAA 4A8JC 1SXPA 1FPMA 2JF0A 5T4BA 4DV5B 4ZAXA 2DPYA 4N5NA 4HNGA 1DHRA 4DR2B 1MT0A 4V3BA 4XVUA 5BSMA 3SQNA 2VAMA 5FNVF 3W2HA 4I2CA 4HLQB 2ISQA 4XIFA 4W1RA 4GMGA 4JJ8A 4KVAA 4UAGA 3HXOA 1AHNA 1SD2A 4YXWD 2HMAA 3GWGA 1FFEA 1G19A 4A03A 1O97C 1HK7A 3ILXA 4Y0AA 1ZGHA 3KUXA 1IBLB 5J47A 3TW6A 4HRXA 3V7LA 4MJLA 3QUSA 2OV1A 5BWLA 1RG6A 5GVSA 3C41J 3TAQA 1JQAA 2YHUA 4HQLA 1CY8A 1XZLA 4NLBA 4GR5A 1YZ7A 3D54D 3ZLJA 2X3UA 2C96A 5DNVA 5C8ZA 1WETA 2ZWIA 1NNEA 2FSUA 1Z0AA 1BEEA 1JXLA 1X0VA 2XWSA 4I4TB 2Y0CA 3PRJA 4G5SA 4GKKB 4L2IA 3ZPXA 2RHOA 4UHBA 4YJDA 2O8DA 3NKLA 1W6RA 1IQPA 3P26A 4QZHA 4RSRA 4RQ0A 3CBQA 1ZL2A 1ZDMA 6ABPA 3LH5A 2P9QA 1NVVR 2BHRA 4JEIA 2EEPA 1UK9A 5C8YA 4F0JA 4KQJA 4KITB 1K6MA 2ZUWA 1NYTA 2QZJA 4ZCIA 4EG4A 1JLRA 2W6JA 5LYJB 2LKYA 2O05A 3BXPA 3LFUA 1N5JA 3ZDBA 4BAZA 1DX4A 1CU1A 3OA2A 1JR3E 5J0RA 2XICA 2ZRBA 2FTKE 4JXZA 1W2HA 4DQIA 3ONEA 3GFQA 5LQMA 2O59A 4N6OA 1F0MA 2IH4A 1N9KA 1C7EA 4EELA 2Q0SA 1BXGB 2OOSA 3LMKA 4EYOA 4C4XA 4JZYA 1YGYA 4D0NA 1NI3A 2C4UA 3ZHZA 3C6QA 4RA6A 1TAUA 3NTOA 4Y1FA 5GOZA 1W4CA 2P6UA 5M5BA 4Q4LA 2ZUDA 4K2HA 1XLUA 1ZD4A 3NALA 3F2BA 4K9DA 1UXOA 4QKQA 1FOEB 3WQSB 2IOYA 2I65A 1Q16A 1ZKDA 4O4IB 3OTOB 3UXPA 2BJHA 2OO7A 3WI7A 1OX4B 3GYGA 2FZLA 5EUQB 2BW0A 2EZ4A 1M6EX 3DWGA 2F3QA 1B8UA 2O2SA 3AT1A 2Z2XA 1PX2A 3ZZNA 4ED0A 4FFBB 4AUMA 1T29A 4QLAA 1WDWB 2MSKA 2F64A 2RSLA 4DYVA 3B7WA 1OWLA 2HTEA 1BCSB 2CD9A 1Z2CA 1XYVA 3L7OA 2CNNA 4KTTE 4JUDX 2MDTA 2X4DA 4UCQA 3CF4A 3JAKB 1DQSA 2DAPA 2NO7A 2CVHA 2C9DA 1W0KD 2SBTA 4DUPA 1QUFA 5E7MA 3D4IA 3OZSA 4LYHA 4OY3A 4B79A 3EEFA 3URMA 1M1NB 3DEIA 3WRXA 1VI5A 1PG5A 4B2PA 3TFWA 6REQA 2W00A 1BMFD 4QZVA 1DFGA 2YN2A 4IKEA 3WYBA 1QORA 4RVNA 3PYLA 2Y2UA 3JVUA 4MP8A 4I50B 4YJHA 4EVQA 1SKYB 2Y1IA 3GGSA 1GU0A 1RWQA 5CLHA 1BSVA 3LDHA 3L7BA 1MNQA 3I6YA 1PG2A 3EK2A 1OH8A 4M1OA 1EGMB 5AXAA 5H1YA 2NO1A 1E7RA 3KU1A 4B4WA 2QJFA 4G4IA 1WUIS 1FZTA 4B35A 2BEWA 5LBTA 4GBED 1RC1A 2D5LA 5CDFE 3OETA 2GWRA 1W36D 3U48A 3PI6A 2FAXA 4Z3OA 1XO1A 3AETB 1PT9A 2KMDA 1JR2A 3HJCA 3PFHA 3JAWA 1GAWA 1TPYA 3SQOA 4R01A 4P5PA 3K0SA 3L02A 3MJHA 1CLEA 4FYJA 2C0PA 5F3DA 2Y1OA 5IXYA 2QX9A 1GFSA 2GZHA 2G36A 2OENG 4KFSA 3FR8A 3GUUA 4Y2VA 3X2FA 4GXTA 2M0NA 4HVCA 4LVUA 1CR1A 2WP8J 4EB0A 2VDUE 3KQSA 1A4IA 3J81A 1AQYA 2NYUA 2BFNA 2OYYA 1E2EA 1MR3F 3TTVA 2X8JB 3HPOA 1RRVA 4E5UA 3ZU2A 3OIDA 5A4JA 5CAEA 1X9IA 1NXTA 1XQXA 4QYIB 3GZ4A 4LYJA 2XA1A 1Z6PA 2ACVA 5ECDA 1D2MA 5EI5A 4BLWA 1MQ3A 3IP9A 3HWTA 3A2NA 1G8GA 3O90A 5JAPA 4J9NA 5FQOA 4JR2A 3JATA 4HPJB 4DLZA 1NFRA 3HN6A 2DHEA 1SU4A 3E9EA 4DDTA 5J2TF 1RWXA 3QG5A 4I50F 1FMTA 3GG9A 2ZCJA 4EEKA 3OQ6A 1EEXB 2DPHA 3EJ6A 3IALA 1U9IA 3M34A 5MN6A 4Q3KA 2VF5X 4LC0A 4TX1A 4EJFA 1VHTA 1JSCA 5BMVB 4LRXA 3IP3A 3GUCA 2G3YA 2WUFA 1LS6A 2F59A 1ZBDA 1X3SA 2COKA 2JDIA 3CWQA 1E5TA 4WKGA 1W44A 3D3NA 2QRLA 2I2XB 1U9YA 5HTOA 1QFXA 2P30A 3GAMA 4IUBS 2FETA 3DC2A 1DT5A 1Q6ZA 4XVQA 1UJ2A 1NPDA 2I7DA 2JI9A 3Q7TA 3TNFA 1L8AA 3LYSA 3A9CA 4N0MA 2ZE6A 2V7TA 3GIJA 1OCEA 4UM9B 3RS7A 3IAM1 3ME5A 1CZKA 4JYBA 3GJ0A 2X5JO 3NI2A 4HNHA 3DLPX 1QTMA 2HSJA 1CJVC 4MPPA 3AQ4A 4ZCSA 3WB1A 3KUDA 4HN9A 1GTG1 2YN4A 2G5PA 2YASA 2ZI3A 2C9YA 1HDZA 1L3UA 1WKVA 5DB9A 3AIMA 1X1DA 1S97A 3EHEA 2QG9A 4UM7A 1JMYA 4QIHA 3KQVA 2RHBA 1UDRA 5J4KA 5G41A 4DOBA 5IWCA 1U28A 1Z00A 1TJ3A 5L45A 3VBEA 3OCZA 2H92A 5HBGA 3QENA 1UJ6A 3BX1A 1A9RA 3L8EA 5JW6A 1DRUA 4GPTA 4K9QA 3JPWA 4HYTA 4NV1A 1KU0A 3PHGA 3Q2KA 3ICXA 1R4MB 3RHFA 2W93A 1FDWA 4IQ8A 2BM0A 2V6GA 1SU6A 2B1GA 4BO3A 4LE0A 3W77A 1JLHA 1AUVA 1NJYA 1CZUA 4ON9A 4EY7A 4FDUA 1D6JA 1Z5ZA 3NHMA 2NZJA 2H0QA 1KL9A 4L5YA 2Q9CA 1E69A 4E94A 2D0OB 3MWJA 4HS9A 4JYMA 3HHPA 1W9MA 4YR9A 3B7PA 1EWTA 1Y42X 1UOPA 3R76A 2A1TR 2EF1A 3E4CA 1HUZA 4YDQA 4RHEA 2HO4A 2D4AA 2BKVA 4M9CA 4LXHA 1QJ4A 3FWNA 1OB2A 4GLOA 1GSHA 3MBYA 3F6EX 1VKZA 4MRPA 4K81B 3HJRA 5ALGA 4CBVA 4M1KA 3ZD8A 4DNQA 1MAAA 3ZXSA 4ARVA 2GN0A 1NK4A 2O2DA 4MOWA 2OWDA 4DDWA 4YAFA 1IN1A 5AVVA 1QSYA 1ZKMA 2XTMA 3ZD6A 3FXAA 2X0JA 3GOHA 4EGJA 3CCCA 3UMBA 3V48A 5LDDC 5JMPA 3F1KA 4LXUA 4HYEA 5DLFA 4DWOA 1WY5A 3GP8A 4QEDA 2BSAA 3O8NA 4FVTA 4RLHA 4F1KA 1OBOA 2DPIA 4HNTA 2P9BA 1N2ZA 5CGQB 5IN5A 5UKDA 3EWAA 3H4MA 3NW9A 2PH7A 2PLWA 1CQJA 1D0IA 2JMGA 5CXUA 1DGJA 2OHJA 2CHUA 2FQ1A 3N2KB 2OGSA 1QSSA 1EJBA 5FO0A 3QKSA 2Q41A 2IYUA 4LOJA 4WJ3B 3P5BA 4ZAZA 3QX9A 4N5DA 4CEJB 1N25A 4DKJA 2BR0A 1Q1ZA 2WTNA 4LKRA 4OHMA 3OJEA 5J2AA 1R8YA 2YZMA 1QU2A 4A0QA 1UMBB 3T0GA 3GMSA 1YJAA 4ABYA 1LPSA 2YJ5A 2I1VB 4X1IB 3S1SA 1E2LA 5D00A 2VT7A 1GFZA 2VXOA 3W7VA 4F9GA 5AJHA 3BGDA 4AIIA 3VDXA 3U4QA 2JEIA 2W8BB 4I2AA 3AYZB 1F4LA 2YY7A 3I53A 1E2KA 3WRVA 3VH4A 1M6WA 3I5AA 3LIIA 1KAQA 2VHEA 4DR6B 3OZCA 1CR6A 1GPJA 4J1TC 2FP4B 4FILA 3G5UA 3LE8A 4DQLA 3IN5A 3HKEB 4NULA 2Y66A 4O0MA 1ZJMA 1C14A 3HZHA 1Z0KA 3C5CA 4G8DA 2NU7A 2ZVQX 2FUEA 1YZLA 5K4AA 1J9ZA 1J1IA 3IELA 3DM9B 1L5MA 4HNUA 3MTAA 2BPOA 2OXRA 3SZOA 4AJKA 4OQZA 4MRRA 3TQIA 3K8ZA 1RTTA 4HGQA 2FDCA 3F8WA 2BBSA 3MRTA 3I58A 3P4YA 5EMHA 7ICFA 1YFLA 2W8KA 5KOYA 3BTSA 3ZDCA 1W4LA 3AB3A 2CW5A 3OKCA 2EU8A 2O7VA 1ND5A 3AI3A 3EDMA 2EP7A 4UBOA 3IR5A 5JH7A 3D8SA 2WJIA 2C7QA 5BV1A 2QN9A 3GYBA 4NU6A 4N5IX 2G9UA 2GTHA 4HAOA 1KDVA 4ITRC 4I19A 2DWUA 5FRDA 4GBJA 4MICA 4IW3B 1WB9A 3MB5A 1X2BA 2IZ7A 4KIFA 1QS0B 4I2GA 5KZMB 3MTGA 2BFCB 3RJ9A 1UQTA 1Q46A 2W2MA 3W3AA 3HBFA 3B1ZA 3SS9X 4V02A 2BCSA 2PT9A 1E96A 5DN6A 1ZISA 1N5MA 3ZQJA 3TOCA 3C2LA 721PA 3PFIA 3AR9A 3VC1A 3U3KA 2BHNA 3C7CB 1Z17A 3OA0A 5GZ3A 1TZCA 4NICA 2UUPA 5G40A 5EJ8A 2X6QA 3GVCA 3AERA 5I01A 5LOVF 2G5IB 3TVTA 3V1YA 5I7AA 1P3DA 4AKTA 4NENB 5B1EA 2AJBA 3WICA 5LXTB 3G0DA 1TUEA 4NBLA 3TD6A 4D97A 4H1VA 3RQIA 1CUGA 4IO1A 3EVNA 3D6MA 3UGJA 1TKCA 2VQSA 1PD1A 4F4KA 4ABTA 2IVFA 1BDJA 2HQRA 1U2QA 5FKJA 2XY6A 4AICA 2TECE 3OG9A 3LLMA 4D3XA 1Q3UA 2X7JA 2EHDA 1ZK1A 3TINA 4DZRA 1RAAA 1BGVA 2ISCA 5HKOA 5B1SA 2VCEA 2WDPA 9LDBA 1L4LA 2FLVA 3JTMA 5JCXA 4BFSA 4P9NA 3EOAI 4E12A 2V0NA 3U4CA 5F2EA 4EG0A 1K88A 4KX3A 1BU5A 5KCZA 3CH5A 1USKA 5ITZA 3GN2A 2C5HA 1JEYA 1LV8A 4OMCA 2ZRDA 1E2PA 2OYRA 3HP7A 2QWXA 1DXHA 4TN5A 4J9RA 1P77A 4DSUA 3ZGNA 1JF8A 4LTDA 4LRUA 3QK7A 3Q0TA 1LBHA 4FP9A 1FNDA 2OHOA 1N2SA 3ZIUA 1ZGGA 4QWMA 5BR7A 1KJQA 4R9NA 2CC2A 3GG2A 4FOPA 2ZQYA 5DW0A 4F93B 4MUKA 4U2BA 5EUMA 1WPRA 2C57A 2J9GA 2FSVA 4RTPA 1K63A 4JQOA 2O4UX 2AN4A 3PC7A 4UBIA 1J2UA 4GM1A 4L8VA 3W0LB 3I9MA 1JR6A 1LK5A 3RTDA 1GNLA 2VJPA 4OATA 2OXOA 2Q7XA 5ES3A 2ZT8A 3PDIB 4L08A 4NCJA 1E7MA 3LO8A 5K0LA 2ZJAA 3GJQA 3KETA 4KVGA 4OHBA 1DKNA 2L5YA 2GNAA 5DBCA 4K6MA 3IEMA 3PRKE 3KKMA 4RTSA 1Y1PA 2ZB4A 4GKAA 2HLDA 1UFQA 1XNSA 5KKNB 4HVLA 4W7IA 4PZ9A 2K4IA 5AVJA 3E05A 3PPIA 3VTZA 1XRLA 3BKXA 1FVHA 4DARA 4YJKA 2QLNA 5EZYB 1F2UB 1KZHA 2C77A 4GXIA 2XECA 2ZGVA 2TYSB 5KFTA 1R16A 2J9FA 2OLEA 3DMGA 4NCBA 2GKOA 3JVDA 4RTRA 9ICMA 3AFOA 3NT2A 1T15A 3KP1A 4NPCA 3WLOA 1D1SA 3GU3A 4BP1A 3G13A 4L4YA 4QDZA 3LG2A 2R4QA 4DLKA 1OX5A 2Q5EA 4Y2TA 4IFIA 1M67A 1LSUA 3MRXA 2NSDA 3B89A 4QFDA 1HPLA 2C2HA 3DSRA 3S2GA 1ZVKA 2IHBA 4N3CA 2LYAA 2EAPA 1XTVA 2DB3A 2GBCA 3AV3A 5E3HA 1U4BA 1ULUA 5HTKA 1CG6A 2OCLA 4N01A 7ICMA 5LYYA 4QFCA 1RM0A 1EE2A 1M8FA 2P5SA 2PL9A 4PNZA 2BKLA 3ORQA 3WMXA 4V0LA 1Z0IA 1NQ5A 2YFHA 1RP7A 3GY0A 3NH9A 3BZCA 3HUFA 5JLAA 4LJ8A 1K8ZB 4W82A 2W22A 4C5CA 1XZNA 2QTTA 3A6ZA 1ISGA 1S6YA 1E2DA 5TT1A 3F71A 3WDLA 2DLCX 2P3OA 5KFUA 2PU7A 3TEMA 3I12A 3AEUA 1Z75A 1PEKE 3VUFA 2BIFA 2XZOA 3BSYA 3IE2A 1E4EA 3PEFA 1U2GC 4OV6B 3X1JA 1QIIA 4UM5A 4H1TA 5JBIA 4OQLA 2QR3A 2QQGA 4I5IA 4C4ZA 5E6UB 1AV6A 4WACA 3THYB 3WK4A 3BQNB 1KHHA 2UXDB 4BP3A 5DW3A 3GN1A 1CJSA 5KFQA 1WS6A 1R0CA 1B6RA 1XRRA 3KJZA 1KFKB 1Y80A 2E87A 1TK8A 2X2PA 3Q1LA 3TARA 1E20A 4LJRA 5D3ZA 3LQFA 1ZPDA 3EUFA 2H4FA 1UJNA 3G79A 1IZYA 2JS7A 1WZUA 2PS0A 4MQFB 1G9SA 2LCQA 2WIFA 3C7AA 2IFTA 3A7EA 3ENKA 2WW8A 4JGBA 2VPIA 2UUBB 1T5OA 2YOFA 2Q4TA 3V42A 2M2IA 1QCDA 4IV0A 3NM5A 4FEEA 3ZHQA 4M55A 1Q17A 3GGJA 5HR5A 2W2LA 5FOUA 3V4OA 3B1KA 1NM5A 3L7JA 5DTRA 2ZYIA 4CT0A 1Q21A 2BFFA 2G9VA 4X85A 9LDTA 1GPUA 1QH1B 4K9NA 3WLJA 1PR6A 2GUWA 1PFYA 13PKA 4AJ1A 1I2MA 2B3DA 1R8SA 3O7MA 1HDIA 1BEZA 4F60A 3ZTWA 1T0IA 4E5PA 1EUCA 3QITA 4QUKA 1WBJB 3AR4A 4KRGA 1GGKA 2PT6A 4R5HA 5JAOA 3LK7A 4ED7A 4Z4HA 2QRNA 4RV4A 1Z34A 1BW9B 1O9BA 5AJWA 4G07A 2WZQA 5CMLA 3JSXA 3T4XA 4RQ6A 1KGDA 1C4WA 4EBDA 2BKAA 3VNQA 2C3UA 2X1LA 4C8NA 2CE7A 3CZRA 3JQ8B 2Q1SA 2ZWMA 3CT6A 3TZ6A 5K3CA 4J16C 1OH5A 3KHLA 4BLVA 9GPBA 2AN3A 2OCIA 4FLEA 1K7YA 1WZEA 3NWOA 4WLFA 4HPWA 4IHJB 4P6VF 3TVYA 1UBUS 2YDXA 5KYYB 1L5RA 2CZGA 1MEEA 3E5NA 4KAFA 3ZY2A 1CQIB 4B73A 4MO2A 4QA9A 3FPKA 5DFAA 2PX6A 4BHTA 1QE5A 3DBVO 3FDIA 5K51A 5LIPA 4FT4A 5A9RA 5T4FA 3LT5A 1Y3FE 4F4XA 1W93A 1XRQA 2PKRA 1NBMD 4DABA 5LDGA 4ENUA 5K3FB 2DKXA 1ILEA 2GK3A 3ADKA 2Z8XA 5KYWB 5EL0A 2OHFA 3TCXB 4XX0A 2XMPA 3LUJA 1TUBB 1WF6A 1R0KA 3RV3A 4KAJA 1IATA 1MX1A 3EQ8A 1YJCA 2IS4A 4X5VA 3PGVA 4MVJD 1XVIA 3R3VA 2DBYA 3NBQA 4NY1A 2XE4A 1XRMA 4JP5A 1FYWA 4YNBA 4B5LA 2WVHA 1BWQA 2EDUA 3PSIA 2CVOA 3EULA 1XNJA 4WN9A 1CT9A 4PLHA 4IP0A 2G88A 3THWA 2H3FA 1KERA 3O4FA 1LDYA 4KLCA 5CT6A 4GIBA 4PYNA 1W9HA 2CNKA 3FVVA 4LX8A 5BOMA 4U7PB 2QRJA 4GVXA 4K03A 3V8MA 1UK8A 3L84A 3LLUA 1ZN8A 4C0ZA 3ZWDA 5EPEA 1QFSA 2IUSA 3D6TB 5ALHA 2BMEA 1WD7A 1AB5A 5KFYA 1E6CA 3DTYA 2QNRA 1JZTA 3GRUA 2VPPA 4YRPA 3I23A 2B7LA 4I3GA 5IP5A 4US8A 5DN9A 3MMSA 5AK5A 3CKYA 2AQIA 4QZCA 5BW8A 4I9FA 1RRGA 3LC0A 4Q4JB 1M0WA 1TYEB 2IHVA 4BFVA 3JQDA 1ZNZA 3JQPA 3MFHA 4ZDWA 1G291 4N3GA 1OKKA 2BEJA 2JVIA 5LD2B 4LDAA 2D1QA 3UUGA 2AQ8A 4XGKA 2SNIE 2C9ZA 2YBEA 4DJAA 1PV4A 1OLUB 3K92A 3OQIA 1D2RA 1IUOA 3VZDA 1T4CA 5HW0A 5J2KA 1BWPA 4I55B 5THQA 3VHXB 4O63O 1APBA 5HHTA 1EWVA 5THKA 1V9SA 1W34A 2R8YA 4KMRA 5JO9A 1PEDA 2AD5A 4QOHA 4P0PB 1SY7A 1RQ2A 8ADHA 3OO1A 5F7ZA 3QEKA 1NDUA 1CUEA 10MHA 4E6PA 3DEFA 3D2BA 5CFMA 1FDSA 4IUDS 3C28A 4MVWA 4JENA 5T8KA 2GD6A 4YACA 4AJJA 5DXAA 2HRDA 4LMAA 4R2LA 4WK4B 3WHKA 3AF5A 2X9GA 1FC0A 4KVZA 4YAKA 1M72A 3EY4A 1KKUA 2W2OA 3O1LA 3TIVA 1SC6A 4MB6A 1VL0A 3EGDA 3RVQA 1IDN1 1XD2A 1I1OA 5T3UA 3C2QA 3WFIA 2WSSA 1SOUA 2BEUB 3I1FA 5ENVA 2PT7A 4MIOA 3OIWA 2AMVA 5G0TA 1OV4A 3X1MA 2I2DA 2NO4A 4DUGD 2QMEA 3V32A 4KLFA 1AQ6A 1XK7A 5K4GA 3LUBA 3WU2U 2VIXA 1Q1AA 4Y18A 4AG6A 3RHSA 5I9NA 2OLKA 2Y6VA 2PXXA 1C4KA 3BQ2A 3UW1A 2YV1A 4ANFA 4UE6A 3E3AA 3TSOA 4EA6A 3F74A 1YJBA 3LZCA 4G5FA 2MAXA 1CXZA 4UMEA 3V2IA 3LVWA 1YE3A 1MJGA 1L7QA 2ZBUA 1IBSA 1JI3A 1PT7A 2ET6A 1RZRA 1MG0A 2EDCA 3H7AA 2NZUG 1ZWLA 3G89A 2W70A 3HY3A 1MA0A 3C8DA 4Z6EA 2ZTLA 4K3VA 9ABPA 4LJ9A 2PSSA 1A72A 4M0PA 1YHZA 2MU1A 3B3FA 3TVDA 4R2XA 2J1LA 1BH2A 4AXXA 1XDUA 3KV1A 4NCKA 4PZCA 2BD0A 3RFXA 5FOTA 5HRAA 1DLJA 2BONA 1V5EA 2V6BA 4NOKA 5BSTA 3MZ0A 3SFZA 1H2HA 1RIFA 4K6KA 1MSWD 5B36A 1NP7A 2FU5C 3RROA 3KQPA 4FOLA 4QOSA 1W30A 2HBRA 4YXWA 3SBDA 1H2ZA 2EP5A 4QU0A 1JDBC 5TY0A 4CUKA 3LVVA 3CRNA 3Q8XB 4BVKA 3FNIA 2YXPX 1JRPA 3HYNA 3FTPA 1KYIA 3UHJA 3BMNA 3P9CA 1HLDA 4MRSA 3HL4A 4QGHA 2EKBA 2QTVB 1K3TA 1CW2B 2NSYA 3F7MA 4UXJA 2B1RA 1SC1A 3H5NA 2RGRA 1Z2NX 1JS1X 1VOTA 3R7SA 1K8RA 5C81A 1X7WA 3WKBA 2YMLA 4OGGA 5DWDA 5DGTA 4IIVA 5B6IA 4N3AA 1LU9A 5DXJA 1JA0A 4OJYA 4MA4A 4HMQA 4UEKA 4WY2A 3W1EA 3F6SA 3D5EA 2VF4X 3I8SA 2AYYA 3OZRA 2KWIA 1RYRA 2I7VA 3K70B 1RQNA 1Z0SA 4KBYA 4R0MA 1GLGA 5C3UA 3Q9NA 4C0SA 3UQYS 4KZPA 4Q01A 1G4UR 2XQVA 3ZWMA 1C30A 3BZWA 3GT4A 2ZJ8A 4C0HA 1SIBE 1KEEA 3OQOA 1ADGA 2NU6B 3SC3A 3BCUA 4DV4B 4JV2A 2OGTA 4RAQA 4REQB 1JAZA 1X7YA 2LHTA 1D9DA 5CB1A 4YJ3A 1X7GA 3K9NA 1WPXA 5C5JA 1KVSA 3NWBA 2HRCA 4NESA 2IYFA 4MW7A 5AWFC 1ZOOA 4V38A 5L3ZA 4J49A 2PUEA 1XDSA 3Q7QA 1DWPA 3AY6A 5JFOA 1BPXA 4EZBA 3ROPA 5AXDA 1DI0A 2F43A 3L7IA 5T41A 4PWZA 4TTJA 4KDFA 4WASA 4ZHSA 3ZE7A 5KT6A 3T1NA 3DF9A 3DR3A 4CIAA 1WMFA 1E9DA 3R7WB 1Z83A 3OCVA 2OORC 2UYHA 2CXTA 1AD2A 2DQKA 1XPOA 2ZFUA 3KQWA 1N6KA 2YZKA 2PZMA 5KFKA 3DL4A 5HPYB 2HN9A 5EFZA 1A95A 3D6FA 5I7VA 4EGSA 2UZ3A 2IYAA 2Y0SF 1DIAA 4DZTA 4H7IA 3OX4A 1GTZA 5KX5B 4YQEA 1Z6YA 4DQSA 1RXSA 5JCOA 1AUXA 1GGJA 3FMIA 2V9PA 4TUQA 4EPYA 4TYPA 3NS1A 2WWRA 2AWNA 1BJRE 1XLTA 1EUQA 3FVQA 3KVOA 4EW3A 2WZDA 5AJUA 2ASVA 1MGPA 2F8MA 4A0RA 1W0KA 5CUQA 3QF7A 3C85A 1TIKA 2POCA 5FFFA 3O4HA 3DLCA 3KELA 3WL3A 1SCDA 4UB4A 2I6XA 3F3YA 1G5HA 1Z82A 1O03A 1BMFA 1X1AA 3DMYA 5FB3A 4F50A 3C70A 1RHUA 1TAMA 1SXGA 1I2ZA 4TQUS 4OHOA 4WZBA 4LVNA 1ZJ6A 1JBEA 3MWLA 1DBWA 1OGYA 5JJIA 1J1UA 1L5WA 2AOTA 5D8DA 1N77A 3I04A 2XTNA 3NHUA 3R0ZA 3TMYA 2VXBA 4J16A 1YF3A 2IYYA 3ESRA 4DWIA 3GJ7A 1CQZA 2IUFA 4Q19A 4IDGA 3BJYA 1P0IA 1A5BB 1Z7YA 3PCTA 3OT4A 2JHGA 1H8ED 1CZNA 4FC6A 2OO5A 4OTZA 1NVXQ 3M6XA 1X1CA 1UA0A 2XEXA 3KAKA 3NWEA 4OJ6A 3WKEA 1XSLA 1SL2A 4RAOA 2DTXA 3KZVA 1E3JA 1EP9A 5BOSB 2PMDA 5L8VA 5IC6A 3VR2D 1C8KA 1P7VA 1T9BA 1FK8A 2OBFA 4D8YA 2C5SA 3RH6A 1GFIA 1U28C 3RVNA 3D0KA 3U1BA 3MOGA 3OHAA 2QQ0A 4M36A 2DJ5A 4OIFA 2JEJA 3OZEA 2AG0A 2XMCA 3ANXA 2VAXA 4C7VA 3AU2A 5FNVB 3L4KA 1A2BA 4JH0A 3WIUA 1C1XA 2Z6AA 3O2SB 2JASA 4MUYA 1TM7E 4MI1A 1QFMA 1P2FA 5KFEA 3IBYA 2A33A 4G63A 1A4XA 2W6NA 4MRMB 5ELMA 3W9BA 4IINA 2NT4A 4P8RA 1JMVA 1Z0JA 4F2GA 3AVQA 1ISIA 1U80A 5EIBD 4L5IA 4QPCA 2LTAA 2CFRA 4U5XA 3UYKA 3WOVA 5FWXB 3QFCA 3SS7X 2ZIXB 3G6XA 1LLCA 2GEBA 4NHOA 2REQA 4DCNA 4LY0A 1Z74A 4KK4A 2JIMA 2P8JA 1K7EB 2VS1A 4CTKA 3HB4X 4B9NA 2J32A 5J29A 1WWVA 4ND7A 4A5OA 2ZIFA 5IULC 5ANRB 5AI4A 5GTIU 2ZT6A 3EOBI 4HLCA 4LUCA 3RDPA 2GUGA 1VL8A 3E82A 3C6XA 3TLZA 5ELXA 3U4IA 1QKKA 2X7XA 2PRIA 3HCRA 1JN0A 1N63A 3N5CA 4QYTA 1P5JA 2HJ9A 4ESVA 3BDIA 4JT2A 1V8DA 1U3CA 3P4UA 1OXUA 3F5QA 3FCXA 3EWNA 5BSWA 3R3SA 3O8DA 4DN6A 1XTPA 5F9HA 4E09A 1X1EA 4ZGBA 3AR2A 4FEGA 2PFPA 1T36B 2P6RA 2XR1A 2Q27A 3JYNA 1AS2A 1RKQA 3OCXA 3I09A 4IQWA 2WIDA 3C3XA 2C84A 2R1VA 4BBJA 5JEEA 1Y8QA 4RANA 3QSYA 3W6NA 2AFHB 4HAZA 4NY8A 4ZHQF 4QVGA 4RKWA 3TTWA 1M6NA 2QT0A 4NFHA 4LJ6A 2VHTA 4BYGA 3M4XA 4K9KA 2C88A 1OBHA 1H4SA 3WMRA 5J63A 1RJ9A 1N3YA 2QG6A 3QVWA 1Z13A 2P3SA 3GDWA 4B32A 5IYZA 3PJFA 2R62A 4ZRNA 4EPTA 5JARA 3EMKA 4DOMA 1M6VB 3CLRC 3W4JA 2V6JA 4G8JA 1B1CA 2BDPA 2D4HA 3TRIA 3MWFA 1G8KA 3HCCA 4FWTA 5C8VA 1LCIA 4R81A 3THXA 4LJLA 4Q3LA 4A73A 4Z6DA 3AJ8A 1X38A 1ISHA 4OXKA 5HF9A 1N3BA 3PR1A 4PO1A 4KGVA 4BJ6A 4F4ZA 3OMXA 4FE3A 3G9QA 3QM1A 4ILKA 4CU5A 1SCUA 5CLJA 3Q7RA 1V5WA 2IEGA 4UVGA 5KWIA 4EABA 4FWIB 1KVRA 4QXMA 2YB4A 1H9AA 4JBIA 3GNLA 1T2NA 3PZBA 2OC9A 3PI7A 1WUYA 1G9XA 2XKKA 3HB9A 1UH5A 5KQGA 2XOKD 4MQBA 4G8BA 4B2YA 2ZR9A 5TC4A 1COOA 3AUTA 1ISPA 3UGKA 3VTAA 5CLFA 2R9VA 4QFMA 1ECPA 1NQVA 2D7DA 4BVAA 3NC1C 1CR0A 2OBBA 3B3JA 3I9V1 5FV7A 2VSYA 4J8PA 2W6CX 1EB8A 3EF1A 5B58C 1T94A 5IH7A 2I5HA 1GYPA 1Y5RA 4KQFA 3VSDA 1L4YA 3NHSA 1CJCA 1URJA 4ED1A 1YL7A 4PIVA 4HQFA 1VJTA 2MJLA 5K09A 5GIOE 1V85A 4L6CA 3ZV4A 1O5IA 2CF6A 4UDOA 2G9QA 3PVSA 3Q6NA 4QGGA 5I5GA 3GDFA 4X7PA 4KQ2A 1XZAA 2WYIA 3QHAA 4B9MA 3L40A 5H2FU 3P8ZA 4M1SA 2JD2A 4IQUA 3PF8A 3RFTA 4AROA 4FUTA 2IEYA 2CLIB 4UTZA 2EQBA 4Y2UA 1K8YB 2Y2VA 2WTBA 1GPBA 3SEQA 1L4HA 4I8IA 3RTEA 2DTDA 1U49A 2VNAA 1G8AA 2V7VA 5DNDA 4RPGA 1F6BA 4BVBA 4OOEA 1N5KA 3K4GA 4D8WA 2WP0A 4YAIA 2PLNA 4HD8A 3FSJX 1C8BA 3N0WA 4J4BA 4BPBA 1ZY2A 2GPBA 1X8LA 3SF0A 1MD9A 3PLRA 2Z9CA 2FMHA 4V03A 4YCJA 4GFJA 3L8GA 4KDEA 2IP4A 4DIOA 3C3PA 5ARCA 4DRXA 3O8RA 5CM2Z 2G63A 4K8OA 1KA9H 2EX1A 4XM1A 4IL6U 2FP3A 4F96A 1TCCA 2B9VA 4GPIB 1OLSA 4M1TA 2PI5A 3DC7A 4CFSA 5J2TB 4R1NA 3P52A 2R11A 2XF2A 4EO7A 5CB0A 1GG5A 1U99A 1NJ6A 1YAHA 3VI3B 3SPXA 4RGBA 4RJIA 2ZRPA 2C28A 4XA5A 1V45E 4RMNA 4CV1A 1AKWA 1XVLA 3DBHB 3G9UA 3QOYA 3WGUA 1AX9A 3LK6A 3CHYA 4QNMA 5AVQA 2RFLA 3HV2A 2IX9A 4NU0A 4EX7A 4FBMA 1MX5A 2VDWB 4A8EA 1JBKA 1JDVA 4NS1A 2DFVA 5TPZD 5KFJA 2IPXA 4LXXA 3A0BU 4X00A 5JFTA 2W3SA 1TECE 1U8XX 2FSVC 1K8QA 5L7TA 1RWPA 1HY3A 2MTBA 2CL6X 1Z4KA 4FKMA 1KTIA 3CVVA 4I81A 3QVGB 1A8UA 4ZO7A 2OORA 5TRTA 1U0TA 5C7YA 5FA8A 3EXEA 5L40A 3MT0A 4C6TA 4DV3B 3SXJA 3C8MA 2FPGB 3UQ0A 4JLWA 2HXYA 2E48A 4DDUA 4RWZA 3ZWKA 2Y0PA 3GJTA 1X9SA 2IEZA 5DGHA 4CM4B 2QU8A 3BK1A 4ZREA 4QSHA 1QZXA 1WVGA 3RV4A 2VJYA 3I6BA 1JKJA 3SKXA 1CS0A 4B3HA 1KEUA 3OM8A 3OIYA 3WB9A 2ERCA 5ALVA 2XY4A 3VR1A 3ZWWA 1SZJG 5T3YA 3V2UA 4F5ZA 1PS8A 1OZAA 2DSNA 3FNEA 5MHTA 2VJMB 5DG9A 2IDZA 3R5FA 1UKYA 3PR5B 4P4OA 3ZCSA 1OXMA 2I3BA 4ZVRA 4EB3A 4O3OA 1OW5A 4JLBA 4RHCA 4S1NA 5JSQA 2Q0ZX 4K4GA 2JFPA 1LLFA 3WWOA 1FXWA 3N0VA 2NU8A 2KE5A 3FHCB 5B4UA 4MR9A 1I4WA 3IUYA 3L0YA 3UV7A 4R2IA 4DL5A 2VWQA 4QECA 4YLGA 1JP7A 1M75A 4Q3OA 2LGJA 4M9JA 4QOGA 3GW8A 2IX3A 1NI4A 1DAIA 5H68A 2KSOB 1KGSA 2OK8A 4MDFA 4WLVA 1XNQB 5IS2A 3DLBA 4RNCA 3FDJA 1EX9A 3ZIDA 1QX4A 4NSNA 3IUBA 5JYEA 5DISB 2GTIA 4IIDA 3O38A 2DQYA 1O6GA 1GT91 4YQWA 3NETA 3M49A 3H4DA 4M89A 3O8LA 3Q3IA 2H7CA 2VT2A 3QXGA 1P1KA 3JQ7A 3OQNA 2QDXA 5AVYA 1D1TA 5LKRA 2GPWA 2BUBA 2WWTA 2RE8A 2B21A 1A4RA 4KO8A 4O33A 3TOVA 2JLUA 5CR0A 4WZAE 1XP8A 2PVCA 4FS3A 5EZ5A 2RKBA 4PL1A 1JQKA 2FQYA 2NTYC 5F12A 2JFOA 4EIWA 2WK1A 1MO2A 2CXPA 1XYGA 4LHSA 3MGCA 3L0BA 3HKZF 3NQ41 1VL6A 3WLAA 2IW1A 1UT6A 4J43A 5LQUA 3GVHA 4GOMD 1J20A 1LBIA 1IQUA 1SULA 2AQKA 4FIZA 2W11A 1HMPA 1EHIA 3EF3A 3OHSX 4E2YA 1X9WA 5EJMA 6YASA 3AR8A 5BP7A 1WCIB 3P2MA 4D9FA 1SEPA 4MYUA 1LK0A 1ZQIA 4HH3C 1N7HA 3G2JA 1NKSA 1PT6A 4QBIA 1YMUA 2DGDA 1VGVA 1NM5C 1ZQCA 3EPJA 1JLLA 1SOWA 1OZFA 4MKHA 4WE3A 2ADMA 2YJ4A 4NCNA 3I3OA 4F8YA 2I7XA 4P93A 1K6XA 3MOSA 1O94D 5KTQA 4LY3A 4EJSA 2OEPA 1FA9A 1RLTA 3ZWCA 1E2UA 1GU7A 3Q3CA 4BU1A 2PR7A 1CUZA 1Z63A 2QL7A 2ZUVA 4JP2A 5L95A 4GOXA 4OJQA 2XNDD 2ZWVA 2DHRA 4P58A 4NEGA 4IUYA 5BSFA 5ENDA 2BFPA 3ESZA 4QD3A 4PYRA 5E7QA 4MW0A 1ISFA 2ZULA 5ITVA 1P75A 4EZ9A 3CG0A 4EVSA 2BTEA 3DEZA 5KNCD 3ZWPA 2BRUA 4ALKA 2QYTA 5EP2A 1D2GA 3UJNA 1EH5A 4PC1A 4BFZA 5AW6A 4B82A 4FGJA 1V41E 3C3YA 3R7FA 3SWWA 4UXHA 4IR9A 4P4UA 1Y9EA 1GTL1 2C3MA 2JGDB 2VHZA 1S1MA 2OAEA 5KSWB 3KKLA 2X8LA 3BIFA 3EXIB 3EQ7A 4JWTA 4MB0A 2LBOA 4FMPA 1NRXA 3U44A 4JP3A 2BBOA 2YC4C 3JD4A 2FJPA 4JUZA 1M73E 2IF0A 4RS4A 3C43A 4PZYA 1ISSA 1D0SA 4GX5A 3EZYA 4JJKA 2EIHA 2AG8A 2MYNA 4YRTA 3KRTA 2GK4A 3TNYA 1A9ZA 1O3YA 2IZOA 3EGIA 4AKHA 4JYZA 3LKVA 3H3JA 5JO0A 3WZLA 4B83A 3KSAC 1MTZA 1AQIA 4OU4A 4MKZA 3KDAA 5LOVB 4RVHA 4LGYA 2B8NA 3OFJA 3TG2A 9ICFA 2OB2A 3NJ4A 1AXEA 3R9XA 1SA0B 3OU6A 5I9TA 4GH5A 4MQLA 2V7UA 2AE1A 1EFVB 1K5OA 4FHFA 4H35A 2XYVA 5JXHA 2ZVDA 1HGXA 1A2OA 3UH1A 4EO4A 3TZEA 4K88A 2J9XB 3ESXA 1GNRA 2AOWA 3D0RA 4GPD1 2HPVA 2Z0MA 1F3LA 2GAIA 1X2EA 4H4DA 3PLNA 2R7KA 2V4ZA 4ZAGA 5LR6A 4GKJB 1P74A 3N5KA 1ECWA 3BB3A 3ODPA 3DMHA 1PQYA 1MFZA 4N0EA 3HCFA 2ZB7A 2W5UA 2IPOA 1ZHHA 3OJWA 1A88A 2IXFA 4EP1A 1J39A 4ZP1A 2ZYWX 4B71A 4WHMA 3G85A 1N0HA 4F11A 1YBAA 1J06A 4D4GA 3WIVA 1NAIA 2AD1A 5FUXA 4MDHA 1N6RA 4UE3S 1Q7RA 3HB0A 3EVAA 3M4JA 1PX0A 3KJNA 3N2EA 4F9EA 3H84A 3HI6A 3B2QA 5ADUS 1OFIA 3IMGA 1C7YA 3VHRA 4X94A 3AG6A 4RK0A 5L1IA 3K0FA 2FN9A 4LMBA 1NJ8A 3G5TA 3K71B 2GSWA 4BB9A 3JWIA 5JOQA 1UMDB 4KLUA 2HF9A 3C15C 4RDIA 1UC4B 4BLSA 4URHA 4Q9KA 4IX9A 3WWEA 2HDWA 4BNNA 3UPQA 2YWJA 4C7MA 4NE2A 3WV4A 2RGCA 2JB9A 2XUJA 3Q7IA 3RODA 1PL6A 2EGHA 1M1UA 1PL7A 1F2TA 4HQNA 3GJXC 3W1WA 1Q1BA 4I08A 3AKEA 8ICTA 3L7YA 1XLVA 3H1PA 1B73A 1RQRA 2Q4BA 3NHYA 4K05A 3I72A 4R9VA 4H7EA 4FE7A 2F77X 2DBRA 3FPJA 1J0BA 3OMWA 4TUYF 3ZHXA 1NBMA 2J3EA 3GH1A 1T8TA 1R4ZA 1NG1A 2IHJA 4K9SA 3S40A 1N5OX 2WWXA 5F3WB 4UNNA 2Y9MB 5DTQA 3N07A 1HE8B 4Y0VA 1EB9A 5AM3A 4KRFA 1KMCA 4B6EA 1N2XA 2L82A 5T8KC 4EEYA 2PUFA 4YWHA 2C98A 4MVJA 2E49A 2QPLA 4TV9F 3RU3A 3MJ4A 421PA 4YT5A 5IBPA 1PJRA 1ESZA 3AESB 3NOOA 5FPSA 2NYVA 1KARA 3SIRA 3DAHA 7ICQA 2OWEA 2CZQA 3U62A 2OHHA 3ECCA 4M0DA 4ELVA 1NWCA 5KFAA 3H83A 4UD2A 4MR7A 2X2FA 5EIBC 1VMKA 3ENQA 5HZMA 5IN4A 4JVMA 1N32B 1XUOA 2O2CA 5FJJA 3W7BA 3DHEA 2FN8A 2GPJA 4UPVA 3TXYA 1D8YA 4YY3B 5CHEA 3BMOA 1ORDA 4F6RB 3HVIA 1PLJA 3QE4A 1FDVA 4B3CA 5KFBA 1JFLA 3WG9A 5IH3A 4FIDA 4FFPA 1A5TA 1IY1A 4RH1A 2Z5LA 1G6OA 3H7IA 2FFJA 1H2RS 2YRXA 3JX9A 5KQLA 1ZG3A 5IAOA 3MMXA 1T5LA 9ICNA 1GITA 3ULKA 2XGQA 2AVNA 4XA8A 1MIHA 2A57A 1ZUD1 4YPOA 1DINA 4I7EA 5CXQA 4WJZA 1THTA 4UKDA 16PKA 5ALQA 4P33A 4YREA 2WVGA 4KLGA 4W5QA 3UN1A 1FRVA 4J76A 3COWA 2R00C 3Q5EA 1PS0A 2VPWA 3H9BA 2CFTA 5KIAA 1U31A 3HYSA 3L4BA 2B92A 4NBKA 4QO8A 1UMKA 3EAGA 4ZO6A 5FR1A 2OM2A 4FDVA 3P9PA 3SGLA 5K0JA 2BKXA 1TAGA 3R5KA 2R8OA 3SHTA 1VIAA 3HJUA 5JJBA 5CFPA 3SXPA 4HF7A 3TG8A 2A5YB 3ZDQA 1X7XA 2PMKA 4EENA 5F64A 5EIEA 4E7PA 1ISRA 4HQOA 4XYBA 3VYVA 4EG6A 2ZSIA 4FLMA 1Z2DA 2R7LA 4IFTA 1NAHA 4GGOA 5JSYA 3DV2A 3FROA 4OFZA 3IJRA 5CA0F 1KHTA 4OJTA 2JD1A 2EAUA 4NYJQ 3TANA 1PAUA 1E1LA 3RADC 4OP3A 3F6CA 1EJ6A 2QM0A 1LXCA 1NQWA 3H8JA 3ZH9B 1SXJD 1Q6YA 4W9NC 5G3YA 1B8VA 1U3WA 1JKIA 2A7XA 5CP2A 1ORWA 3DTVB 1VE6A 2QZ9A 1W85A 1Y6RA 2BMWA 1H1LA 2ZBEA 1NMZA 4DCOA 1AKTA 1R0LA 5KDDA 2PGJA 8OHMA 5JCJD 2KEYA 2B94A 4LOKA 4U7JA 4DVJA 2LRHA 3CZCA 3GIDA 4ADSG 4EW1A 1UPFA 1C1DA 4E31A 3BWXA 3Q88A 1Q3KA 2QDKA 5SZJA 3JASA 4DUGA 4K6CA 2I3ZA 2CB0A 1JQDA 3Q7EA 2XD9A 2P3LA 3H97A 3AI7A 2F44A 1Z47A 1HC7A 1U5BA 7ICIA 1UBFA 4ER6A 1G3QA 2PVSA 1I3CA 3WBFA 2HHXA 4B47A 4KIGA 1IWPB 3UUWA 1NVGA 1Q44A 4IGKA 2WF5A 4DSNA 1EGHA 4MV3A 1QP0A 4C7OA 1Q84A 1C8LA 5IUKC 4X62B 3LPCA 3T15A 5C5EA 1TAHA 4EX6A 5IT0A 2C1XA 4I5GA 3GZJA 3C6ZA 4G0YA 4DWJA 3RC9A 1Z25A 1YRHA 4BFXA 1INLA 3TF5A 4P4PA 4NPAA 4AMYA 2BLNA 1U7DA 1SNYA 1G8FA 3KHKA 3S29A 2GBIA 5A4MS 2YHIA 2P4QA 1JXOA 4I9NA 1I6MA 1C9JA 1ILWA 1X70A 3MXTA 4F5RA 2JCSA 3V6HA 1W48A 1FS5A 5IJXA 1Q1EA 4F5QA 5HJEA 2Z8YM 4ERXA 2DWQA 1E2BA 5LBUA 5FTWA 4LRYA 3R7LA 4KI7A 1GGNA 4NCAA 4CQLA 4ZOHC 3RTCA 5A0FA 1ZOIA 3T5PA 3WGHA 1S76D 1HFKA 3RABA 3RVRA 3H2JA 3BRQA 1RT9A 4JI7B 1IB0A 1QTIA 3WP0A 4UM8B 2Y05A 4QT4A 1ESNA 1PBNA 5KMGB 1V1MA 1MPXA 4YP5A 4E11A 4K28A 3BD8A 4QW8A 5JCOC 2NQ2C 2VRBA 4NJMA 2AOUB 5B1YA 3FCSB 4O9MA 1YT5A 2XZPA 7MHTA 3IQHX 2W7PA 1D2EA 2FWRA 1M8JA 1XLTC 3GLGE 1HUOA 3NAMA 2XB6A 4F5PA 3F46A 4LDZA 5KBYA 5P21A 1WMSA 5MFZA 2FPLA 1TK9A 5JQGF 4FINA 1AIPA 3RYCA 1TVAA 1T3HA 5JXJA 4BQRA 2PKCA 3JQ6A 4AJIA 4LOAA 1EWQA 3HYTA 5BSRA 1LV5A 1OXVA 2PQ0A 3ANYB 2O3JA 1ATIA 3K0AA 2ZRMA 4R65A 2UVQA 1KO5A 3ORHA 1YI0A 1UBHS 2X40A 1AHIA 4NZPA 1EXDA 1U9LA 2BP7B 3PEUA 1YA4A 1RDFA 2I2AA 1W96A 2AIRA 1EFHA 3SX4A 4YX9A 4HGZA 1LPOA 4MHOA 4A2WA 5CDSA 4G2TA 2NOAA 4B4OA 1ZBQA 4YS6A 2XTAA 3P9YA 1ZJJA 5KG5A 2J30A 1TCAA 2RKOA 4W8GA 4HWGA 1W36C 3QVKA 2AKYA 1JHXA 3QQ5A 2OO5C 4WOCA 1J70A 2RAPA 1KR2A 3OLQA 1RQGA 2CL7X 4OQMA 1YTLA 1E9SA 5FAXA 2PU5A 4LXQA 3N6XA 4RVGA 3UJ7A 2H1IA 5IEBA 2X1HA 4GKVA 3PUWA 1HNNA 2YMMA 2OGUA 5TJ9A 1PS9A 4I2EA 4C78A 1IPEA 2QT1A 4KQMA 2YVAA 4XYGA 4P54A 3OEED 5EMJA 4AWAA 2YTZA 4RZSA 2IC5A 4HLUA 3OE5A 3KR1A 4YMGA 1JH9A 2Z1MA 1TMKA 3K9QO 4R41A 1T43A 3ADBA 4EUFA 1A2KC 4UEJA 4FNAA 2FSPA 3M2TA 4YP0A 1UM8A 4QAJA 1J5XA 4NJEA 4B46A 4N7MA 3UJCA 4XIIA 3RBXA 1L3TA 2ZRGA 1PJSA 5KYTA 3CEMA 4JUCA 4LZOA 4F9FA 1Y5LA 3V7NA 4G8CA 3GCGA 4FQ8A 1PR4A 1B1AA 1FDTA 4BE9A 5AKEA 4BNHA 4C8OA 4BMYA 3OY2A 3PDJA 1X87A 2DYKA 2I22A 5TQ0B 3K2IA 2XWJI 1I3OA 2ALJA 1EXNA 4EDHA 3RRGA 3AF0A 3IEPA 4TS9A 2J4CA 1T3TA 1AKVA 3VR5H 5AHOA 2PGXA 4FFNA 1YMQA 2QIPA 2JKYA 3ZNOA 3LXMA 1HR0B 3AZPA 3MPUA 1FLNA 1PIWA 4AO7A 2JD0A 3R4CA 2SHKA 3ROMA 2AZTA 3TE7A 2I8LA 3CF4G 2WHEA 1E6LA 5LP6C 2K7FA 1DJLA 4O5AA 3KKQA 5LN1A 1R0YA 1HDXA 3C5FA 5KT7A 3D8BA 3GRCA 1OLXB 1VCMA 4LGVA 4RFVA 5KNLA 2W4IA 1UZAA 1B0XA 3FWKA 4X65B 2XW6A 2Y9TA 2HNKA 3FCAA 4C4OA 1U02A 2H51A 4CCWA 4RVCA 1D8AA 1RWMA 4PU0A 1MVNA 1H8EA 7ICPA 3TZKA 2NZXA 2A0UA 5SY6A 4MQEA 2OCBA 4BGUA 3GVIA 1POWA 4ZKDA 1MABA 3KTAA 3AC0A 1HYQA 4XR4A 1GYRA 3W2GA 4FJ2A 1VDVA 2Q8NA 3RU7A 2LP4Y 3KZMA 1MO4A 1X86B 4RD0A 3CTPA 1XTSA 4XD7D 2J31A 3P9NA 4PAGA 3GDGA 2PEZA 1ZJ5A 4A8PA 1QGZA 4E4TA 5KDOA 4L3OA 1MG5A 2PAFA 3FPGA 3VR2A 3EIQA 3N0RA 3AVVA 4ID9A 3GK3A 4CN9A 3RRZA 4YP9A 5L7WA 3GLVA 5BR1A 5EA2A 3DEYX 4UNRA 1ZOSA 1A2QA 4UD6A 1T5SA 4L9AA 2CHQA 3C1UA 4KLOA 2W7TA 1N2GA 4ZK2A 5DGDA 3MOIA 2CT8A 2GEFA 3PT5A 1GT6A 3U16A 2HF8A 1BX3A 3BQMB 4MYSA 1ZW6A 3PNBA 1QZTA 2AA3A 1OI2A 1AU9A 3VR3A 2NW6A 4FGZA 4U2CA 3TBHA 4DF3A 2ODQA 5KG0A 2VATA 4PSVA 4A5SA 2CWWA 4G5QA 5KFSA 2ZIVA 2GPTA 2W6PA 1RJWA 2ZTVA 3FMGA 5EPUA 3C8ZA 2LDBA 2J5KA 3VHLB 1WEHA 2VDVE 5D7NA 2WSBA 4ECEA 2G6BA 3WGOA 3CEPB 3K2EA 1DKLA 2NAFA 2B1QA 2CVZA 4I1OA 4CN8A 3AUXA 1J99A 2PFQA 2G1KA 4KXMA 1JJBA 2QVCA 2FPPA 4E07A 4AU1A 1SC9A 2KP7A 3S2FA 4O2BF 5FI5A 4B3TB 1RRMA 4ZOLA 2JI7A 4OXIA 1N7JA 2MSWA 2ZI5A 3PICA 4OYRA 3Q5GA 3LQYA 5F7OA 1MB9A 1NN1A 5AQEA 2PV0A 4NPHA 3NHPA 4JELA 4HPXB 4H1HA 3K20A 5J2EA 3VR0A 3DXFA 2R00A 1A82A 2JLXA 3U4AA 4BLPA 4LSMA 4WK0B 3MN1A 1CJTC 1IULA 1E59A 2B4YA 3EVDA 2Z57A 3SE0A 3P2IA 4EBEA 2FPWA 1X6JA 2BT4A 3AR7A 3DDSA 1I3MA 2FMFA 2XYQA 4XLZA 3Q3HA 1R66A 2P75A 3QTBA 4IHQA 2H2AA 4LMPA 4JN6B 1P7DA 4EY3A 3FMPB 4HRVA 4FCCA 5JS6A 4JJGA 4N7JA 5DDMA 3JPYA 3CVXA 1XZGA 4DM4A 1L7MA 2BJWA 3H9GA 1KRHA 2DUWA 5TGDA 3WGMA 3L1KA 4ISBA 3RNLA 2OUKA 3NTVA 1G64A 2V7GA 2P69A 4M54A 4YCSA 2EL7A 1GSIA 1T2UA 4G1UC 1TJYA 5IJAA 3D2SA 2HAEA 3FPSA 2VDQB 3FWHA 4Z4EA 4L4UA 1WWKA 2P4SA 4RFSB 1VJCA 3PNCA 2UDPA 1E3LA 2YUTA 2YXNA 4WZZA 2WUDA 2RONA 1GTJ1 3HUEA 4W9NA 4FGKA 4JEUA 4N1AA 5TEVA 1O4WA 4JWNA 3FGPA 3ETGA 1RI4A 1JVNA 4B3JA 3K05A 2C0QA 3I64A 3OIUA 4COOA 2RARA 4JKOA 1NZDA 1BNCA 4YT8A 2E8NA 5KFPA 4ZJYA 5DG7A 1YBMA 4NFYA 2IBMA 2Q07A 2X9VA 4MWGA 9ICUA 4WVFA 1CWUA 3FNQA 2PSEA 4UBJA 2G0AA 4O5EA 5K01A 1MHPA 3X1XA 2XUFA 4XCQA 3RSZA 2EWMA 4R8UB 4MLPA 3AINA 4QFBA 1G21E 2XOKA 2J6IA 4US2R 2ZROA 2W9BB 1NKBA 1HLGA 4Q6BA 3UIEA 4QPNA 3PGLA 2OPBA 7ICLA 4NECA 2E5LB 1FX0A 4Z8YA 1I9CA 3QVJA 3UMMA 4KIWA 1EWRA 2VK8A 3RTBA 3FUWA 3QBVA 3VVBA 4DDHA 2PT5A 3TW4A 1US8A 3IA7A 5DIFA 3LSTA 3S3TA 4AULA 2BBTA 1M83A 2BCGY 2O23A 3SF8A 4Y2XA 1ORVA 4EUKA 4QTUB 3I42A 2ZVJA 4MCIA 3VOSA 3B52X 1TRHA 2EZ8A 3A37A 2DERA 4DBLC 1YB6A 5E1MA 4PZOA 3OD1A 2HI0A 3HR4A 1EIWA 1VMDA 2W37A 2B30A 1E58A 1O5TA 1KI6A 4GQIA 1KDRA 1PU2A 1EQAA 1CUWA 9ICRA 1CUDA 3FLBA 3HEAA 1YZGA 3K3PA 4GKBA 3DQZA 4D96A 1KIMA 4LNHA 5KVSA 5BN5A 3DMPA 2GJ8A 1JZSA 1SKRA 1T1SA 5A9SA 3K0CA 4ALLA 4LWPA 1TU4A 2WYWA 1E94E 4X8LA 3IUSA 5COQA 5JMOA 4AUEA 2X13A 3BFKA 1QHNA 1JALA 5JNVA 3Q98A 4BNTA 3JQBC 3MUFA 1TVKA 2WD7A 4GLBA 5ALJA 3PDUA 4D0LB 5CVJA 3T1VA 4YJGB 3L7LA 7AT1A 4LCJA 3LP5A 4IHKA 4AN1A 5FA6A 2Q3FA 3NVVA 5BVGA 4I99A 1XTKA 4YASA 1G3UA 2BZ0A 2CXOA 2DECA 1IM8A 4ODIA 4Z9XA 4YUVA 3RW9A 3AM1A 2FFHA 2CV0A 3WDSA 2LVBA 3GBPA 2WTUA 3S6JA 1OAAA 2AUMA 3LIPA 2ON6A 2HHTA 5DSTA 3U4DA 4OP2A 3JQQA 1WR8A 4IOKA 5AUNB 2Q5OA 3DD5A 4B0OA 2GX6A 1GTSA 4BFYA 3EEQA 4KV7A 4OJ5A 3IM1A 3BK2A 1IM2A 4C9BA 2QT9A 3U1VA 1KETA 3HCDA 4OO3A 4AQ7A 4HX5A 4C2AA 1V43A 1CIVA 4FNGA 3KJEA 3VDNB 5AT1A 1DV2A 5TPZA 3JRXA 1XEXB 2QARA 2XRYA 3WGGA 2B82A 4IBOA 3ONDA 3AL3A 2X7HA 3G1TA 4YHHB 3H5IA 1U2EA 4OHVA 4MO9A 1ZEJA 4G4JA 3OSPA 3HH8A 1AO0A 2CCKA 1I2AA 3HU2A 4R0VA 2ES6A 2J0VA 1ZH0A 3HADA 3U37A 2AG5A 1UMCB 1L4GA 2QJWA 2YFKA 1ESEA 3S1AA 5KTNA 4FSXA 1GYQA 4MJ3A 3Q8QB 2E8PA 3FG9A 1VIMA 2WJZB 4DWWA 2CZCA 5HJ7A 2P78A 5CYOA 1D6NA 3GL9A 5LQDA 5GY7A 4L4XA 2ZTHA 1OPXA 3M5DA 3E53A 2EBFX 3H5LA 4CIWA 1JHQA 4TLAA 2JFNA 4GG1A 4AFNA 4S05A 4ZC1A 1VKOA 4JQYA 2YB1A 2KN7A 1RZVA 1JQEA 8ICEA 3V5NA 4QUJA 3BC1A 4WINA 1WXQA 3B3GA 4FR5A 4ZHQB 4O5KA 4YVZA 3D0OA 3G8YA 3DH0A 2YIMA 5FUBA 2IKQA 3CRXA 3ZGXA 1QE3A 1UJ4A 4ZDJA 3GLIE 4NLGA 4JLVA 5ALTA 1GSOA 4WADA 2H9AA 4Y6GB 2GBGA 1MDBA 2C95A 2BHLA 1P72A 2WYUA 4JJ4A 4G5OA 5DCUA 1D1QA 1C9EA 3WNDA 3ACCA 2GXAA 4OI1A 1KRXA 4POOA 3LK9A 5LP6A 3SKVA 4EJSC 2PUWA 1A5SB 1NJXA 1OIWA 3INYA 2OVFA 4QZBA 3MBOA 1LPPA 2VNIA 3PJGA 4JD5A 4MPDA 3TNJA 4EITA 3G5AA 3WRWA 2HDNB 3W7AA 3C98A 2A1TS 5HUJA 1KAOA 4C05A 1CNFA 4D7AA 1WZ2A 1NJWA 7REQB 2EJBA 2ZR7A 5KC8A 1NV9A 3VR4D 3ESQA 4GM0A 3TM4A 2JGMA 2ZPAA 1UAAA 2H11A 2BRUC 2SKEA 4DMKA 4ND3A 3DLTA 5A7HA 1UUFA 5EOZA 1Z5VA 1P4AA 2WB4A 1USWA 3W4IA 3N6RA 2R6JA 1ZM9A 1XKQA 4QQFA 2AK2A 4OGKA 1LKYA 3MTEA 3O0DA 4INPA 3NS7A 2RIRA 3V1TC 4HDRA 5REQB 5JXIA 1NLFA 5JH7F 1P1CA 1E98A 5JHHB 1XHLA 2QN2A 4URVR 3CB4A 4B31A 2AXTU 4ZJUA 1Z4LA 1XZ8A 3ECSA 3FHTA 5DHTA 3GV5B 3TZQA 1M9NA 3KUCA 4B0PA 3H13A 4RU9A 3EG5A 5KFVA 2Y9PB 3FDFA 3PNVA 4FFSA 1ULAA 1NUTA 1XL1A 3QWFA 1NUSA 1FW6A 5MFPA 4QREA 2OCXA 2HL6A 4O2AA 1K9SA 4C0LA 4J9MA 3IURA 1Z6QA 4YMIA 3FTQA 3MYRA 5IJ0A 2AFIA 3GCWA 1JU3A 3IDSA 3HRDD 4ARZB 2WVJA 5ICSA 3RVKA 4NTZA 1JDSA 2VWGA 3EISA 5BMOA 3TW0A 1G0NA 1VLQA 2EG9A