2I74A

Crystal structure of mouse peptide n-glycanase c-terminal domain in complex with mannopentaose
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
ERKEILFIPSENEKISKQFHLRYDIVRDRYIRVSDNNTNISGWENGVWKMESIFRKVEKDWNMVYLARKEGSSFAYISWKFECGSAGLKVDTVSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNLRSYNDFSGATEVTLEAELSRGDGDVAWQHTQLFRQSLNDSGENGLEIIITFNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PNGase
publication title Structural and biochemical studies of the C-terminal domain of mouse peptide-N-glycanase identify it as a mannose-binding module.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 48
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1020 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2i74A00
2I74A 2G9GA 2G9FA
chains in the Genus database with same CATH superfamily
2WZR3 1AL21 3NNGA 5JDBA 3DPRA 4WM7C 2JX9A 5LBCA 3H7YA 1AR82 1R1A2 2AEYA 2CGPA 2ZAAA 3T0DA 1S2BA 4EQVA 1HRV1 1ZBA2 1KITA 2D6LX 3JD71 2D3SA 4WV8A 4ZKTB 2PHRA 4NPLA 4CYDA 1RUJ2 4NN0A 2A6WA 2HEVF 2ENRA 2HWD3 4PT6A 4XBNA 2D98A 3AFGA 4CXXA 4XBLA 1RUD2 2VBBA 5E88A 4FVVA 2R6QA 3NNMA 4OVEA 3SNMA 5C8WA 1QQP2 2QQNA 1GZ9A 4B7KA 4BM8A 5BUVA 4LKEA 3OCPA 1AR71 1VR3A 3B69A 2WA4A 3NO8A 4RGGA 3MF6A 5L9RA 5EWSA 4QM8A 1VRH1 4Y1ZA 5JOZA 3SH4A 3ZXFA 2V5DA 5L73A 5EXOA 2C24A 1MEC1 2F6BA 2PHXA 3MIGA 5C9AA 2HWB1 2TEPA 2PLV1 2H6CA 2ZMKA 4AEDA 3M3EA 1H2MA 5C3RA 3R05A 4EWAA 3V64A 2GP3A 2WAAA 3OGGA 5FLHA 4A2UA 4DUXA 1XE7A 1AXYA 3POBA 4XF1A 5FZLA 4CRQA 3O14A 5BNQA 1LESA 4AWDA 2W39A 4UFIA 1VLNA 3H8OA 4G9SB 4YSFA 1MZ6A 2LRPA 3FMGA 3KV5A 5KC5A 1VMJA 1NCQB 4IE0A 1UAIA 3LF7A 3O1VA 4XE9A 5HCHA 1FYUA 2NN8A 1WBFA 2XL7A 3AZWA 1RUE3 1IKPA 4JRAA 5K4LA 3WUCA 2AH2A 2PQSA 2DU1A 3ME2A 4CP9B 3W5MA 1NE4A 3NAPC 1HQNA 2WABA 1DZRA 2OUHA 1UYPA 2XLGA 1SCRA 3OUJA 4QB2A 4QPWA 3RZGA 4H7LA 2J1RA 1L3JA 4FQ4A 4Y5SA 5JSOA 2WNEA 3ZXLA 2ORZA 1SG3A 4YZ3A 2D93A 3RI8A 2I07B 2BWAA 5HCFA 1OC1A 4QX7A 3VL9A 4PIXA 5C5TA 1AYN2 4JKMA 4LITA 3BVCA 4A42A 3MLKA 3OBRA 4QPYA 1KEXA 5F3EA 4K3UA 2QZ3A 3OSDA 3ZFGA 4AGGA 5D1IA 1SLIA 1X7NA 5IWFA 3NL1A 1ZVFA 4Q29A 2ILMA 1FMD1 3O1RA 4ASKA 1YFUA 2RR12 3QH6A 3WUDA 4DEVA 4LTAA 3F95A 4P14A 3FC0A 3HMYA 5DG1A 1XOYA 3B5LB 1SLCA 4BQ4A 5C3QA 2EAKA 2X5IC 4LBQB 2CNAA 1VAKA 4LOSA 1RUH2 4AEMA 5C70A 1OSGA 3I2HA 4CP0A 3SISA 1TE1B 1W06A 1O59A 5JPNB 3LSDA 4MZUA 3VUOA 2XONA 3CL1A 4DEQA 2BQPA 4YW1A 1QGLA 3PMEA 4KWUA 4BIOA 1W0PA 2OX0A 3URFA 4MV2A 1O91A 5F2SA 3IMNA 1S0CA 1UU6A 1W99A 1LOCA 5E16A 4L92A 1QJY1 4YGCA 4P5YA 5ACA2 1GOFA 1UF2C 5FREA 2BUKA 1KXGA 4AVSA 1W9WA 1VBA1 3MF9A 5J96B 1ULGA 3WF0A 2LTNA 4Q4W3 5T5PA 5E8AA 1WCKA 2VZOA 2AREA 5AC91 2VQUA 4Q5OA 1HKDA 4WVMB 5ABJC 2JDHA 1O5UA 1LJ7A 2RDRA 2ADEA 3AVSA 3FHIB 3NNLA 3PIGA 1HRI3 2VOXA 4AQSA 4JGYB 1LHOA 1CAVA 1NCQA 2RJLA 4BWOA 4JDNA 4JQRA 1LECA 1SFYA 1H2KA 2Q8EA 3N7JA 4IE4A 1SDDB 1W8HA 4CP9A 5KXCA 1Q8VA 4MGZE 2DURA 1Q8QA 3ZDVA 3D5OA 1JBCA 4KH9A 4CDQB 1AYM2 4PDWC 3THPA 3ZSLA 1RUI3 4NWWA 1YUDA 1HN0A 3ZFEA 5DABA 3AXEA 4KGQA 3U10A 4NIDA 1LOGA 4AG4A 1XB9A 3NJXA 4N7UA 2RS53 1RMU1 2VMIA 3GNEA 4WVWA 5EYXA 5FPAA 5FYSA 5FY5A 3WD5A 1TME2 4LMFA 3MHZA 4D6RA 5FFOC 4ZU5A 4QXKA 1V00A 1K3IA 1OURA 1PHMA 1VAMA 1WCUA 2HWE2 4H55A 1ULDA 3VDAA 4AOCA 4IEOA 5FY9A 2J1VA 2QQMA 2DU0A 3WCSA 2Q30A 4LIUA 3SKJE 3HAGA 3BPZA 3BTZA 1BXHA 1V9U3 3BCWA 3A0NA 3G7DA 3M3CA 3MGUA 3LE0A 4HSLA 4IV3A 4LBQA 4Y1XA 2C9KA 2ZGNA 4ISRA 2ZGSA 3HNMA 4UFJA 1CIYA 2K9ZA 1POV3 2W08A 3WNKA 4E8CA 1XYNA 1OLQA 2QTWB 3C7GA 2W1QA 1FX5A 1XC6A 5JMCA 4V2WA 4MYEA 4BHPA 5FKCA 2JE7A 1X8EA 3ZN4A 1XNAA 4NUBA 4PBOA 5JPMB 2ERFA 5I0DA 3HPNA 1ZA7A 1JU4A 2GNTA 4ZXKA 4AEKA 2JICA 4O61A 2Q0AA 2W46A 1JN2P 4CE8A 3I8TA 2V5YA 1O6UA 2VZRA 4XCAA 5CG9A 4YZ4A 1R093 4CCNA 3GZEA 4HVRA 4COUA 1JZ8A 1NA1B 3LOIA 5HXMA 4J25A 1I5PA 1VBC1 4CSWA 5KXBA 3MIEA 4EE2A 2J1EA 4XYXA 4AVCA 4JTNA 1QJX3 5DUWA 4YFWA 3USUA 1REEA 4LT5A 1G9FA 5HCAA 1Z7S3 3FHQA 2VC9A 2PAMA 3N9LA 2B7YA 3DYMA 4JDOA 3TN91 3ZMOA 4EN9B 2WFF2 3WQ1A 1OFNA 3WG1A 2R072 3ATGA 3IDBB 4XW3A 3IAQA 3BIWE 4Q0SA 4LULA 5F32A 4BLJA 4CDQC 4PLMA 2P17A 1SFPA 1IOAA 1NZIA 3JZVA 3LZZA 5I0TA 3R4DB 5CYYA 3T2TA 1O3QA 2YBPA 2P34A 1AR83 2CWSA 2TBVA 4Q4V1 1QH6A 1G7YA 2XHNA 1UMZA 1ZBA3 5FPVA 1EYBA 5FP4A 1E57A 1UYZA 3ZFFB 3ZDSA 2R041 1RUJ3 1WLDA 1OOPB 3PUIA 4XUOA 5FPLA 5FY8A 4W6WA 2RVAA 1MACA 5JR2A 3ES4A 5I8YA 4CCLA 1CVNA 4FTEA 1I5ZA 1QQP3 3BGAA 3AMNA 3DL3A 1PGW1 1HDKA 2VQ0A 3H0OA 4OQ8A 2VH9A 3IIIA 4EWDA 4Y4RA 1LOBA 1CZVA 1FNZA 4LQRA 5IATA 1A8MA 4NE9A 1NY71 1J1LA 4LHSA 2RDSA 3DV8A 4XPVA 2H6BA 4Q1RA 1JYWA 4XXPA 5C71A 4I0WB 4COVA 4XZPA 1RUF1 5FOBB 4OHVA 2Q8DA 3ASIA 2DWRA 1HQWA 3K51A 5FZ7A 5CU1A 4DPNA 1W3XA 1BBT3 2CY6A 2QDNA 3D0SA 1K5MB 2I74A 5HBAA 2PTMA 3JCIA 3ZPYA 2Q5TA 1H8VA 3ETPA 3GJAA 3I2IA 3NMBA 4QXCA 5DXDA 3D3AA 3OG2A 4Y5Z0 5FJKA 1PK6C 4YGDA 3ST7A 1OA3A 4GB31 4NHKA 4XFFA 1NA1C 2A7AA 2FHRA 3VZNA 1W39A 1XNTA 4ATFA 1BVVA 2WNUB 1HRV2 5JR7B 3JD72 5L7OB 4Y22B 1WW7A 2XPJA 3CF6E 1JYVA 2ZKLA 1NXMA 2B9VA 2K46A 3B00A 3IPVB 3LPGA 5EPAA 4COWA 4DY5A 1GP4A 3CKHA 4OULA 1ND2C 2P37A 1DQ0A 1AR61 1ZZ7A 5C4WA 1TMF2 5BY5A 2UYAA 4AZZA 1UL9A 1ASJ3 2ID4A 1V6OA 3KT7A 3N36A 3POFA 2Z69A 2YXSA 1VRH2 1MS8A 2R30A 4XUQA 3WW1A 3O0WA 1XE0A 3IT8A 4M01A 4LNVA 1MEC2 2HWB2 1KDKA 4FPHA 5K0UB 3VBOC 2XG3A 3EYPA 4XF9A 3VBUC 2RR13 2UWCA 4D3WA 2ZX1A 4ARYA 3A0KA 1UCXA 2XJQA 2IVJA 1FPN2 2ZGTA 3MDPA 4XETA 4CP2A 2XDVA 4B8EA 1E5SA 2BNMA 3MIDA 5K7PA 2WNVC 2HWF2 1NX9A 3GBFA 4QM9A 4EZ4A 1OOPA 4MG2A 4HETA 4FPCA 2RS32 1N1VA 3ITQA 2EF6A 3TWIA 4A6SA 4D7YA 1GYKA 4RR3B 2VZ1A 1LENA 2D5FA 5AVPA 2IUWA 2X09A 4FAGA 3ZKYA 4AGVA 2OZ6A 1LU1A 1EAH2 2Z79A 4HFSA 2AGSA 4QPGC 1OD5A 4OUEA 4YLZA 4XFGA 1Q8PA 4Q4X1 1Y43B 1LOFC 1RGSA 4N8MA 5FAXA 3ZIWA 3GXUA 1C3HA 2UU8A 4LBOA 4EROA 1JZ6A 1XU2A 4JGZA 3AP4A 4QD2A 4AFDA 3GZUC 1UX6A 4G4FA 5GZFA 4AHWA 5ACA3 2JDAA 3JQXA 4RQPC 3WQ0A 5K8SA 2X8KA 5JI7A 1T2XA 5JVVA 3OD4A 1HXS1 1QWRA 4XF0A 2IZWA 1PVXA 1ZRIA 2CV6A 2GNDA 2KA3A 2WLQA 3H9AA 5EQUA 2WNUC 2ZHLA 5JWPA 4MX3A 3WINE 2HBTA 1W6OA 4H14A 4W6XA 3ZMNA 4RS5B 3ZSEA 1LGBA 2QQUA 5A1LA 1DQ1A 1FMD2 3I2JA 4UW5A 1V6NA 1GNHA 4B4PA 5FYVA 2WINB 5LRRA 3UKNA 3WDYA 1W2AX 4ZS2A 3RJ2X 3ZSKA 2WL1A 3VBHB 4WVVA 3CQOA 5GJ6A 1IQDC 4GWNA 3V65A 4HSJA 1VALA 1YRZA 1AYM3 3LA2A 5F5QA 4YNIA 4Q4Y3 1X33A 1JMUB 4L97A 3LDBA 2QVSB 3LIGA 5FOJB 2VJXA 1REDA 3GZTB 5GZEA 4QQOA 3USSA 4YVSA 1WLWA 1ZBE3 5BNNB 1LAJA 1W90A 3M8LA 3MIHA 1TME3 3VHNA 1OI6A 2IXLA 3N9NA 2B46X 5A3LA 3AKRA 1PMHX 5K0UA 1AZDA 2HWE3 1AR92 1VBA2 2BTVC 2PFWA 4XC9A 3VBRC 4EN0A 4Q8KA 4COYA 4W6YA 1J84A 3HQXA 4PBPA 5LK7B 2IC1A 4RR3C 5AC92 3TOJA 2W52A 1CAWB 4EZHA 2HYKA 1VBE1 1WW4A 4QMAA 3BB6A 4XJUA 3B7MA 4ES9A 1BVP1 1OD3A 1OPOA 3GCXA 1T6GC 1LGNA 1D4VB 3JU9A 4AQTA 4QWNA 2AC1A 1F31A 2B5HA 1VB2A 3H42B 4E2SA 4HVQA 3AZZA 5LY2A 4CDWB 5J37A 4A41A 4BDVB 2VPVA 1IS3A 5IFPA 4X6RB 3LOBA 2ZHKA 4RS5C 3H8XA 1WMFA 1PGSA 4IEYA 5GLZA 3E6CC 1X50A 2Y6LA 3ZX7A 4AHYA 1RMU2 1D7PM 1NCRA 2BDRA 1J1TA 2JG9C 1RXGA 3FX3A 1ND3A 1QY4A 3WNNA 3VBHC 2WFF3 3EJKA 3H1WA 2WZR2 4FOQA 2N7GA 2R073 2ZBJA 1VJ2A 2GC1A 3NRUA 3VDDB 4LBLA 1WCSA 4XQDA 4ZU7A 3Q9OA 5EIYB 3FUQA 1JHNA 2J1TA 2HWD2 3FHAA 1MS0A 1QDOA 2WS93 3PHMA 4LK6A 1SZBA 2XMLA 4E4ZA 4XFIA 3T1MA 4OMCA 2EIGA 1ZZCA 3NKTA 3ZYRA 2WKKA 1C4RA 1GQPA 2OIIA 3NJYA 5FQ0A 4EJRA 2QNKA 1AJOA 3MPPG 4AI1A 4OLLA 4CP1A 5BNNA 2DFBA 2TNFA 1RUNA 4UBHA 5J3UA 1ZM1A 5FUPA 3RSJA 4ZONA 4A7ZA 4HL0A 2A5ZA 3WG2A 3W59A 2R7EB 5JUVA 3VBFA 4WM8C 4XDOA 1JI6A 1VBC2 3EQEA 2ZGRA 5KR7A 3THTA 3J8F1 3OBAA 2B42B 2EXHA 1UY1A 3P3PA 1UIJA 4XDQA 2X10A 4DB5A 4ATEA 1NQDA 2ZEYA 3WHTA 4KWKA 1G9DA 3TN92 4E4HA 3KV6A 4GXLA 1PM7A 2XJRA 2D44A 3CJIC 4LO4B 4JC1A 3UGHA 1AL23 1Q43A 1LRHA 1SPPA 5I8TA 1UY4A 2OZJA 2P5BA 4Q4V2 2PHWA 1GNZA 4YW2A 2O8OA 3AX4A 5JZGA 2BP6A 4NMIA 2ET7A 1IG0A 1HRV3 2JG8C 2WJSA 1RINA 1ZRRA 3JD73 3WCRA 2RMU1 1D2QA 2Y6KA 4KQ7A 3J7NA 5FYBA 4KU7A 4W4ZA 5J09A 4GWIA 1UXXX 4IEUA 4LHKA 5D2AA 4D69A 4HK9A 4XFAA 4D94A 3N4MA 2JECA 1RTVA 3J9SA 1RIRA 5BNPC 3A23A 3RWKX 4HPKB 3BN6A 1NKGA 1PGW2 3SEEA 3MUY1 3I54A 1AR73 4Q0UA 1OMIA 1VRH3 2WRAA 4TWTA 3T1LA 1MEC3 4JZRA 2UURA 1RHI1 3TEWA 1NY72 2HWB3 3VDDA 4YW3A 3ZYGA 2PLV3 1YJKA 1SBEA 2XJSA 3DKQA 1W6MB 1PX3A 5KHJA 1XYPA 3H50A 5CIRA 1RUF2 3HBZA 1R64A 4M0NA 1QXRA 4KWJA 5FYYA 5A6XA 1PMIA 1SCSA 3VV1A 3VHRA 5DMYA 3WQBA 5G05L 3KMHA 3PU3A 4OI1A 3DYPA 2WO1A 3IM0A 4FO9A 4YGBA 1W8NA 1C5HA 4MXWA 2VZUA 4GB32 4OQ9A 1AJKA 2DVFA 3HN3A 5CKMA 3ZN6A 5KXDA 1SQ4A 2J22A 3KV4A 2GNMA 1H0BA 1DHKB 2A6YA 2I2SA 3ABZA 2V09A 3IN9A 4IXLA 2JD4A 4CU7A 3V0BB 1H8TB 5KC6A 1MS4A 2VUDA 4GH4A 3ZSMA 2A6VA 4Q4W2 4E2QA 3GBWA 5FY4A 1AR62 4A3ZA 4IW3A 1KQRA 2QQVA 1CN1A 5FYCA 1BQPA 5DG2A 4QPIB 2X53S 3LFMA 4JQTA 2VW2A 1XQNA 2W1UA 3AZYA 3H3LA 2XWBB 3BYWA 1JZ5A 5A70A 3QCWA 2LROA 4FP3A 5FV3A 5JXGA 2G19A 1B35C 3PJQA 1JXNA 3LFIA 4IE7A 3V56A 1FMD3 4XFHA 1JOJA 3WP3A 1FT9A 3BALA 3LQCA 1KFUL 5CVRA 3TAYA 1REFA 3KCCA 1S4CA 2E33A 4N53B 3IB3A 1P8JA 1RUI2 4WM7B 3O5SA 1CJPA 2E7QA 2ZX0A 3NJZA 3AYAA 2FCTA 4IGPA 5A3PA 3C7OA 3AYDA 4OZXA 3B01A 5FXWA 2RS52 3MIFA 1NE6A 2Y64A 2WZ8A 3FJSA 1RJ8A 2JENA 4GULA 4V1PA 3UKTA 3M7AA 5DUXA 3I97A 1WCQA 3ZXDA 4Q4X2 5JLVA 2HBUA 4BE3A 1ZZBA 5FBZA 1DZTA 3FE5A 2ZZJA 3ZXJA 2RS11 4COZA 1QJY3 1CX4A 5A7OA 2VL4A 3GCWA 1W6MA 1N1YA 1VBA3 1JZ4A 2ZPXA 1VMHA 5IK5A 3OD0A 3T4HB 3ZN5A 4HLTA 3UGFA 3DEMA 5AC93 5IK7A 4KI5M 4BMBA 1RUG1 5BNOC 1S1AA 4GQ7A 3RZZA 3HT2A 2WT1A 4Q26A 2E53A 3H3ZA 3OY8A 3ON7A 3UESA 1YIPA 3AMMA 3WDVA 4Y26A 4AVBA 1AF9A 3V0BA 1H8TA 3U75A 3WLUA 5JAXA 2NLRA 3OGRA 3KF5A 5KHKA 4LBMA 3NV3A 2VOWA 5JIUA 3WZ1A 4XHXA 5FO7B 3NAPB 2HWC1 3PVBB 4QPIA 2G9GA 3B93A 3RG0A 4NAOA 2JDZA 4QX2A 1JUHA 1VMFA 1RMU3 4D6QA 3VZLA 1VBD1 4MHRA 3K4ZA 3MFCA 4O65A 3OBZA 1C1LA 2HH9A 4QB6A 5A3NA 4ZXEA 3KQRA 2A1XA 4HXCA 1AXZA 3AXDA 3EBRA 5D8AA 5E89A 3LSEA 5TSWA 1POQA 2VVFA 2B9UA 4OZOA 1US2A 1CPNA 3B02A 4L2NA 4P5HA 2PHFA 5CKNA 4CUAA 2YBKA 1DQ4A 3JB8A 4FPYA 1LEDA 4N53A 1DLLA 1XNCA 3HD8B 4WM7A 1JS9A 1N1SA 4TXWA 2WZEA 2VE1A 4IDZA 1QNYA 4KGGA 1NLSA 1R081 3AB0A 4LR4A 1RUC1 4IE6A 5BV6A 3VHPA 3NQHA 1LOEA 2X5IB 3B94A 3H3UA 5I91A 4NRMA 3S57A 3JB4C 1IKQA 4ZPIA 1W8UA 1NAEA 1PIV1 5JOXA 2FDFA 4CPBD 1GANA 1K42A 2NZ9A 2FMYA 4Q0PA 2JD9A 1SDWA 1VBC3 1LHVA 3HR9A 3E6DA 1BHGA 1C28A 3QLQA 4BJ0A 4INDA 3LKJA 2WSVA 1SMVA 3NNJA 4Q0QA 5F8PA 1BBT2 2JKXA 2ZGKA 5FZMA 4SLIA 5CNAA 3TN93 2VY0A 4AEDC 4MSVA 1NLRA 1W2NA 2X05A 4DIQA 4MGIE 5ABJB 5LATA 3BTXA 1GQGA 3N9PA 4FFFA 1YHFA 4HT1T 3LCPA 4Q4V3 2V4AA 3ROUA 3I2GA 2DCJA 4M3CE 4F3JA 3RGBA 2Y0OA 1F15A 1W6NB 1RVF1 2QFEA 2R043 2BZDA 3F2ZA 2BPA2 3VZMA 3RQ0A 1JOPA 3WW3A 5L36A 2FZ2A 1XU1A 2CYFA 4NR1A 1S0IA 2GC0A 2R1BA 3AZVA 1ASJ2 1S0JA 2V72A 2WA3A 2WNOA 4J6GA 4ORFA 2YBSA 5F39A 5FZ1A 2VR4A 2ZGMA 4DRRA 4PDWB 2Q4SA 2DVBA 3ILFA 1KFXL 4CCOA 2O14A 5F2WA 1XRUA 4FPLA 3PLQA 4CEWA 5SV5A 2EAAA 4PJYA 1OHFA 4NO4A 5CFCB 5CBLA 1JZ3A 2RM21 1Q8SA 3MO4A 2BU9A 1YYNA 2V73A 3J8F2 2QQOA 5FMOS 3NNFA 1RUF3 2RE9A 5F5CA 3ZFGC 3S6PA 3POYA 1HB1A 1OT5A 1HV0A 1SLBA 3I4IA 2R16A 4N43C 5IT6A 5GLVA 2ZKNA 4S2HA 4CDUC 4FFIA 3MW2A 4QXHA 2FDKA 2FDIA 1LR5A 2VCBA 2ZTNA 1I6XA 3FLPA 2X5IA 5D21A 2EXKA 1FI2A 1DG6A 3OGSA 4GB33 5JOYA 4X6QB 4MGTA 4LE3A 4LLFA 1V70A 5HPOA 2A73B 4K20A 5IHRA 2Q1MA 3K77A 2RMU2 2BW8A 2D3PA 1APNA 4YG3A 3I7DA 1VE0A 3ZYFA 1V6LA 4XJWA 2VZPA 4Q27A 4QHBA 2XL9A 2ZS6B 3QH7A 1AR63 1IPJA 1GU3A 1Z78A 3ZLIA 1YIFA 4W50A 4AFCA 3PVNA 4XAAA 1GSLA 1OVSA 2XOMA 5B4NA 2Y6FA 1XNKA 3MUZ1 2WO3A 4P9JA 3T0BA 4CCDA 4Y4YA 2GNBA 3JBG1 2WQ8A 4QGMA 2FDJA 1W2OA 1RHI2 1HB3A 4TTGA 4AQ6A 5T3NA 3POWA 4FFHA 4R4XA 1SLAA 1V6IA 2A3YA 1FV2A 5A3WA 4M00A 2QQIA 2WSUA 2ZHNA 3VB9A 2UWAA 1YC61 4CDXC 3TNQA 4QX1A 3VBSB 1O4TA 4RA0A 3U07A 3E97A 3ZR5A 4I02A 5EZWA 3ACIA 1LHNA 5A32B 5CAZA 4Q4Y2 5KXEA 4XURA 4YM1A 3WX5A 5CFCC 1ZBE2 3OPZA 3CIHA 3C7EA 1CQ9A 1G8WA 4FXGB 3C7FA 1DGRA 1LOAA 4NOTA 4RYDA 5F3CA 1UIKA 4Q4X3 5LY1A 4X8NA 5T5JA 2B4KA 2ZXQA 5FZ0A 4XUTA 5FPXA 5GM0A 4H2AA 4P9IA 2WR9A 3VKOA 3U0ZA 2YFZA 5J7MA 1W6QB 1Y4WA 1NYWA 1HXS3 4BOWA 2I45A 2IXKA 2JDMA 5IVFA 2A70A 1F8VA 1S2KA 2GALA 4QU2A 1QHDA 2YUEA 3A4UA 4C0BA 1W9SA 4G3YC 3T08A 1OF4A 3IZOA 2A3WA 4LA3A 2YYOA 1CX1A 2W94A 3OEAA 1O3TA 2A75A 2XBO3 5LBFA 5F3IA 2W87A 1SBFA 3E5XA 4YVWC 5DAPA 3BI3A 1PK6B 2GAUA 1CR7A 2KD7A 5A6YA 4JCKA 1LHUA 2A71A 2PA7A 2ATFA 4I3PA 1YQ2A 3T30A 2OQ6A 3KLSA 2EIEA 4GA9A 3LA7A 4UW6A 2VOKA 4XUNA 3AFKA 4WVMA 3W21A 4B1MA 2JDPA 1UPIA 3WNLA 4R9DA 2VAUA 2Q8CA 3FN9A 2VM9A 1ACCA 3PTYA 3P3NA 4BQ3A 4JGYA 1YFWA 1ND2B 3VZJA 1BKZA 5LCWL 3VBSC 2XKPA 2RS12 2Y34A 1CIWA 3CNAA 5GALA 3WP6A 1Y7BA 2VTFA 1BEV1 4RGAA 2EIDA 1XSRA 3POEA 3WW2A 2VQAA 3J7HA 3AZXA 2WAOA 2JXAA 4IQPA 4R9CA 2FDHA 1V6MA 3K3NA 2JIJA 2WS92 2E31A 4CDQA 5EP9A 4LE4A 3VBOB 3VBUB 2GMEA 3I49A 4P9YA 4LHNA 1VBE3 4XAEA 4Y33A 4YW6A 5IAVA 2GSYA 4XQ4A 4YZ2A 1DGLA 4HMZA 1GKBA 2W92A 2WNVB 2FQPA 2ES3A 1ENXA 3WXPA 2J42A 2WWJA 2XXZA 5FLJA 4NAMA 5FP7A 5IVBA 4WZFA 1UOGA 5FYZA 4I0AA 5F9TA 5FIXA 2UWBA 2OW4A 1C57A 1UWWA 1TZOA 4QPGB 2HEWF 4XFBA 4UW4A 4F7ZA 1WW5A 1BMV1 1F4AA 1WMEA 1VBD2 2ZX3A 4O9GA 3K46A 4OMDA 4K8RB 5FPBA 3WNMA 4RQPB 1EV11 1OQ1A 4TZDA 1Z0HA 3MBWA 1AL22 3KVBA 4NHLA 2VBPA 2D5HA 4DS0A 1EY2A 2IXHA 4DXTA 2XH6A 2QQWA 3AM2A 3FFQA 4CU6A 3DCQA 1IS6A 2WN2A 3KM5A 2GP5A 3W9AA 3UETA 2UYBA 3K48A 4LO5B 5FZCA 1COV1 1UYYA 4OHXA 3VZOA 1OUSA 1OA4A 2CGNA 3MI8A 3JUUA 2VZQA 1NA1A 2KM2A 4LXLA 4IUGA 4S2DA 2VNGA 4YM0A 2CAVA 2SBAA 4RGKA 3ZYIB 1RUC2 1DIWA 4F8AA 1O5LA 2JKBA 3OTFA 2ZACA 1NG0A 4FPJA 2C6SA 2BEOA 4B4QA 1AR72 5KHHA 2XUMA 1E5HA 3Q8AA 5EJ1B 4A44A 4LKDA 4LHLA 1MS3A 1M06G 1ND2A 2W1WA 2DCYA 1YFXA 1WGPA 3ACLA 1ULEA 1H9WA 4Y20B 2PLV2 3BTYA 1UU5A 1JODA 2X29A 1HX6A 2ZGOA 5DQ0A 1OQEA 5FZOB 1OXCA 2BYVE 5C4WC 2E9QA 4Y5TA 3PL0A 2VMDA 5A3UA 2XGXA 4N9HA 4NIIA 3J8F3 5JXHA 4FT8A 2WQ4A 1EPWA 3ZFFA 3POJA 3Q8CA 4GMP1 2FCVA 3VBUA 5H9PA 1KS4A 5JOWA 3VBRB 3ACFA 5ANQA 1JOBA 2ZX2A 1YFYA 2PHUA 3J26N 5DDJ1 2W2IA 4UFLA 5L9VA 2HYXA 4NIAA 5FMCA 2CHHA 4I30A 4BISA 2D97A 3POGA 3ZYPA 1CJDA 2H0VA 5H9QA 2QJVA 4FP2A 5FZAA 1DU3D 1QOOA 2BOJA 2RMU3 4QGNA 2VU9A 5C3SA 4UAPA 2UY8A 4QKBA 1ZZ6A 2HLEA 2VUAA 2D3RA 3MV11 4IESA 4LO8A 1LOFA 3AYEA 5L19A 5LA1A 2EXIA 4AE2A 3MICA 2CDPA 2PQQA 4HVOA 1D0GA 3GM8A 1K5MA 2LUWA 4GWMA 4MO3M 5BPXA 4CU9A 1LCLA 1OKQA 4QKNA 4NWVA 4Z2AA 4Q1PA 1ULOA 1RHI3 1W6PB 3CMGA 3MFAA 2RM22 1QNWA 3MYXA 4CPBA 2MEV1 2JG9B 4KNCA 4XJZA 4AR2A 2BV4A 2WNUA 2DUPA 3BUCA 2XBO1 4BQYA 1FOD1 4ASLA 5L7OA 3CZJA 4Y22A 3UT0A 2AENA 2L9LA 3BKZA 4OUMA 3RRDA 1OBNA 1U5XA 1YXWA 1CAXB 1PO21 3KT4A 1QOSA 3IPVA 4CU8A 1W8FA 3S7EA 4BU2A 1UNBA 2VW1A 3A22A 4ZU4A 2Q1FA 2J7MA 5ISLA 2O8QA 4A7KA 4FXKB 2P6CA 5F5IA 3TRSB 4UOJA 4AAPA 4QDQA 3RFRA 3N35A 3PUAA 4R4ZA 4XF4A 4FSJA 2E7TA 2WO7A 3RJRA 3SQOA 4BQXA 4A4AA 4NVPA 1QJY2 4M3CB 5HXVA 5F5AA 5FZOA 1WWYA 1EP0A 4PQ9A 4AI9A 4YFZA 4HZFA 1OH4A 2YY1A 3LIHA 3U37A 4LORA 4YWAA 4C90A 1SACA 2BOIA 2R0HA 2EA7A 4YVSC 3CEWA 4XJ8A 1X9PA 4PI2A 1SBDA 5SV8A 2F4LA 2OXBA 3WSOA 1DQ2A 4W65A 2B8MA 3ZSJA 1JTZX 5LA0A 4IV1C 4WM8B 3UGGA 1WKYA 1OQDA 4NPRA 3AMHA 3JBG2 4UI9L 3AL5A 3U78A 1UMHA 5FP8A 3AP7A 2JB4A 4RR3A 4QQLA 2EICA 2F4PA 1S0BA 1PZ7A 1LEMA 2D40A 4GD4A 5F6LB 1WZXA 3WF1A 1WLTA 1HW5A 4LA2A 3CJIB 3PU8A 5FZHA 1VBB1 1R1A1 4QX8A 1HLCA 1KGYA 4XQWA 1ONAA 2QQLA 3SHRA 5FJHA 3T2QA 5A1AA 3SLIA 1UQXA 4HG6B 4UWDA 3KHCA 3VHOA 5I8SA 4JDMA 2JG8B 4BMEA 4C0HA 1PZ8A 3N7KA 2Y6GA 1RUD1 4QGLA 2D6MA 4QQ2A 5I93A 4YM3A 3DYOA 5G04L 1Q8OA 1JZ7A 4UBGA 2QKDA 4MADA 4MGYE 2WDBA 4RS5A 5BNPB 3NWKA 2RS13 1F5FA 3IIAA 4GKXA 4BIFA 3E5QA 3I2KA 2BFUS 5HI0A 3UNPA 2CAUA 1NCRC 3GALA 2ARXA 1H2NA 2RJ2A 2P3YA 2WBKA 3I3QA 2IXJA 3VBHA 3VKNA 4XZUG 4AK3A 5C7GA 3GHNA 3KD4A 1TG7A 1VP6A 5FR3A 1RUG3 3H8RA 4ARXA 1EPZA 1OH3A 3JQWA 5GZCA 1N47A 1WUVA 2B39A 4M3CF 3QACA 5J98B 5T54A 3RVHA 2XB6C 1V0AA 2NP0A 3HVDA 3ZYHA 4JKLA 4Z1VA 4NIHA 3ORJA 4YW7A 2XLAA 2ARAA 2YV8A 2XVGA 3IAPA 1GMMA 5CZKA 3M3IA 2WC2A 4HBNA 4CCJA 5HCBA 3MPBA 1CAUB 3MW4A 3T3YA 1IPSA 4H3WA 5C8CC 3UL2A 2VVDA 4S2FA 2HWC3 5FRAA 4K40A 3GZAA 1J83A 1CAWA 4E27A 3HIFA 5EFUA 2CDOA 4WM8A 5IW0A 3CO2A 1VBD3 3W5NA 3EO6A 3D8CA 4XCBA 1AYN1 3VBFC 4GIQA 2WYFA 2R49A 4XBQA 1SFNA 4CEYC 2C26A 4NROA 5CKQA 3MEPA 3RYRA 4AVTA 5FZ8A 1W0OA 4I3GA 4HOOA 5I0UA 5A33B 1JH5A 2VECA 3LDRA 3N9MA 5FP9A 5LRSA 4HN0A 1YJLA 3CJIA 3O0XA 4DNYA 2OPWA 3TEZA 4CDWA 2R042 1B35B 3AKTA 5DN2A 2JJ6A 1WD4A 4K9SA 3LAGA 4BXSV 1U5IA 5CG8A 2WIIB 1RUH1 2AYHA 2NMOA 1DLCA 2YB7A 1R083 2DVGA 1W9YA 1RUC3 4BQ2A 4XJ9A 2D6KA 2DUOA 1ST8A 2GH2A 5C6CA 5JZGC 4JHTA 1H30A 2Y38A 4FPOB 3SH3A 3TEXA 1C8M1 2ARCA 1MQTC 4NRPA 5IK4A 2A6XA 3O7OA 5BNPA 1PIV3 1IQAA 2GU9A 1S0EA 1UZYA 4C1XA 5FMOL 5A7QA 4Z8BA 4EWEA 2WWSA 3KGZA 2NYYA 2Z2SB 2OVUA 4YW4A 3X29B 4HKOA 1BMV2 2VMFA 3IDEA 4LK7A 4P08A 2LW8A 5T52A 1YQ8A 1CZTA 2WN3A 4UF0B 5GLWA 5LK5A 4R52A 4RFRB 2QBXA 5IUQA 5A80A 1UY3A 2Y6JA 4CXWA 3N9OA 1F35A 2DCZA 1EUTA 1MS5A 1LULA 1UXZA 2D6OX 2ZMNA 3RI9A 2VXRA 2BGPA 4DZGA 4KU8A 5BNOB 5C3OA 4PIZA 3I3BA 1DYOA 3OYWB 2C5DA 3TYJA 4XTMA 3RDIA 1ULPA 3ZIXA 4YM2A 2IFRA 2OYZA 1NT0A 2Y0IA 3FUOA 1RVF3 3PMSA 4QAWA 1UZZA 3AJYA 2D6NA 3C7HA 1WMXA 2YGMA 3AKPA 1IS5A 3HNYM 4V2VA 3VDCA 3ZYJB 4L99A 3R6SA 4ET7A 5IVEA 1HJFA 2VW0A 3WG4A 4FAHA 3N7LA 3LB9A 1QXPA 4BA6A 4EYUA 3AVRA 3VD5A 2PHDA 4E8DA 2DTWA 1QJEA 4D6SA 4R9AA 4LPLA 1HIXA 3U4XA 1O4YA 2XJTA 3PUQA 5FMDA 1OA2A 2RM23 3ZO0B 2ZHMA 1B35A 5FXXA 2ET1A 2ZMLA 2XQXA 1PZ9A 2NM1A 3BIEA 3IBMA 3KQ4B 5ANNA 5FYUA 4DXZA 4FOWA 5EJ3A 1W04A 3QD6A 1W2UA 2XJPA 4SBVA 1WMDA 1GZWB 1DQ6A 4HPKA 3I59B 3ZR6A 1PO11 4JAAA 1GZCA 1X9TA 2QUOA 2Z42A 5FY7A 1V6JA 2Y26A 3W58A 5CFDC 5J48A 3DPRB 5GZDA 3L9JT 3O1TA 1DP0A 5ERLA 2JB8A 4XF3A 4GJYA 2NMNA 1UN1A 1JUIA 1Y3TA 4BB3A 1OKOA 3VD3A 1HXS2 1BK1A 5GKAC 3OPTA 4PQQA 5LA2A 1RL3A 1I1EA 3QOPA 2VOTA 1D4M1 4E9KA 5T50A 4UF0A 4CCEA 2NQYA 2YU1A 4Q2FA 1XE8A 3U11A 3UV9A 2IWGB 3JBG3 2R32A 4CCKA 2O1QA 4XIKA 4BXFA 4BCUA 4M4RA 4MXVA 1NZCA 2ZGPA 1QJU1 2XBO2 5BNOA 5C9AB 1FOD2 1YEWA 4AEDB 3ZXAC 2P2KA 3WP4A 4MGKE 3RS6A 1PNFA 1W9TA 1UMIA 5FBJA 2J1UA 3LA3A 4TYSA 4JX0A 1IG3A 5FTTC 3PURA 3BODA 3VDBA 2XLFA 5T5OA 1X8MA 3DECA 1TQ5A 4N90A 5FY1A 4L9BA 3WNPA 2WZPP 1AX0A 1ZNPA 4K21A 4DOUA 4LUMA 5FKBA 1VB4A 1FATA 1F4HA 1ULFA 1W8WA 3ZXKA 3RZKA 1DZQA 2BRTA 3BTAA 1H6YA 1CZSA 3OOXA 1OLRA 2W68A 2E32A 3PNAA 1W8ZA 2ORXA 3DXUA 1AX2A 2Y60A 1ULCA 1DDLA 3LD8A 3OPWA 4EV0A 4E4DX 1VBE2 1KJRA 3I2OA 2QQKA 1RB8G 1QDCA 3I2DA 4ONUA 3DPRC 2GN3A 5AFEA 4OHYA 5IVYA 1POV0 1GP5A 2ZX4A 2ZEWA 1DFQA 5F37A 2WO2A 4XJAA 3PVOA 4Z82A 3ZFGB 3IDCB 2GC2A 4B1LA 2CSGA 4N43B 3Q8BA 2Z5WA 3KF3A 4XACA 4CDUB 1VBB2 5JMOA 1AX1A 2VUCA 3BOWA 4LEJA 5KBFA 2CWMA 5JSRA 1UOFA 2QZ2A 5HV0A 1AL0G 3KS7A 4L8QA 3S5QA 4P9GA 2BJSA 3AMQA 3WV6A 2FZ1A 5I0RA 2O0OA 5FPUA 5FYMA 2IXIA 2KXLA 1HV1A 5FO8B 1TMF1 5C9AC 5FYIA 2Z4FA 3FLRA 2BGOA 1OPMA 2DVDA 2ZABA 4IEWA 3OF1A 3O12A 3RYPA 1ODMA 4XFCA 4YYOA 3TBDA 2OQ7A 3GYDA 2OKXA 3N9QA 1FAYA 3C3VA 1SEFA 4P00B 4YG0A 3WNXA 1BEV3 2VMEA 1U0AA 3NV4A 3U4SA 1S2EA 2MHFA 2DBIA 3WF4A 4S2GA 3B9IA 3WW4A 1YLLA 1PMJX 2BERA 1CGPA 4IGQA 3RZLA 3E6BA 1GZTA 1FPN1 4QKFA 3O1OA 1WBLA 5C33A 2VO5A 4UW3A 1GWMA 2BBVA 4XILA 1YQ6A 2HWF1 1PVC1 1W8TA 1XPWA 2E6VA 3LDKA 2VMCA 1YWKA 3NAPA 4LBNA 4LLOA 3ACGA 4CDXB 4CVUA 2RS31 3WF2A 1CAVB 1DGWA 2P6HA 1JZ2A 5LEJA 3O1UA 1C8NA 1CD3G 3KVAA 1C5IA 5FDBA 4DQAA 4HONA 2TUNA 2EALA 4UFKA 5FZ4A 4KMQA 1EAH1 4AI0A 2DUQA 5CISA 3HQRA 1C1FA 4F83A 3ELNA 3J7MA 1UO9A 2R0FA 2W91A 3NSTA 1JU3A 3CHXA 3N7MA 1L7LA 4P9XA 3ZVXA 2YROA 4YARA 3AP5A 1QKQA 1NUKA 3ECQA 4CEWC 1ZX5A 3T09A 3ZFEB 5FUNA 5LEKA 2VD7A 4NHXA 4QDSA 1AUYA 1GFF2 2YPJA 1U5YA 1H1AA 2PXJA 2VNRA 1MZFA 3EHKA 3FBMA 3POSA 3AKQA 4HANA 2DYCA 1EV13 3GF6A 4RFT0 1XYOA 1JYTA 4L11A 4AAXA 2P3JA 5K9YA 3KB5A 3NV2A 2W9XA 4JRLA 4N43A 3NKGA 4CDUA 2VNOA 1E5IA 3AC0A 4NHYA 1OLME 5DAWA 2QQJA 1COV3 2C9AA 3UYJA 1GWLA 5LA9A 1NLQA 4IV3B 1H4HA 3LEMA 5DAVA 1XXNA 1HB4A 3K2OA 4MH0E 1ODNA 4BYYA 2ZGQA 4YVWB 4A7YA 1A3KA 4DUVA 3ZXEA 4AI3A 4GWJA 3MW3A 1C8M2 2J1SA 1MPXA 2C0ZA 1US3A 2BVVA 2GN7A 2JDKA 2VG9A 3OUIA 3DUIA 1UOBA 4LKFA 1OFSA 1YO8A 2VCCA 1UX7A 4RHV1 1S0FA 5GZGA 5CEHA 5ABJA 1G6NA 2HKXA 3M2MA 4EN6B 1HN1A 4OCTA 4QHOA 4J1WA 4FTSA 4QHZA 2ARBA 1AR91 2XVLA 3D0JA 1J58A 4Q8LA 4QXBA 2EXJA 1ENRA 1W6NA 3WDWA 1NCQC 4CUGA 1A78A 4GMP3 3TB0A 1RXFA 3USUB 2VTXJ 2AUYA 3IKWA 1T6BX 1LKNA 3M3QA 4PF5A 1JYNA 3ACHA 4AXOA 2PHLA 3I2FA 4Y24A 1QEXA 2ZGLA 4CDXA 4AYUA 4PIYA 2HJIA 5DDJ3 2XKOA 3LEIA 5EV7A 1QOTA 5DZGA 5A7WB 4PDWA 4MOAA 5F3GA 4RL7A 1LNSA 3B9CA 4FPGA 4PLOA 5FZ3A 4KBBA 1HQLA 2DF7A 5H9RA 5FZBA 1H2LA 3PUHA 4U36A 1QJZA 2P3KA 4QDRA 5CFCA 3ZFEC 3M70A 3O1SA 1J3QA 4AI8A 4UFHA 2PYTA 1GLHA 2GMPA 4FPFA 2DV9A 3SCHA 3W20A 5M0TA 4YZ1A 3LGRA 2A6ZA 2D43A 4E4SA 3G6JB 3GJBA 4OUSA 2Y33A 3TEYA 3EMRA 1G86A 3CBNA 3ILNA 5JXIA 5LBBA 4Q0VA 1GUIA 3DXTA 3NV1A 1ZRFA 1QJFA 4QKDA 5FZGA 4IV3C 2MEV3 2WZR1 2XVKA 5FZ6A 1Y9MA 1FOD3 1UY2A 3Q8FA 4IEZA 4HKWA 1PO23 5JXJA 3EXUA 1OVPA 4HKLA 4O7XA 4BQWA 2RV9A 2XR4A 2HWD1 2PAKA 4XEZA 3RMYA 1A8DA 4GKYA 4PI0A 1W2TA 1UYXA 4YVWA 2XJVA 1QH7A 3AMPA 1PO12 4C91A 3RZMA 2IVIB 5FXZA 1KS5A 4XIOA 4MLOA 3WT3A 3Q8EA 3HNBM 4RN5A 2BFUL 4GZ9A 4IE5A 3DKWA 1WD3A 1IGOA 2DDUA 4JGYC 3VBSA 3M1HA 5FLIA 2R063 2QQPA 1D4M2 3PJYA 5C4WB 1RUG2 5A32A 2ZA9A 2XHKA 5DZFA 3HEIA 5EHDA 1O3SA 4PCRA 3MIBA 5FZIA 3VL8A 5IK8A 1AXKA 2ZJCA 1J59A 5A6ZA 3VZKA 5FK7A 2J1AA 4DRVA 5A7WA 2WWUA 3GGLA 1QJU2 1YQ5A 2MPFA 3S30A 1IZ3A 1ALYA 2G9ZA 4ITCA 3U1XA 4FPEA 1UZVA 5FMBA 1RUE1 3WDTA 5B2GB 5KWRA 1DF0A 1MVEA 1VBB3 2JDNA 2P1BA 1DYPA 1R1A3 2DVAA 4L0PA 4TLFA 3FZ3A 4OFGA 4YG6A 4BPZA 4J1XA 4ISQA 2VZTA 4P02B 4CTEA 1W6QA 3KHBA 1XSQA 1YCIA 1SHWB 2HWC2 5C3PA 5JSPA 3VGIA 2GZWA 2VCAA 4YRDA 3WDXA 3RZHA 2YHJA 1STMA 1RUD3 3WY6A 1H1IA 4ASMB 1JYCA 1N1TA 2EIBA 2G1MA 2ZEXA 5J1XA 1AVBA 2ADDA 5LASA 3PUSA 2QE3A 3VKLA 4BQ1A 1YI9A 5LWBA 1E5RA 2SLIA 1BZWA 3BU7A 3H1MA 1RITA 2OT7A 3OJBA 2BNNA 2RJKA 1LU2A 4JVAA 4K1ZA 1O8SA 3OEBA 2WT0A 4JGZB 3AP6A 4W8JA 1PGL1 5KHGA 1PK6A 4LBKA 3RPQA 1F2NA 1W3VA 2Q1ZB 4Y1VA 1RC6A 4R9BA 1O8PA 4B29A 1QIQA 3VD9A 1MVQA 1NQJA 1DCSA 1R082 2AEZA 3ES1A 4NIGA 3CZUA 3UKVA 3O1PA 1GBGA 1URXA 4LKSA 1UZ0A 3ENRA 4FPKA 4PLNA 2EVXA 1W6OB 3SCFA 1S55A 4PF1A 3T2OA 2KR2A 2D7FA 5B4XA 2FBEA 1LODA 4EN7B 5IVJA 1PIV2 1N3QA 3O0VA 3T0AA 3ZYBA 4AI2A 1CESA 4U2AA 3H8UA 1OUXA 1BK0A 1GICA 2BGCA 2CU5A 3LPFA 4KBZA 1DQ5A 2YC4A 1JW6A 2ZAHA 4RSUA 3GHMA 3SMHA 2V4VA 2DBNA 4B7EA 2VTXA 2VZVA 1SLTA 3PIJA 4ZZ5A 3L2YA 4Q4W1 2RHPA 1XNBA 4P9WA 3VBOA 4IEXA 2WUHA 4AF9A 5IAXA 3O1MA 1Y9GA 2PELA 3UK9A 5CA6A 5IVVA 2PAEA 4A6OA 1AYN3 1XNDA 1W9FA 2AR6A 2JDYA 1HRI1 3R4SA 4YVSB 3ZOIA 4JKKA 4OI0A 2WNVA 4H7MA 3SKVA 4DO0A 5LB6A 1PX4A 4META 3ZFFC 2YMZA 4IV1B 4AGRA 1Q3EA 2GMMA 1OOPC 2K0GA 3MLJA 4NPMA 1RVF2 1H4GA 2E51A 4FTBA 3RNSA 1VIWB 3WNOA 3N3HA 1UPSA 4OI4A 3RZJA 4FQZA 4JV4A 4QPGA 4UFMA 3T4VA 3WG3A 3WHUA 3KV9A 1PVC2 2VQTA 2YGLA 1RUH3 3NJVA 3APBA 4XXAA 1DGWX 1RUI1 3R4UA 2W3JA 1QF3A 1S0DA 1YNAA 5LBEA 4ES8A 1UKGA 4XDPA 1J3PA 1MZEA 1QU0A 2OUJA 4M4PA 2OS2A 1C8M3 1YI7A 2P4EA 4D7SA 4QQPA 2RS51 4RQPA 1UKRA 3LEGA 4JGZC 3T2PA 1ZZ8A 1VAVA 1S0GA 2BWCA 4OYUA 1MS1A 3CU7A 4BZ4A 3CDZB 4GAZA 3ZM8A 2MNGA 2IXCA 2XUEA 1F5JA 2AACA 4GJZA 4QX5A 5EJZB 3SH5A 4Y1YA 1U12A 1K5MC 2LM3A 4BLIA 3NVCA 4Y1UA 1UY0A 3JXSA 4LO7A 3R0RA 4LIVA 1V9U1 3POIA 1KRIA 1H6XA 2VCMA 2DCKA 2VNVA 3D6EA 2A3XA 1POV1 2XWJB 3LEKA 4QQHA 4XVHA 3WDUA 1NCRB 2VMHA 2DCTA 5DPNA 1BCXA 2VXJA 4UXAA 1ND3B 4AEJA 4DINB 5L7OC 1TEIA 5FZ9A 3DN7A 3ZPOA 3WR0A 1YQCA 4A45A 3K4AA 5C5UA 4I09A 3SITA 1BLZA 1GV9A 4Y20A 3FLTA 4R8HA 3HT1A 4M0HA 4URTA 3HJRA 5FO9B 5E1RA 1PGL2 1WW6A 1Q56A 1DGRN 5FXVA 4KG0A 1R091 1G9AA 4LJHA 2YFUA 4LBJA 2E63A 1A34A 4NRQA 2W0XA 5CADA 2C1FA 3INAA 3ETQA 2R061 4IEPA 3VKFC 1GP6A 1QJX1 1LTEA 5FZKA 3VN4A 3VBRA 3IDAA 1Z7S1 4MGQA 5C8CB 5FQ0B 5F6KA 5K0UC 5FWJA 4LUKA 1VPHA 1WA4A 3AJZA 4RHV2 2YDEA 4TSVA 4FBFA 3UJOA 5FZEA 4BH9A 2VUJA 4JTOA 2RDQA 1IHMA 4XTPA 4YW5A 1VRBA 4IV1A 3FBYA 3C2UA 4QU1A 2C4XA 5APAA 3VBFB 3P6BA 1AR81 5FZFA 2F17A 4CEYB 4CA9A 3E1F1 3DGTA 1ZBA1 2JE9A 4GALA 3MV01 2D6PA 2PMWB 1ENQA 4NJ4A 1JYIA 1RUJ1 2VGDA 4KG8A 4I0BA 2WYSA 1I3HA 3AP9A 2BVBA 2H0BA 4DXRA 1QXJA 5CB7A 1PO13 2OPKA 2JIGA 2WT2A 1GQHA 1QQP1 3GBGA 4IEVA 2QCSB 3DF0A 3H1YA 1X36A 2YC0A 4DFSA 1SPPB 5A3OA 5H9SA 4AFAA 2YC2A 2DFCA 1BYHA 1W6PA 5JZGB 1FNYA 3SEPA 2JG9A 3H7JA 2LALA 5DAXA 2GDFA 4UYBA 3D4KA 1GR3A 4YGEA 1MQTB 3GDBA 5A3MA 2YG0A 3AL6A 1ND3C 1CAXA 5FYTA 2ZEZA 2JDUA 1D4M3 3VKMA 3AKSA 3M4FA 1H1MA 4XUPA 1BBT1 3LWCA 4MHUA 5J36A 1L7QA 1UW8A 5FYHA 1W0NA 1KJLA 2OA2A 5DUUA 1R1ZA 2DTYA 4JHZA 5EYYA 4OHZA 4LOTA 4AQ2A 5FCCA 1QJU3 4K7JA 2VZSA 1OF3A 4FI9A 2XQRA 1NXD1 4CUBA 4M3CA 4AL9A 3ZKUA 4UT5A 1ZYBA 4URAA 3VLBB 3KCYA 2UY9A 1CPMA 4MUVA 1U5ZA 2P3IA 1G9CA 2WFPA 3I3MA 5BNNC 5IJRA 1UOJA 2BBAA 3UJQA 2W5FA 5IFTA 2VOVA 2VMGA 1ZA4A 4IGOA 4K6BA 4MXWB 1ASJ1 3SCGA 3THCA 4XABA 3ZN6B 5C8CA 3A7QA 1V6KA 4YPJA 3M3OA 1O3RA 1BEV2 1X82A 1W28A 1ZRDA 4AHXA 2Y8KA 4TN7A 3KCXA 4AFMA 2RR11 4GH4B 4K1YA 5E6HA 4IETA 3RMXA 4KL1A 1WA6X 4MVTA 4XOGA 4B3NA 2Y6HA 4CEYA 4RD7A 5AVAA 2FMDA 2K2SA 4WVZA 4E2GA 2W47A 3OGVA 1TVGA 3KZ4C 2CGOA 2HEYF 2JG8A 2VBDA 3V0AB 2AZ5A 3WF3A 5I0SA 2GH8A 4N9IA 2YU2A 3S0MA 4FCAA 4CXYA 3WP5A 4CDWC 5JI9A 1RUE2 2WQZC 3PTRB 1RYYA 4EN8B 2JWPA 1OLMA 4AVVA 4IEQA 1H9PA 1O4ZA 3FWEA 3PVEA 1ZZ9A 1L7RA 4CCCA 4I2OA 3VD4A 5CFDB 3PDQA 2CL2A 1MQTA 4QT6A 5ACA1 3ALQA 3K3OA 3U14A 5FK8A 3K4DA 1F9KA 2FCUA 4LBQD 2CTVA 1TMF3 1RUOA 3VDDC 3FFZA 4XHBA 5A1FA 1EV12 1W03A 1AHSA 4ZY9A 1J3RA 1SLLA 4DMIA 4C8DA 5JCTA 4FOVA 3WQ7A 5HV4A 4BQ5A 3KSCA 2RDNA 1JHJA 1COV2 2PHTA 4I01A 2VVEA 1HB2A 4K8FA 4N7IA 3BOPA 2JE8A 4X8PA 1LHWA 4XMAA 1CAUA 3IWZA 3S5AA 1FPN3 2W1SA 5FPZA 1BJQA 1KDMA 5T5LA 4AHZA 4B4RA 1AYM1 2HWF3 2WLPA 1PVC3 3HQUA 5IVCA 5FP3A 3AK0A 1ENSA 3L2HA 4Q4Y1 4HN1A 3SXWA 1GWKA 2RS33 5A7PA 4CZSA 1K5JA 4ZS3A 4D7TA 1HJGA 3OBTA 4DXSA 3AYCA 2FDGA 4GH4C 4HK8A 1ZBE1 1NOVA 3OY8B 1EAH3 1TME1 3WOGA 1GNYA 4KWLA 1N3OA 5GLUA 3QBQA 5F7UA 1WCDJ 4FOYA 5A33A 1A6CA 3OGJA 2ZCWA 1IPKA 2FD8A 3S7IA 5FY0A 5A6QA 3KGLA 5LZ6A 2HWE1 1M4WA 1DBNA 1LGCA 4A3XA 5BYNA 4QB1A 1D0HA 3TNPB 3KWVA 3P5BA 3EB7A 1QMJA 4XMIA 3J4UH 4DY3A 2W95A 1HRI2 5DDJ2 3V0AA 3KT1A 1KD7A 2GC3A 3THDA 3MLLA 3P1IA 2Q8OA 4WZCA 1RJ7A 1K12A 4Z92B 3A21A 5D8AB 5DZEA 1JYXA 1W8OA 1K45A 4P9LA 4AW7A 2RG4A 4QX3A 2ZZQA 3NW4A 3HWJA 4PHZA 4FFGA 5T55A 4O9EA 1Q5OA 5CFDA 1LB2A 2R1DA 1DYKA 4OHWA 4AFBA 3WEZA 4OI2A 4C1WA 1CWPA 4NHMA 2IFWA 1TNRA 1B09A 1O7FA 4LO6B 1GOHA 1Y9QA 2B45X 3FL7A 3RWNA 3J7LA 2G4IA 3K75B 5FWEA 5IYYA 1TNFA 4RHV3 4WBBA 2WFF1 2MEV2 3RYKA 2R071 2QDRA 4Z2WA 2E26A 1EUUA 1UD1A 4IERA 3OYWA 4D0QA 4DUWA 1UU4A 2VULA 1AR93 1CONA 1PO22 1V9U2 2G9FA 3HBKA 5DUVA 3SC7X 1PM4A 3CJXA 1FV3A 4TLGA 2XJUA 3ZXGA 4BK4A 2ZOEB 5LW9A 2WS91 1MZ5A 2NPIA 2ETEA 3OB8A 5F1RA 1ZREA 4GMP0 1UZWA 1MR5A 4IL7A 1I9RA 1D2SA 2JEMA 3D82A 1MS9A 1IS4A 1GOGA 1XJAA 1H8TC 3B3QE 4Z07A 5GLTA 3OUHA 3WVJA 5A7NA 2E7AA 4Y3OA 5A3TA 1FXZA 1XBFA 3E5UA 3ILRA 3VD7A 2YZ4A 3CLPA 2ZGUA 3BPSA 4BK5A 4QPIC 4MGSA 5AFBA 3MZHA 1ZRCA 1R092 4D8MA 4CUCA 2VZ3A 5DAQA 3BU0A 1W05A 3HOBA 3HN1A 5KHIA 4CCMA 2YPDA 3IMMA 3I3DA 2R062 4ZHNA 2PN5A 2BNOA 4AVAA 1QJX2 5FUIA 5JIAA 1Z7S2 5D8AC 5FZDA 1PNGA 4ZZ8A 1N3PA 1WLCA 1G9BA 5A7SA 4QX0A 5BXXA 1GZWA 5L9BA 2LS6A 3I59A 4YZ5A 3I3EA 4CEWB 3C8XA 4N53C
chains in the Genus database with same CATH topology
2WZR3 1AL21 5JDBA 3DPRA 4WM7C 2JX9A 3H7YA 1AR82 1R1A2 2CGPA 2ZAAA 1S2BA 1HRV1 1ZBA2 1KITA 2D6LX 3JD71 2D3SA 4WV8A 4ZKTB 2PHRA 4CYDA 1RUJ2 4NN0A 2A6WA 2HEVF 2ENRA 2HWD3 4XBNA 2D98A 3AFGA 4XBLA 1RUD2 5E88A 4FVVA 2R6QA 4OVEA 3SNMA 5C8WA 1QQP2 1GZ9A 4B7KA 4BM8A 3OCPA 1AR71 1VR3A 3B69A 2WA4A 3NO8A 4RGGA 3MF6A 3WDUA 5EWSA 4QM8A 1VRH1 4Y1ZA 5JOZA 3SH4A 3ZXFA 5L73A 5EXOA 1MEC1 2F6BA 2PHXA 3MIGA 5C9AA 2HWB1 2TEPA 2PLV1 2H6CA 2ZMKA 4AEDA 3M3EA 1H2MA 3R05A 4EWAA 3V64A 3OGGA 5FLHA 4A2UA 1XE7A 1AXYA 4XF1A 3O14A 5BNQA 1LESA 4AWDA 2W39A 1VLNA 4G9SB 4YSFA 1MZ6A 5KC5A 3FMGA 1NCQB 1UAIA 4XE9A 1FYUA 2NN8A 1WBFA 2XL7A 3AZWA 1RUE3 1IKPA 4JRAA 3WUCA 5BUVA 2AH2A 2DU1A 3ME2A 1NE4A 3NAPC 1HQNA 1DZRA 2OUHA 2XLGA 1SCRA 4H7LA 1L3JA 4FQ4A 5JSOA 2WNEA 3ZXLA 4YZ3A 2D93A 3RI8A 2I07B 2BWAA 5HCFA 3VL9A 4PIXA 1AYN2 3MLKA 3OBRA 4QPYA 4K3UA 2QZ3A 3ZFGA 4AGGA 5D1IA 1SLIA 1X7NA 3NL1A 1ZVFA 4Q29A 2ILMA 1FMD1 1YFUA 2RR12 3QH6A 3WUDA 4LTAA 4P14A 3FC0A 3HMYA 5DG1A 3B5LB 1SLCA 2EAKA 2X5IC 4LBQB 2CNAA 1VAKA 4AEMA 1RUH2 1OSGA 4CP0A 3SISA 1TE1B 5JPNB 3LSDA 4MZUA 3VUOA 3CL1A 2BQPA 4YW1A 1QGLA 3PMEA 4BIOA 1W0PA 3URFA 4MV2A 1O91A 3IMNA 1S0CA 1UU6A 1LOCA 5E16A 4L92A 1QJY1 4YGCA 5ACA2 1UF2C 5FREA 1KXGA 2BUKA 4AVSA 5J96B 1VBA1 3MF9A 1ULGA 2LTNA 4Q4W3 5T5PA 5E8AA 1WCKA 2AREA 5AC91 5ABJC 1HKDA 4WVMB 1O5UA 1LJ7A 3FHIB 1HRI3 2VOXA 4AQSA 4JGYB 1LHOA 1CAVA 1NCQA 2RJLA 4BWOA 4JDNA 4JQRA 1LECA 1SFYA 1H2KA 3N7JA 5KXCA 1Q8VA 4MGZE 2DURA 1Q8QA 3D5OA 1JBCA 4KH9A 4CDQB 1AYM2 4PDWC 3THPA 3ZSLA 1RUI3 4NWWA 1YUDA 3ZFEA 3AXEA 4KGQA 3U10A 1LOGA 4AG4A 4N7UA 2RS53 1RMU1 2VMIA 3GNEA 4WVWA 5EYXA 3WD5A 1TME2 5FFOC 4ZU5A 4QXKA 1V00A 1VAMA 1PHMA 2HWE2 4H55A 1ULDA 4IEOA 2DU0A 3WCSA 2Q30A 3HAGA 3BPZA 1BXHA 1V9U3 3BCWA 3A0NA 3G7DA 3M3CA 3MGUA 4HSLA 4IV3A 4LBQA 4Y1XA 2ZGNA 4ISRA 2ZGSA 2K9ZA 1POV3 2W08A 1XYNA 1OLQA 1FX5A 5JMCA 4MYEA 4BHPA 2JE7A 1X8EA 3ZN4A 4PBOA 5JPMB 2ERFA 2GNTA 4ZXKA 4AEKA 2JICA 2Q0AA 1JN2P 3I8TA 2V5YA 5CG9A 4YZ4A 1R093 4HVRA 4COUA 1NA1B 3LOIA 1VBC1 5KXBA 3MIEA 4XYXA 4AVCA 4JTNA 1QJX3 5DUWA 4YFWA 3USUA 1REEA 4LT5A 1G9FA 5HCAA 1Z7S3 2PAMA 2B7YA 4JDOA 3TN91 4EN9B 3ZMOA 2WFF2 3WQ1A 1OFNA 3WG1A 2R072 3ATGA 3IDBB 4XW3A 4Q0SA 3BIWE 4BLJA 4LULA 2BPA2 4CRQA 4CDQC 4PLMA 2P17A 3LZZA 1IOAA 5I0TA 3JZVA 3R4DB 1O3QA 2P34A 1AR83 2CWSA 2TBVA 4Q4V1 1QH6A 1G7YA 1UMZA 1ZBA3 1EYBA 1E57A 3ZFFB 3ZDSA 2R041 1RUJ3 1WLDA 1OOPB 4W6WA 1MACA 3ES4A 5I8YA 4FTEA 1CVNA 1I5ZA 1QQP3 3AMNA 3DL3A 1PGW1 1HDKA 2VQ0A 3H0OA 2VH9A 4EWDA 1LOBA 1FNZA 1A8MA 1NY71 1J1LA 3DV8A 4XPVA 2H6BA 4Q1RA 4XXPA 4I0WB 4COVA 4XZPA 1RUF1 5FOBB 4OHVA 3ASIA 2DWRA 1HQWA 3K51A 5CU1A 4DPNA 2CY6A 1BBT3 2QDNA 3D0SA 1K5MB 2I74A 5HBAA 2PTMA 3JCIA 3ZPYA 2Q5TA 1H8VA 5DXDA 4Y5Z0 1PK6C 4YGDA 3ST7A 1OA3A 4GB31 4NHKA 4XFFA 1NA1C 2A7AA 2FHRA 3VZNA 1W39A 4ATFA 1BVVA 2WNUB 1HRV2 5JR7B 3JD72 5L7OB 4Y22B 1WW7A 2XPJA 3CF6E 2ZKLA 1NXMA 4DY5A 3B00A 3IPVB 4COWA 4OULA 1ND2C 2P37A 1DQ0A 1AR61 1ZZ7A 5C4WA 1TMF2 5BY5A 2UYAA 1UL9A 1ASJ3 1V6OA 3KT7A 3N36A 2Z69A 2YXSA 1VRH2 1MS8A 2R30A 3WW1A 3O0WA 4M01A 3IT8A 4LNVA 1MEC2 2HWB2 1KDKA 4FPHA 5K0UB 3VBOC 2XG3A 4XF9A 3VBUC 2RR13 2UWCA 4D3WA 2ZX1A 3A0KA 1UCXA 2XJQA 1FPN2 2ZGTA 3MDPA 4XETA 4CP2A 4B8EA 2BNMA 3MIDA 5K7PA 2WNVC 2HWF2 3GBFA 4QM9A 1OOPA 4HETA 4FPCA 2RS32 1N1VA 3TWIA 2EF6A 4D7YA 1GYKA 4RR3B 1LENA 2D5FA 5AVPA 4FAGA 4AGVA 2OZ6A 1LU1A 1EAH2 2Z79A 4HFSA 2AGSA 4QPGC 1OD5A 4YLZA 4XFGA 1Q8PA 4Q4X1 1Y43B 1LOFC 1RGSA 5FAXA 3ZIWA 1C3HA 2UU8A 4LBOA 4EROA 1XU2A 4JGZA 3AP4A 4QD2A 4AFDA 3GZUC 1UX6A 4G4FA 5GZFA 4AHWA 5ACA3 3JQXA 4RQPC 3WQ0A 5K8SA 2X8KA 5JI7A 5JVVA 3OD4A 1HXS1 1QWRA 4XF0A 2IZWA 1PVXA 2CV6A 2GNDA 2KA3A 2WLQA 3H9AA 2WNUC 2ZHLA 5JWPA 4MX3A 3WINE 1W6OA 4H14A 4W6XA 3ZMNA 4RS5B 3ZSEA 1LGBA 1DQ1A 1FMD2 4UW5A 1V6NA 1GNHA 4B4PA 2WINB 5LRRA 3UKNA 3WDYA 3RJ2X 3ZSKA 2WL1A 3VBHB 4WVVA 5GJ6A 4GWNA 3V65A 4HSJA 1VALA 1YRZA 1AYM3 3LA2A 5F5QA 4YNIA 4Q4Y3 1X33A 4L97A 2QVSB 5FOJB 1REDA 3GZTB 5GZEA 4QQOA 3USSA 4YVSA 1WLWA 1ZBE3 5BNNB 3MIHA 3M8LA 1TME3 3VHNA 1OI6A 2IXLA 2B46X 5A3LA 3AKRA 5K0UA 1AZDA 2HWE3 1AR92 1VBA2 2BTVC 2PFWA 3VBRC 4EN0A 4Q8KA 4COYA 4W6YA 3HQXA 4PBPA 5LK7B 2IC1A 4RR3C 5AC92 3TOJA 2W52A 1CAWB 2HYKA 1VBE1 1WW4A 4QMAA 3BB6A 4XJUA 3B7MA 4ES9A 1BVP1 1OPOA 1T6GC 1LGNA 1D4VB 3JU9A 4AQTA 1F31A 2B5HA 1VB2A 4E2SA 4HVQA 3AZZA 4CDWB 5J37A 2VPVA 1IS3A 4X6RB 3LOBA 2ZHKA 4RS5C 1WMFA 1PGSA 4IEYA 5GLZA 3E6CC 1X50A 3ZX7A 4AHYA 1RMU2 1NCRA 1J1TA 2JG9C 3FX3A 1ND3A 1QY4A 3VBHC 2WFF3 3EJKA 3H1WA 2WZR2 4FOQA 2N7GA 2R073 2ZBJA 1VJ2A 2GC1A 3VDDB 4LBLA 1WCSA 4XQDA 4ZU7A 3Q9OA 3FUQA 1JHNA 2HWD2 1MS0A 1QDOA 2WS93 3PHMA 4E4ZA 4XFIA 3T1MA 2EIGA 1ZZCA 3NKTA 3ZYRA 2WKKA 1C4RA 5FQ0A 2OIIA 4EJRA 2QNKA 1AJOA 3MPPG 4AI1A 4OLLA 4CP1A 5BNNA 2DFBA 2TNFA 1RUNA 4UBHA 5J3UA 1ZM1A 3RSJA 4A7ZA 4HL0A 2A5ZA 3WG2A 3W59A 3VBFA 4WM8C 1VBC2 3EQEA 2ZGRA 3THTA 3J8F1 2B42B 2EXHA 3P3PA 1UIJA 4XDQA 4DB5A 4ATEA 1NQDA 3WHTA 4KWKA 1G9DA 3TN92 4GXLA 1PM7A 2XJRA 2D44A 3CJIC 4LO4B 4JC1A 1AL23 1Q43A 1LRHA 5I8TA 2OZJA 4Q4V2 2PHWA 1GNZA 4YW2A 2O8OA 3AX4A 5JZGA 2ET7A 2JG8C 1HRV3 2WJSA 1RINA 1ZRRA 3JD73 3WCRA 2RMU1 1D2QA 4KQ7A 4KU7A 5J09A 4IEUA 4LHKA 4D69A 4HK9A 4XFAA 4D94A 3N4MA 2JECA 1RTVA 3J9SA 1RIRA 5BNPC 4HPKB 1PGW2 3I54A 1AR73 4Q0UA 1OMIA 1VRH3 4TWTA 3T1LA 1MEC3 2UURA 1RHI1 1NY72 2HWB3 3VDDA 4YW3A 3ZYGA 2PLV3 1YJKA 1SBEA 2XJSA 1W6MB 5KHJA 1XYPA 3H50A 5CIRA 1RUF2 3HBZA 4M0NA 1QXRA 4KWJA 1PMIA 1SCSA 3VV1A 3VHRA 3KMHA 4OI1A 3IM0A 4FO9A 4YGBA 1C5HA 4MXWA 4GB32 1AJKA 2DVFA 3ZN6A 5KXDA 1SQ4A 2GNMA 1H0BA 1DHKB 2A6YA 2I2SA 2V09A 3IN9A 4IXLA 2JD4A 3V0BB 1H8TB 5KC6A 1MS4A 4GH4A 3ZSMA 2A6VA 4Q4W2 4E2QA 3GBWA 1AR62 1KQRA 1CN1A 1BQPA 5DG2A 4QPIB 2X53S 2VW2A 1XQNA 3AZYA 2XWBB 3QCWA 4FP3A 3PJQA 1B35C 1JXNA 3V56A 1FMD3 4XFHA 1JOJA 3WP3A 1FT9A 3BALA 1KFUL 5CVRA 3TAYA 1REFA 3KCCA 4N53B 1RUI2 4WM7B 3O5SA 1CJPA 2E7QA 2ZX0A 3NJZA 3AYAA 3AYDA 4OZXA 3B01A 2RS52 3MIFA 1NE6A 4V1PA 3FJSA 4GULA 1RJ8A 2JENA 3UKTA 3M7AA 5DUXA 3ZXDA 4Q4X2 4BE3A 1ZZBA 5FBZA 1DZTA 3FE5A 2ZZJA 3ZXJA 2RS11 4COZA 1QJY3 1CX4A 1W6MA 1N1YA 1VBA3 2ZPXA 5IK5A 3OD0A 3ZN5A 4HLTA 5AC93 5IK7A 4BMBA 1RUG1 5BNOC 1S1AA 4GQ7A 3RZZA 3HT2A 2WT1A 4Q26A 2E53A 3H3ZA 3OY8A 1YIPA 3AMMA 3WDVA 4Y26A 4AVBA 1AF9A 3V0BA 1H8TA 3WLUA 5JAXA 2NLRA 5KHKA 4LBMA 3NV3A 2VOWA 5JIUA 3WZ1A 4XHXA 5FO7B 3NAPB 2HWC1 3PVBB 4QPIA 2G9GA 3B93A 3RG0A 2JDZA 1JUHA 1RMU3 3VZLA 1VBD1 3MFCA 1C1LA 3KQRA 1AXZA 3AXDA 3EBRA 5D8AA 5E89A 3LSEA 5TSWA 2VVFA 2B9UA 1CPNA 3B02A 4L2NA 4P5HA 2PHFA 3JB8A 1DQ4A 4FPYA 1LEDA 4N53A 1DLLA 1XNCA 3HD8B 4WM7A 1N1SA 1QNYA 4KGGA 1NLSA 1R081 3AB0A 4LR4A 1RUC1 5BV6A 3VHPA 1LOEA 2X5IB 3B94A 3H3UA 5I91A 3JB4C 1IKQA 1PIV1 5JOXA 1GANA 2NZ9A 2FMYA 4Q0PA 1SDWA 1VBC3 1LHVA 3HR9A 3E6DA 1C28A 3QLQA 4INDA 3LKJA 2WSVA 1SMVA 4Q0QA 1BBT2 2ZGKA 4SLIA 5CNAA 3TN93 2VY0A 4AEDC 4MSVA 1NLRA 4MGIE 5ABJB 1GQGA 1YHFA 4HT1T 3LCPA 4Q4V3 3ROUA 2DCJA 4M3CE 4F3JA 2Y0OA 1W6NB 1RVF1 2QFEA 2R043 3VZMA 3RQ0A 5L36A 3WW3A 2FZ2A 1XU1A 2CYFA 4NR1A 1S0IA 2GC0A 2R1BA 3AZVA 1ASJ2 1S0JA 2WA3A 4J6GA 4ORFA 4DRRA 2ZGMA 4PDWB 2Q4SA 2DVBA 3ILFA 1KFXL 1XRUA 4FPLA 3PLQA 4CEWA 5SV5A 2EAAA 4PJYA 1OHFA 4NO4A 5CFCB 5CBLA 2RM21 1Q8SA 1YYNA 2V73A 3J8F2 5FMOS 1RUF3 2RE9A 3ZFGC 3S6PA 3POYA 1HV0A 1SLBA 3I4IA 2R16A 4N43C 5IT6A 5GLVA 2ZKNA 4S2HA 4CDUC 3MW2A 1LR5A 2ZTNA 1I6XA 3FLPA 2X5IA 2EXKA 1FI2A 1DG6A 4GB33 5JOYA 4X6QB 4LE3A 4LLFA 1V70A 2A73B 4K20A 2Q1MA 2RMU2 2BW8A 2D3PA 1APNA 4YG3A 3I7DA 1V6LA 4XJWA 4Q27A 4QHBA 2XL9A 2ZS6B 3QH7A 1AR63 1IPJA 1Z78A 1YIFA 4AFCA 3PVNA 1GSLA 1XNKA 4P9JA 4Y4YA 2GNBA 3JBG1 4QGMA 1RHI2 4AQ6A 5T3NA 3POWA 4R4XA 1SLAA 1V6IA 2A3YA 1FV2A 4M00A 2WSUA 2ZHNA 2UWAA 4CDXC 3TNQA 3VBSB 1O4TA 4RA0A 3U07A 3E97A 4I02A 5EZWA 5A32B 1LHNA 5CAZA 4Q4Y2 5KXEA 4YM1A 3WX5A 5CFCC 1ZBE2 3OPZA 1CQ9A 1G8WA 4FXGB 1DGRA 1LOAA 4NOTA 1UIKA 4Q4X3 4X8NA 5T5JA 5FPXA 5GM0A 4P9IA 3VKOA 3U0ZA 5J7MA 1W6QB 1NYWA 1HXS3 4BOWA 2I45A 2IXKA 2A70A 1F8VA 1S2KA 2GALA 4QU2A 1QHDA 2YUEA 3A4UA 4C0BA 4G3YC 2A3WA 4LA3A 2YYOA 1O3TA 2A75A 2XBO3 4YVWC 1SBFA 3E5XA 1PK6B 2GAUA 1CR7A 4JCKA 1LHUA 2A71A 2PA7A 2ATFA 4I3PA 3KLSA 4GA9A 3LA7A 4UW6A 2VOKA 3AFKA 4WVMA 1UPIA 4R9DA 3PTYA 3P3NA 4JGYA 1YFWA 1ND2B 3VZJA 1BKZA 3VBSC 2XKPA 2RS12 1CIWA 3CNAA 5GALA 3WP6A 1Y7BA 1BEV1 4RGAA 3WW2A 2VQAA 3AZXA 4IQPA 2JXAA 4R9CA 1V6MA 2WS92 4CDQA 4LE4A 3VBOB 3VBUB 2GMEA 4P9YA 4LHNA 1VBE3 4YZ2A 2GSYA 4XQ4A 1DGLA 4HMZA 1GKBA 2WNVB 2FQPA 2ES3A 1ENXA 3WXPA 5FLJA 4WZFA 4I0AA 5F9TA 2UWBA 2OW4A 1C57A 4QPGB 2HEWF 4XFBA 4UW4A 4F7ZA 1WW5A 1BMV1 1WMEA 1VBD2 2ZX3A 4O9GA 4RQPB 1EV11 1OQ1A 4TZDA 1Z0HA 4NHLA 1AL22 4DS0A 2D5HA 1EY2A 2IXHA 2XH6A 3AM2A 3FFQA 1IS6A 3W9AA 3KM5A 2UYBA 3K48A 4LO5B 1COV1 4OHXA 3VZOA 2CGNA 1OA4A 3MI8A 3JUUA 1NA1A 2KM2A 4S2DA 4YM0A 2VNGA 2CAVA 2SBAA 3ZYIB 1RUC2 1DIWA 4F8AA 1O5LA 2JKBA 3OTFA 2ZACA 1NG0A 4FPJA 2BEOA 4B4QA 1AR72 5KHHA 2XUMA 1M06G 4LHLA 1MS3A 1ND2A 2DCYA 1YFXA 1WGPA 3ACLA 1ULEA 1H9WA 4Y20B 2PLV2 1UU5A 2X29A 1HX6A 2ZGOA 5C4WC 1OQEA 2BYVE 2E9QA 2XGXA 4N9HA 3J8F3 4FT8A 2WQ4A 1EPWA 3ZFFA 4GMP1 3VBUA 5H9PA 1KS4A 5JOWA 3VBRB 2ZX2A 1YFYA 2PHUA 3J26N 5DDJ1 4I30A 2D97A 3ZYPA 1CJDA 2H0VA 5H9QA 2QJVA 4FP2A 1DU3D 1QOOA 2RMU3 4QGNA 2VU9A 2UY8A 1ZZ6A 4IESA 2VUAA 2D3RA 4LO8A 1LOFA 3AYEA 5L19A 2EXIA 4AE2A 3MICA 2PQQA 4HVOA 1D0GA 1K5MA 2LUWA 4GWMA 5BPXA 1LCLA 1OKQA 4NWVA 4Q1PA 1RHI3 1W6PB 3MFAA 2RM22 1QNWA 3MYXA 2MEV1 2JG9B 4KNCA 4XJZA 2WNUA 2DUPA 2XBO1 1FOD1 4ASLA 5L7OA 4Y22A 2AENA 4OUMA 3RRDA 1YXWA 1U5XA 1CAXB 1PO21 3KT4A 1QOSA 3IPVA 3S7EA 2VW1A 4ZU4A 2O8QA 4A7KA 4FXKB 3TRSB 3N35A 4R4ZA 4XF4A 4FSJA 2E7TA 3RJRA 4NVPA 1QJY2 4M3CB 5HXVA 1EP0A 4PQ9A 4YFZA 4HZFA 2YY1A 4C90A 1SACA 2R0HA 2EA7A 4YVSC 3CEWA 4XJ8A 1SBDA 5SV8A 1DQ2A 4W65A 2B8MA 3ZSJA 1JTZX 4IV1C 4WM8B 4NPRA 1OQDA 3AMHA 3JBG2 3AP7A 4RR3A 4QQLA 2F4PA 1S0BA 1PZ7A 1LEMA 2D40A 5F6LB 1WLTA 1HW5A 4LA2A 3CJIB 1VBB1 1R1A1 1HLCA 4XQWA 1ONAA 3SHRA 3SLIA 3VHOA 5I8SA 4JDMA 2JG8B 4BMEA 4C0HA 1PZ8A 3N7KA 4QGLA 1RUD1 4QQ2A 2D6MA 5I93A 4YM3A 1Q8OA 4UBGA 2QKDA 4MGYE 4RS5A 5BNPB 3NWKA 2RS13 1F5FA 3IIAA 4GKXA 4BIFA 3E5QA 5HI0A 2BFUS 2CAUA 1NCRC 3GALA 2ARXA 1H2NA 3VBHA 2IXJA 3VKNA 4AK3A 3GHNA 3KD4A 1VP6A 1RUG3 1EPZA 3JQWA 5GZCA 1N47A 1WUVA 2B39A 4M3CF 3QACA 5J98B 5T54A 2XB6C 4Z1VA 2XLAA 2YV8A 2XVGA 3M3IA 2WC2A 4HBNA 5HCBA 3MPBA 1CAUB 3MW4A 4H3WA 5C8CC 3UL2A 2VVDA 4S2FA 2HWC3 5FRAA 4K40A 3GZAA 1CAWA 4E27A 3HIFA 5EFUA 4WM8A 3CO2A 1VBD3 3EO6A 3D8CA 1AYN1 3VBFC 4GIQA 2R49A 4XBQA 1SFNA 4CEYC 3MEPA 3RYRA 4AVTA 1W0OA 4I3GA 5I0UA 5A33B 1JH5A 2VECA 5LRSA 4HN0A 1YJLA 3CJIA 3O0XA 4DNYA 4CDWA 2R042 1B35B 3AKTA 2JJ6A 1WD4A 4K9SA 3LAGA 1U5IA 5CG8A 2WIIB 1RUH1 2AYHA 2NMOA 2NP0A 1R083 2DVGA 1RUC3 4XJ9A 2D6KA 2DUOA 5C6CA 2GH2A 5JZGC 1H30A 2Y38A 4FPOB 3SH3A 1C8M1 1MQTC 5IK4A 2A6XA 3O7OA 5BNPA 1PIV3 1IQAA 2GU9A 1S0EA 1UZYA 4C1XA 5FMOL 4Z8BA 4EWEA 2WWSA 3KGZA 2NYYA 2Z2SB 2OVUA 4YW4A 3X29B 4HKOA 1BMV2 3IDEA 5T52A 5GLWA 5LK5A 4R52A 5IUQA 2DCZA 1MS5A 1LULA 2D6OX 2ZMNA 3RI9A 2VXRA 4DZGA 5BNOB 4KU8A 4PIZA 3OYWB 2C5DA 3TYJA 4XTMA 3RDIA 3ZIXA 4YM2A 2IFRA 2OYZA 2Y0IA 3FUOA 1RVF3 3PMSA 1UZZA 3AJYA 2D6NA 3AKPA 2YGMA 1IS5A 3ZYJB 4L99A 3R6SA 2VW0A 3WG4A 4FAHA 3N7LA 3LB9A 1QXPA 4BA6A 2PHDA 2DTWA 4R9AA 1HIXA 3U4XA 1O4YA 2XJTA 1OA2A 2RM23 3ZO0B 2ZHMA 1B35A 2ET1A 2ZMLA 1PZ9A 2NM1A 3IBMA 4DXZA 4FOWA 5EJ3A 3QD6A 1W2UA 2XJPA 4SBVA 1WMDA 1GZWB 1DQ6A 4HPKA 3I59B 1PO11 4JAAA 1GZCA 2QUOA 2Z42A 1V6JA 2Y26A 3W58A 5CFDC 5J48A 3DPRB 5GZDA 3L9JT 4XF3A 2NMNA 1UN1A 1JUIA 1Y3TA 1HXS2 1BK1A 5GKAC 1RL3A 1I1EA 3QOPA 1D4M1 4E9KA 5T50A 2NQYA 4Q2FA 1XE8A 3U11A 3UV9A 2IWGB 3JBG3 2R32A 2O1QA 4XIKA 4BCUA 4MXVA 1NZCA 2ZGPA 1QJU1 2XBO2 5BNOA 5C9AB 1FOD2 4AEDB 3ZXAC 2P2KA 3WP4A 4MGKE 3RS6A 1PNFA 3LA3A 4TYSA 5FTTC 3BODA 2XLFA 5T5OA 1X8MA 1TQ5A 4N90A 4L9BA 2WZPP 1AX0A 1ZNPA 4K21A 4DOUA 4LUMA 1VB4A 1FATA 1ULFA 3ZXKA 1DZQA 3BTAA 1OLRA 2W68A 1AX2A 1DDLA 1ULCA 4EV0A 4E4DX 1VBE2 1KJRA 1RB8G 1QDCA 3I2DA 4OHYA 3DPRC 2GN3A 5AFEA 1POV0 2ZX4A 1DFQA 4XJAA 3PVOA 4Z82A 3ZFGB 3IDCB 2GC2A 4N43B 2Z5WA 4CDUB 1VBB2 1AX1A 3BOWA 4LEJA 5KBFA 2CWMA 5JSRA 2QZ2A 1AL0G 3KS7A 4L8QA 4P9GA 3AMQA 3WV6A 2FZ1A 5I0RA 2O0OA 2IXIA 2KXLA 1HV1A 5FO8B 1TMF1 5C9AC 3FLRA 2ZABA 1OPMA 2DVDA 4IEWA 3OF1A 3O12A 3RYPA 4XFCA 4YYOA 3TBDA 3GYDA 1FAYA 3C3VA 1SEFA 3WNXA 4YG0A 1BEV3 1U0AA 3NV4A 2MHFA 4S2GA 3B9IA 3WW4A 1YLLA 1CGPA 3E6BA 1FPN1 1WBLA 5C33A 4UW3A 2BBVA 1PGL1 4XILA 2HWF1 2Q8OA 1PVC1 3NAPA 2E6VA 4LLOA 5JLVA 4CDXB 1YWKA 4LBNA 2RS31 1CAVB 1DGWA 5LEJA 1C8NA 1CD3G 5FDBA 1C5IA 4DQAA 2TUNA 2EALA 1EAH1 4AI0A 2DUQA 1C1FA 4F83A 3ELNA 2R0FA 5CA6A 3NSTA 4P9XA 3ZVXA 3N7MA 2YROA 4YARA 3AP5A 1QKQA 3ECQA 4CEWC 1ZX5A 3ZFEB 5LEKA 1AUYA 1GFF2 2YPJA 1U5YA 1H1AA 2VNRA 3EHKA 1MZFA 3POSA 3FBMA 3AKQA 4HANA 2DYCA 1EV13 3GF6A 4RFT0 1XYOA 4L11A 5K9YA 2P3JA 3KB5A 3NV2A 4JRLA 4N43A 3NKGA 4CDUA 2VNOA 1COV3 2C9AA 4IV3B 1H4HA 1XXNA 4MH0E 4BYYA 2ZGQA 4YVWB 4A7YA 1A3KA 3ZXEA 4AI3A 3MW3A 1C8M2 2C0ZA 2BVVA 2GN7A 2VG9A 3DUIA 1OFSA 1YO8A 4RHV1 1S0FA 5GZGA 5ABJA 1G6NA 2HKXA 3M2MA 4EN6B 4J1WA 4FTSA 1AR91 2ARBA 2XVLA 3D0JA 1J58A 4Q8LA 2EXJA 1ENRA 1W6NA 3WDWA 1NCQC 1A78A 4GMP3 3TB0A 3USUB 4PF5A 2AUYA 3IKWA 3M3QA 1LKNA 4AXOA 2PHLA 4Y24A 2ZGLA 4CDXA 4AYUA 4PIYA 2HJIA 5DDJ3 2XKOA 5EV7A 1QOTA 5DZGA 4PDWA 4RL7A 3B9CA 4FPGA 4PLOA 4KBBA 1HQLA 2DF7A 5H9RA 1H2LA 4U36A 1QJZA 2P3KA 5CFCA 3ZFEC 3M70A 1J3QA 4AI8A 2PYTA 1GLHA 2GMPA 4FPFA 2DV9A 3SCHA 4YZ1A 3LGRA 2A6ZA 2D43A 4E4SA 3G6JB 4OUSA 1G86A 3ILNA 4Q0VA 3NV1A 1ZRFA 4IV3C 2MEV3 2WZR1 2XVKA 1FOD3 4IEZA 4HKWA 1PO23 3EXUA 4HKLA 2HWD1 2PAKA 4XEZA 3RMYA 1A8DA 4GKYA 4YVWA 2XJVA 1QH7A 3AMPA 1PO12 4C91A 1KS5A 4XIOA 4MLOA 3WT3A 2BFUL 3DKWA 1WD3A 1IGOA 4JGYC 3VBSA 3M1HA 5FLIA 2R063 2QQPA 1D4M2 3PJYA 5C4WB 1RUG2 5A32A 2ZA9A 2XHKA 5DZFA 4PCRA 3MIBA 3VL8A 5IK8A 1AXKA 2ZJCA 1J59A 3VZKA 4DRVA 1QJU2 2MPFA 3S30A 1IZ3A 1ALYA 4ITCA 4FPEA 1RUE1 3WDTA 5B2GB 5KWRA 1DF0A 1MVEA 1VBB3 1DYPA 1R1A3 2DVAA 4TLFA 3FZ3A 4OFGA 4YG6A 4BPZA 4J1XA 4ISQA 4CTEA 1W6QA 1YCIA 2HWC2 5JSPA