2I76A

Crystal structure of protein tm1727 from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
256
structure length
247
Chain Sequence
VLNFVGTGTLTRFFLECLKIGYILSRSIDRARNLAEVYGGKAATLEKHPEVVFVIVPDRYIKTVANHLNLGDAVLVHCSGFLSSEIFKKSGRASIHPNFSFLEKALEMKDQIVFGLEGDERGLPIVKKIAEEISGKYFVIPSEKKKAYHLAAVIASNFPVALAYLSKRIYTLLGLDEPELLIHTLMKGVADNIKKMRVECSLTGPVKRGDWQVVEEERREYEKIFGNTVLYDEIVKLLREVAESERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein TM1727 from Thermatoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 62
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10728 DUF2520 Domain of unknown function (DUF2520)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.20 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 ProC-like, C-terminal domain 2i76A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i76A01
2YV1A 4KDFA 1IZ0A 3FNHA 1SC6A 1XCBA 1ZK2A 4AJNA 2WM3A 3PTZA 3NTOA 4YAIA 3H3FA 3DMTC 3M1LA 3H3JA 5KVCA 3CPSA 1PGNA 4BNNA 3Q0EA 1X7HA 1KEWA 5T57A 2O7SA 3ZWOA 3NGXA 1U28A 2QZZA 1N5DA 3GVCA 3MJSA 1KC1A 1MG5A 4J4BA 1NTOA 3CMMA 1HZZA 1MP0A 1QSGA 1RM4A 4WLNA 2X0IA 1HLPA 4MKRA 4YCAA 1U5CA 5ER9A 4TZTA 1VI2A 2IXAA 1X13A 3ZNQA 3OECA 4U6SA 2HJSA 3JQ8B 5BR7A 5DOVA 3I4FA 2PWZA 1GD1O 1KIFA 1V0JA 5LDGA 2GN4A 5KJ6A 3TRIA 1U7TA 4C7JA 1VL8A 5KJFA 3QV1A 2DBVO 1EK5A 1ZZEA 4BIIA 1A7AA 3B6ZA 1BTOA 2QX7A 4AFNA 3GNQA 4OOFA 2O4CA 4EI2A 5A06A 1I24A 2JAPA 1Y8QA 4R16A 3OA2A 3EVNA 2OFPA 4DWVA 4P8RA 1A9ZA 2B37A 1E7RA 1EMDA 4GLLA 1C1DA 4L76A 4OOEA 1P33A 1WMAA 3RUEA 5F5LA 2OUIA 1PQWA 4ZD6A 3T7CA 2PGLA 1NX6A 1NPTO 4Y67A 1Q1NA 2O50A 2JD2A 2CVZA 3DFZA 4IJWA 3RASA 2OORA 3D3WA 2PR2A 4E13A 1DAOA 4NBVA 1KERA 4GSLA 3D7LA 4PVDA 3QA9A 4XJSA 4FJ2A 3DZHA 4OMUA 4YDRA 3U09A 4JN6B 4DQVA 4MKZA 1GTMA 2RH8A 3KETA 1OZAA 3GT0A 4LCEA 1LI4A 1PJ2A 2DBQA 1V6AA 1E7WA 2NLOA 3EC7A 1BG6A 1QORA 3HN7A 3H9EO 5JO9A 4TRNA 3VH3A 4R3NA 4E2WA 3VTZA 2UUPA 2Y99A 4BVAA 5JO0A 1ZIDA 3VPSA 3GK3A 5IXSA 2C20A 4TRRA 3ZV6A 5A3JA 4YA6A 2VZ8A 3WBFA 1YB5A 1UJMA 2JFHA 3PWZA 3S2IA 1ARZA 1ZH8A 3ANMA 1NP3A 3EDMA 1YO6A 5HM8A 2C2YA 3EVTA 3NAQA 1NR1A 1DXYA 2X5KO 3RBZA 3RVDA 1R4NA 5TJ9A 3V2UA 2F00A 3B1KA 4D44A 1P1JA 3V8BA 5JAIA 1E6UA 3AWDA 2AE1A 3ROPA 1ONNA 1Z7BA 1NXQA 3CUKA 3JQAA 1BXZA 3VZRA 4PG5A 4FC6A 4RDHA 1P1KA 3O03A 2X0RA 4E6PA 4E5KA 4BO6A 4A27A 2H1SA 1Z7EA 3ASUA 2VWHA 5L7YA 4CM9D 2AXQA 2RHRA 3AI1A 4CMIA 2NVBA 3U4DA 3WIEA 1ID1A 3LLVA 1BDBA 1XA0A 2CUKA 2D5AA 4FW8A 1I3NA 4U0KA 1ML3A 2O3QA 1U1IA 3E8XA 5T6BA 5TS3A 4BNIA 4Z9FA 1GYQA 3WICA 1O6ZA 1SCUA 3O9ZA 2VHXA 1XYGA 5IZ4A 3TFQA 4L9RA 2NACA 1C14A 1ZK4A 1UXJA 4IQ0A 4ND5A 3RC9A 3NDRA 3UFXA 4DA9A 3DBHB 4MJLA 2CSUA 4QT0A 4PLGA 2V6MA 3WYCA 4ZQFA 4J7UA 4NIMA 4ZQGA 4DIBA 1HDYA 3LK7A 4K6CA 4ZRNA 2NTJA 1OMOA 4PRLA 3EY4A 1LA2A 3GVXA 4FCCA 2O7QA 2Y1FA 1BRMA 4YQYA 1J5PA 3GY0A 3INGA 4FIZA 4E4YA 4FC7A 4DRYA 3FPLA 2IZ1A 3GGGA 2H9IA 4I08A 3WWYA 3UAGA 3GN1A 3LYLA 3G1TA 3ITKA 1V3TA 1PS8A 1DFIA 1RM3A 3QVOA 3ZN2A 4XA8A 1DEHA 1U3UA 4CLRB 5KJ1A 3A28A 4D0RA 2FZEA 2GZ1A 5DOZA 3JQ8A 4R9RA 1UDAA 2O3JA 1ZK3A 2WWRA 5TT1A 2WD8A 1NPDA 4CQMB 3BMOB 4CV2A 1XLTA 2LDBA 3QVSA 4RDIA 1MC4A 2NVUB 2VT3A 4BMSA 4IDDA 4UULA 3LQFA 2GDZA 4NK4A 3D3EA 2GZ3A 4CMKA 4NZ9A 5KCZA 3H5RA 1KEPA 1WDKA 4DIFA 1I5RA 1E7QA 1YE3A 2B5WA 1YGYA 4DYVA 4YJHA 2R2GA 2XOXA 3AI2A 2Y1EA 4XKJA 5T67A 3NGLA 3DL2A 5A04A 4D3FA 3CTMA 3VZPA 4BGVA 3AI3A 2QIOA 1PR9A 3WJAA 2Q1TA 5FYDA 2D2IA 4HADA 1VRWA 4BO0A 3HNPA 3AK4A 4IDFA 2BFAA 2NU8A 1SO8A 2P5UA 2Y0EA 1LDGA 4J16A 5COBA 2F1KA 2O3UA 5I9LA 1OBFO 1WDLA 4J0FA 1EFKA 4J91A 3W6ZA 5C5IA 4DLAA 4KUHA 4I8XA 4XGKA 3FBTA 5DP2A 1E5QA 3I9OA 5KJEA 1E5LA 2RBEA 4ZICA 1MXHA 1C0LA 2G76A 5DT9A 1PGPA 5IN4A 2D8AA 3V1UA 4RVUA 4BV9A 2TMDA 4MIOA 1LX6A 4FS3A 2VRCA 3Q9UA 2BI8A 2IE0A 3AUTA 3W1VA 2GD1O 1GV1A 1ZSVA 2UAGA 1DC3A 1Q7GA 1XIVA 3KXDA 3OSUA 5IDYA 1DAPA 3KYCB 1PJ3A 1KVSA 2J3KA 1GUFA 2GNAA 2VTDA 4FOSA 2PZMA 4WLFA 1I3LA 4D46A 3WTBA 5C7OO 4A73A 1JVSA 3D4PA 5JMPA 2TMGA 3MJEA 1XHLA 3AFMA 5CG1A 1ZO8A 4J1TA 3TPCA 4D0SA 4BKOA 1DDOA 4L74A 3DAGA 4ND4A 3COSA 4LISA 3HSKA 1P1RA 3ZHXA 4RVHA 4E12A 4IBOA 3RCBA 5A9SB 2YQ5A 5THQA 4E21A 3PHHA 4CMEC 1YDEA 1Z45A 3ANLA 3QP9A 2BKAA 5TRTA 3WWZA 3OQ1A 1LDNA 2EKLA 4UVDA 1HDGO 1VE9A 4CMCA 4DVJA 2QRJA 2DVMA 3GR6A 1N7GA 5JMWA 4FFMA 1LRKA 3E5MA 4IUYA 4PLZA 2E48A 1N8KA 3CIFA 2CDCA 1NAIA 4CV1A 4P4GA 1FDUA 2G0TA 4IS3A 4WCDA 1F06A 3A06A 1GPDG 2R00C 3HDHA 1T1RA 3VVCA 2JCXA 4AJKA 5G0WA 2X5JO 1EBUA 2YYYA 3P7MA 3F4BA 4R5HA 1UP6A 5B12A 1JDJA 3GNTA 4FFPA 1EVIA 1G0OA 3IAHA 3PQEA 4QO8A 1ADFA 4TROA 4AJIA 5F3RA 3QHAA 4MKXA 3ZZNA 2J3IA 2ZB3A 2X0JA 3GOHA 1LUAA 4EYEA 2WDZA 4K6FA 2X22A 4YJGB 2EGHA 4AICA 1GY8A 1HZJA 3EAGA 2ZYGA 1S6YA 1NVGA 2V6FA 1IL0A 3DBHA 1K5HA 1PZGA 4EUHA 2DPHA 1LDEA 5KWEA 1XGKA 3DONA 2YZ7A 3MJVA 4JROA 2I66A 5JCJA 4WLVA 1W4ZA 3WFJA 2FPIA 5IDXA 1B14A 3JD0A 4D79A 4DMLA 5CEFA 5AXCA 4ALIA 5BSEA 4RVSA 1SPXA 5MGBA 3OJEA 2Y1OA 4YAJA 1ZMOA 3BZUA 3WDSA 3GDGA 3GVPA 1R4MB 4X54A 3WGZA 4BO9A 5JW6A 4W4TA 4BKRA 1U5AA 4B3HA 5HBRA 3GMDA 1BVUA 4UUOA 3ROQA 1RKXA 3PFWO 4OQYA 4BNLA 3KUXA 1DB3A 1LLCA 2AQKA 4CL3A 3KZVA 7ADHA 4YB8A 1C0PA 5CEEA 3S2GA 3RFVA 1NR7A 4WK6A 1GCOA 3FWNA 4PZCA 1YJQA 1YXMA 4WOJA 3EZYA 4CQMA 5C7LO 3BMOA 4MINA 3JD1A 1PGJA 1C0IA 1LBEA 3JCZA 2C54A 4PLYA 4XQGA 2HK8A 1QRRA 3GUYA 1HYGA 3MWEB 4GBJA 4K9DA 4QECA 1F0YA 4BNVA 3MJCA 2Y68A 4BNFA 4NFHA 2VWQA 5A5FA 4DBZA 2PGDA 3AY6A 1GUYA 1H6CA 2P5YA 4R1SA 4RF2A 2FR8A 4FD3A 1YL5A 3PDJA 4IIUA 3IJPA 4MVJG 3BIOA 4B8ZA 2E82A 2P4HX 4NJMB 4CMEA 3WQRA 2BMAA 3QLJA 3DHEA 3U0BA 4DC0A 4BGUA 1SB9A 4O59O 1YDWA 2BI7A 2C7VA 4JBHA 5CDYA 2NU6A 4GVLA 5CFZA 3AUSA 4BB5A 3RD5A 1T2DA 3WLEA 2P91A 3VH4A 2VN8A 1XR3A 2W2KB 3D4NA 4AJ4A 5COAA 1UDCA 3Q2KA 2C7GA 1DHTA 2VZ0A 3NKLA 3B1FA 3QE3A 1UZNA 4MIYA 1TXGA 4DIOA 1ZK0A 1F12A 1B3BA 2R00A 3KV3O 1TEHA 1VKNA 2C0CA 3ZV4A 3DEYX 3LZ6A 4J3FA 1QP8A 3KYCA 4L4SA 3OQBA 1ISJA 1PWXA 4M55A 2GPTA 4QFCA 3S2FA 5CDGA 4R69A 1NFRA 3TZCA 1ISFA 4CR7A 5DBIA 1HTBA 2DM6A 2FN7A 1KEUA 2VWGA 3I9MA 5EQDA 1NVTA 5KTKA 5COQA 3DAPA 1PJSA 3JQEA 4PCVA 1MV8A 1IB6A 5A9SA 5IG2A 4CMAA 3QRWA 4WKGA 3W8EA 4DL9A 3KHUA 1PWZA 5I7EA 6ADHA 4Q3BA 4B3JA 2AHRA 5IF3A 3RUIA 1PX0A 3BXXA 3LT0A 3UCFA 3QWIA 4PVCA 5ILOA 4EJ0A 5KVSA 1EE9A 1KY4A 3WJ7A 2JCYA 2X8LA 4J2OA 4XEHA 3ICPA 3ZW8A 4DLBA 4PLWA 3PRJA 1P74A 2NV6A 3HDYA 3Q11A 4BNXA 1MB4A 5JDCC 1WLYA 2B35A 3GRPA 2E4AA 1CF2O 3F1KA 2AQHA 3PLNA 5DBGA 1XU9A 4OIMA 4DYDA 2ILTA 2PKQP 3ITDA 4ZN6A 4DC1A 3H6KA 3DZKA 4CV0A 2PZKA 3JD3A 2EKQA 1ENOA 2X9VA 1E6WA 4AVYA 1YS4A 3HB5X 3QQPA 2YFQA 1YH3A 1JKJA 1O5IA 3PYXA 4OM8A 2OXIA 2OMEA 4YJGA 2EERA 4GMFA 1RWBA 5C3MA 4RO0A 2SCUA 1B8UA 3PYMA 1TA4A 3ZHBA 3H8VA 3OHSX 1LSSA 4KDEA 1GYPA 2C59A 1ZCJA 3DOCA 3MJ4A 4RPHA 3P19A 4UUMA 4XGNA 1QMGA 3K31A 1PS0A 3QJ5A 4W6ZA 5L4SA 4B7CA 3ADPA 3PEFA 4YBZA 3JQBC 2CF5A 2X9GA 1VJ1A 5CPBA 2OBNA 2V6GA 4INAA 3KEOA 4WOKA 3RUHA 4I9NA 1KETA 2EIHA 4R4JA 4L4XA 3VC7A 3VZQA 4OSPA 1K6XA 1Y81A 4CUKA 3L4BC 3OQ6A 5FFFA 5LC1A 3FTPA 4NBRA 1DRVA 1R4MA 1DC6A 2DTDA 2C82A 2IODA 4H7PA 2FZWA 4TWRA 2J3JA 3ENNA 2OL4A 4UEOA 2ET6A 4ZQEA 3G1UA 1IHYA 4I5FA 5CDUA 3H2ZA 3KO8A 1SB8A 4HP8A 4MO2A 1XQ6A 1YB1A 2VUSA 4W7IA 4RL6A 4WECA 4AJEA 5CDTA 3ZHYA 1YWGO 1CWUA 1DBVO 4HNGA 1ZXBA 1XG5A 2FHSA 3HADA 3JQCA 1JN0A 4ZA2A 3U5TA 4F6LA 3ROMA 4BKUA 3PJFA 2ZK7A 4IM7A 4UEJA 1N2SA 1NQOA 2ZCUA 1F8GA 4XIJA 3WMWA 1NQ5A 2HJRA 4FJ0A 3RJ9A 4RPKA 1QYXA 3OJFA 3GEMA 3RJ5A 4DQUA 1DC5A 1D8AA 4BO5A 2VNAA 2E6UX 4JLWA 1R16A 3ORFA 4TZKA 1D4FA 2FSSA 4CMBA 3E9MA 2B4RO 3PYLA 3GC6A 1JKFA 3OM9A 4EDFA 1W73A 1OI7A 2JHFA 1TB4A 1MUUA 4NJMA 1GL3A 1QV7A 3UW3A 3I6QA 3JQGA 1WP4A 1DIHA 1E1MA 1U9JA 4XQ9A 2G82A 5H82A 4XIYA 5L51A 3TDKA 1DIAA 3OJLA 4NHEA 4RORA 1EVJA 4AJLA 2W98A 1UR5A 1CRWG 2XXBA 2W2KA 1I33A 1SNYA 4RQTA 5EJ2A 5HRUA 5JDCA 4F6CA 1WZIA 4NJOA 4IQGA 1TT7A 2FOIA 3G3EA 1WZEA 3MOIA 2B83A 1C3VA 3B1JA 3JTMA 1X15A 4PG4A 2IEDA 2NUAA 4GWGA 5EIOA 2RCYA 4FSHA 3IUSA 4XCVA 1E92A 4FN4A 3LLSA 4RVDA 5CP8A 2OZPA 1MG0A 2X23A 5AXBA 5I7SA 3QSGA 3ZV3A 1LDBA 4FPXA 1NWCA 2JCVA 1JAXA 5A05A 4J43A 3ZHZA 4TRJA 3F4LA 4MP3A 3SLKA 4IDEA 2ZTMA 1P1HA 3JQ9C 4ND2A 4YXFA 4ZHSA 1GQ2A 2EJWA 1HXHA 5DN9A 3VPFA 1FMCA 3JQBA 4IDBA 5HA5A 3DBRA 1YBAA 4YTEA 1GEEA 4BNKA 1E77A 1FF9A 3ULKA 1XKQA 3PP8A 1LLUA 4N18A 4JNKA 3RC7A 4O5OA 2Q3EA 3L4BA 1HE5A 3HE3A 3N58A 4J1QA 2Z95A 1NHGA 1EFLA 1N9GB 3Q1LA 4XJTA 5TC4A 1DSSG 2OBYA 3NUGA 1C1XA 1J0XO 2EP7A 1U3TA 4BO2A 1QYDA 1TI7A 3QVXA 3ZWPA 1DRWA 4TSKA 4K1LA 2PZLA 2WMDA 3C3XA 4YJHB 1B8VA 4BO8A 1J4AA 4JJIA 2CVQA 4MVJP 4JBIA 4J9UE 2DAPA 2HMUA 1K89A 1T4DA 1GU7A 2YDXA 3IOYA 3KBOA 4XYGA 5TX7A 1LQTA 1LNQA 3QY9A 3O8QB 3ON5A 3QW2A 3SBOA 3UICA 1O9BA 8LDHA 5KNLA 4IDCA 4RPGA 2A35A 4WNIA 2A94A 5L40A 4I5DA 2PK3A 1ADCA 2PFGA 3WTCA 5F1PA 5JNLA 4HKTA 2VHYA 1UZLA 2HMTA 2V7PA 3ETDA 3FPCA 4E2XA 3Q2IA 4LW8A 1H6AA 1UXKA 2DT5A 2D59A 4FR5A 1OAAA 3RU9A 3PZBA 4NPCA 3OICA 4Q3AA 3AW9A 4TKMA 1EZ4A 1ZVMA 4PLFA 1VSUA 3ETGA 3O38A 4IGFA 4QQRA 3T4XA 3HG7A 1ORRA 4A5OA 3U49A 1RPNA 1U8FO 3L6EA 1GYRA 2Y93A 3LU1A 2X86A 4BMVA 5JYEA 4L4RA 3H9GA 3JQ7A 2YQ4A 4NBTA 4ALMA 4YR9A 3JYPA 3OEWA 4B79A 3AUAA 3VZSA 2EP5A 1P1FA 3D0OA 1VKOA 3R6DA 3CXRA 3ST7A 4YT5A 5HS4A 5A03A 5JDIC 2RAFA 4S1VA 5B4VA 4NU6A 1XQ1A 2EW2A 2H63A 3UGKA 4ZRMA 4AJJA 1MC5A 4JBGA 2B0JA 3VHRA 3DDNA 3G17A 3ICCA 1BXGA 3KSZO 2EWMA 3I6IA 3L6DA 1E3IA 1NYTA 4MOWA 3VTFA 1K0UA 1TLTA 2VHVA 3I83A 3A9WA 3RIHA 3Q9NA 4OO3A 3I3OA 5FF9A 1GPJA 4OYRA 1R6DA 2IYPA 2VYNA 3FHLA 3G0OA 4BO7A 1D3AA 3MOGA 1LSOA 4P38A 3W4JA 4OAQA 4BNZA 5JC1A 5JSFA 2ZKLA 5TT0A 4R1UA 1F8FA 1Q2XA 3GVIA 3DZFA 2OO5A 3OIGA 5BNTA 3LSYA 1E1KA 4OXNA 3SX2A 1VJTA 1CJCA 1UP4A 3D4OA 3T7EA 2UUOA 4ND3A 4XR4A 1WXDA 4Z9YA 3DZJA 4KMSA 4JK3A 3AU8A 3HFGA 2PKRA 5L7TA 1UH5A 2EKPA 3CMCO 3JQ9A 3GA0A 3JQFC 4H16A 2HMVA 5ICMA 4BHTA 2AEJA 2O48X 1PJBA 1ENPA 3EGOA 3GEGA 3JQAD 4R68A 2GYYA 1E0DA 4UVIA 3K9QO 3BMNA 4OSOA 3PVZA 5EQFA 4J1NA 2HAEA 3M2PA 3SJ7A 3CKYA 3ZDFA 3RUAA 4ALNA 2EW8A 4E31A 4JJGA 1E7YA 3U4HA 2FSVA 5B4UA 1BSVA 2JL1A 1O89A 2HDHA 4DBVO 1U3VA 4S3MA 1IUKA 3PQFA 1B7GO 4CM3A 3X2FA 1Q0HA 4UVHA 2O3SA 5F21A 4PZDA 4WLEA 2C5AA 3A1NA 4CLOB 1L1FA 3L4SO 2GLXA 4RV9A 4MP8A 3WSWA 3ANNA 1LSUA 1GUZA 4L8VA 4IJUA 3PPIA 2BGLA 3AY3A 3C85A 3WGTA 3CINA 4CM8B 3NV9A 3L9WA 4NFYA 1HLDA 2I6TA 4JX8A 4BO4A 2FR0A 4Z0HO 4B8WA 4BNGA 1PJLA 2Y67A 5KOIA 2GZ2A 2HCTA 3AFNA 2GASA 4CLXA 3WFIA 3AU9A 1H6DA 2C2XA 4HFJA 4KQXA 4BV8A 1NQAO 5L3ZA 5DP1A 3JD4A 1QLHA 1EDOA 1DFGA 5EMHA 4O1MA 1K3TA 2D4AA 4J49A 1RM0A 4O63O 4BL5A 4B3IA 4OL9A 4LRSB 3TZ6A 4Y6RA 2JFGA 2VUUA 1M67A 4LK3A 3OIFA 2B36A 4CJXA 1XEAA 2A92A 1WNTA 4OQZA 4R1TA 1YL7A 1IE3A 1P0CA 4TKLA 1N9GA 5J23A 3BYZA 4E0BA 4N5LA 3GFBA 3PQDA 4HY3A 2C07A 3NJ8A 4MPDA 4PLCA 4EBFA 1SOVA 4XB1A 5H83A 1P31A 5JDIA 4NBWA 4E5MA 1T24A 1E3WB 3UKOA 2YV3A 4MVJF 2E49A 3N7UA 1VL6A 3O8QA 2X0NA 2GN9A 1PQUA 5C7IO 4BQPA 5L9AA 4GSKA 1M76A 1VLLA 3ZW9A 2OHXA 5JFOA 4CMHA 5F1OA 4CM4B 1H5QA 4E5NA 1FK8A 4MVJA 4FFNA 1ULUA 1KVUA 2G5CA 4YT8A 4JIGA 1UXIA 4BUCA 3HDJA 4BMNA 1PL8A 4KWIA 4OKIA 1YBVA 1R0KA 3H2SA 4F45A 4U5QA 3E5RA 3V1TC 4WASA 1NHWA 2VQ3A 2CD9A 5BSHA 4BB6A 5L4LA 3DMYA 4P4LA 1QR6A 1V35A 3JQFA 1P9LA 3KEQA 2WD7A 3BMQB 3H9JA 3NEPX 3K5PA 2GUGA 1A72A 2DU8A 2WEKA 3IS3A 3U4IA 4TRMA 3WYBA 3MJTA 4YYZA 4Z0TA 4YAEA 5JAQA 2V65A 2VRCD 3OJ0A 3AM3A 1KYQA 1WMBA 2DBZA 1MFZA 2JD1A 2Q45A 3FI9A 4YJFA 2WYUA 3O4RA 4L75A 3VH1A 3WSVA 4PG8A 2ZQZA 2YW9A 5L45A 2NU9A 3PWSA 1R0SA 1K2WA 3WBBA 1FDSA 4YJDA 4JJFA 2YV2A 2WYWA 3NTQA 3H9QA 5T5QA 1KBZA 5U9CA 3EYWA 1EK6A 3B20A 4R9SA 1R66A 4E30A 3SVTA 4WEOA 3TZKA 4H15A 5DBFA 1AUPA 3M2TA 3UXYA 5A9TA 1M6WA 1MGOA 1PJCA 2VYVA 3DOJA 3A14A 5DZSA 3W4KA 2D5CA 4OXYA 5TQVA 1Y9AA 2X6TA 1FXSA 3MCVA 3HJAA 1SOWA 2VZ9A 3R3JA 4FOOA 4GPD1 3TZQA 4BO1A 1H93A 3DR3A 1PGOA 1GQYA 1Y1PA 1ZEJA 4Q3NA 1CQIA 1R12A 4HX5A 4G5HA 1PL7A 1R37A 4HBGA 4CQLB 1UP7A 1PZEA 1AE1A 4NFSA 2GO1A 3TF5A 1GZ6A 4IINA 3KM0A 3F5QA 5BNIA 3VPXA 3F9IA 1Y5MA 4IQ8A 4K26A 3IL2A 3DWFA 3KRTA 4N7RA 4QTZA 1IULA 3HQ4O 4TVOA 4ITUA 4KP7A 3VDRA 5CAEA 5GZ1A 4ESOA 4GMGA 5LCXA 2EJVA 3QVTA 2NSDA 3UF0A 3VKVA 3ZWYA 4CLOA 3H4VA 2V6BA 1TT5B 3VVBA 4CM6A 2EG9A 3GGPA 1V9LA 4GX2A 4PLPA 4W7HA 1BWSA 4LGVA 3UOGA 4RLHA 2DUUA 4A10A 3N74A 3RROA 4H3VA 4XYBA 2FR1A 2X4GA 5TLSA 4TMFA 4CM8A 3B70A 3GH3A 5A4DA 5K9ZA 2A9FA 2AW5A 4GAEA 3TJRA 1C0KA 5T64A 5EESA 1X1EA 3KTDA 4J7CA 3F3SA 5JCJD 1O94A 5ENVA 2VNSA 3FNEA 2NQ8A 3OF2A 3ZWCA 4IS2A 1UAGA 1EUDA 5JS6A 4GX1A 1X7DA 3WG9A 1ZW1A 3AM5A 1J49A 1M6HA 2PD4A 4LMRA 3ABIA 2P9GA 3TFOA 1LRLA 1WPQA 3G79A 3FF4A 5CHEA 4OGWA 4I9UA 1GV0A 4B4OA 1XSEA 4ALKA 4LVCA 4QSMA 1CERA 3SLGA 1IY8A 2CFCA 3K96A 4WUVA 2HU2A 4XQCA 3D64A 2ZYAA 4IIVA 3GFGA 5H81A 3MZ0A 3IKVA 4ZGWA 3FTNA 3GPIA 4CQMD 2PH5A 1E3WA 2ZB8A 4LSMA 1D7OA 2FP4A 5ITVA 1W8DA 5JYDA 1HE2A 4GH5A 2Q99A 4FDAA 1DFHA 1G6KA 1X7GA 3NYWA 1GADO 4IMRA 5KKAA 1KC3A 4IDAA 1SBYA 3JQGB 3H5AA 3DTTA 1Y8RB 3ZWWA 1N92A 4QX6A 1DPGA 1HF3A 1HEUA 1FDWA 4CM4A 5BT9A 3LT4A 3DFUA 3H65A 1CQJA 3KSUA 2PY6A 4KZPA 3LVFO 3LC1O 5AXDA 4LRTB 1E6EA 1SZJG 2YUTA 5ILGA 4WEQA 3X2EA 3ONFA 3C1AA 1DC4A 1T2AA 4BKQA 1KEVA 6LDHA 2VOEA 4IZIA 4RLSA 4KTTE 1F14A 3BHIA 4U6QA 1T4BA 1J6UA 3GAZA 3BMQA 2J5KA 5GZ3A 2HO5A 4E5YA 4CPDA 4WLOA 1H2BA 4MVJI 3ZWMA 1YKFA 4WNCA 5GY7A 4ZVVA 4LMPA 2ZJ1A 4UVEA 1U4OA 3BMCB 4ZQBA 3OP4A 3RKRA 1ADGA 4BNUA 1E7MA 2Z1MA 5A9RA 1BGVA 2W2LD 2O4UX 4CL8A 1I36A 4G2NA 3IQDB 3WGOA 1KVTA 2PA3A 3GEDA 1SEPA 4UEKA 3INTA 1LC0A 4FFOA 5A3VA 1JU9A 4E2ZA 4EITA 4LCJA 1YQDA 5I7FA 5HWSA 3Q3CA 4DQXA 4YRDA 3DBRB 4OHUA 4R1NA 3M1AA 3V2GA 4IZHA 2R6JA 5DCWA 1G1AA 4WCFB 5EPOA 1L7EA 1YB4A 3GMSA 3SC4A 1NAHA 5JBIA 1C1XB 3INRA 3I9JA 2ZATA 2ZYDA 2DC1A 4R01A 3OMLA 4UREA 2WE8A 3UN1A 3DTYA 2JFFA 4MIEA 1DOHA 5AXAA 4CQLA 5ER6A 4B4VA 1MLDA 5JPIA 3CZMA 2PGJA 4NNJA 4Q3EA 1H2HA 1Y7TA 1GDHA 3EK2A 3FN4A 3RAJA 3RBXA 2ZB7A 1DIRA 2UV8A 2WJPA 1A4UA 4IJVA 2AQ8A 4GI2A 1PTJA 2NU7A 5EL0A 3O26A 2BHLA 3ZU5A 3EZLA 4Z3KA 1E7SA 4BKPA 3TL3A 4A03A 1XDWA 4WPGA 2XF8A 5G2OA 1TT5A 2JKVA 3OFSA 3TQHA 4OKNA 2J3HA 3FRJA 2AA3A 3UHAA 4J9VA 4XD2A 1HDXA 3MWDB 1IYZA 2VT2A 3MTGA 3VDQA 3JSAA 4B7UA 4CUZA 1PZHA 4WCFC 4RGBA 3RU7A 1OC4A 1ZUD1 3EUWA 3OBBA 3JQ7B 4GVXA 3PZRA 5B1YA 5JY1A 4E2YA 9LDBA 2Z5LA 1DO8A 2PD3A 2I5PO 2Q1SA 1NASA 4E3ZA 3V5NA 3C7AA 3H7AA 4M8SA 1QYWA 2IRWA 3GVHA 3S55A 1IPFA 4EJMA 4PLHA 2GF2A 1PJQA 1F17A 3RUDA 4NBUA 4RF4A 1BXGB 3TN7A 4MVJM 4O6VA 4FQ8A 4QFDA 2P4QA 4MP6A 5KVVA 1JLLA 3ZNOA 5TSDA 3WB9A 3GRKA 3K30A 1HYEA 4Y6SA 3DXFA 3WXBA 2LDXA 1LTHR 4FGSA 1N1EA 4DLLA 4PFJA 2HMSA 5ICSA 3WLFA 3WGGA 4D43A 4NR0A 1HDRA 1U3WA 1RYDA 4XDYA 4CM7A 2CZCA 4QUKA 5IZCC 4FB5A 3W6UA 2P9EA 1A4IA 3HDQA 3JD2A 4WE3A 3BTUA 1BMDA 3WQSB 3ONEA 4DXHA 2RHCA 3V2HA 4AJ1A 1R15A 3WNQA 1Q7BA 1Y8RA 1ONOA 3JYLA 4HWKA 3R3SA 4ZQHA 3I4CA 3BMNB 2J6IA 2ZCVA 3A4VA 4XRRA 2W4QA 2BELA 5THKA 4M49A 3ZI0A 2Y1GA 3GHHA 4A0SA 2XPCA 3SEFA 1B8PA 4OXKA 3WR5A 3UCXA 5IJZA 1YL6A 3GPDG 1DJQA 4WLUA 1Y9EA 4JCOA 3HWRA 2RIRA 2HLPA 2YDYA 2D3TA 3F1LA 1YVEI 4ONEA 4PN3A 1DIBA 2DUWA 4E5PA 1GAEO 1HL3A 1ZKMA 1GQQA 1ZJZA 2BGMA 3CE6A 4N5NA 3BMCA 1X14A 1HE3A 2HSDA 4CM1A 4HV4A 4XR9A 1Q0LA 3LF1A 1AN9A 3LF2A 1FJHA 4QXMA 1BW9B 3KYDA 4RPJA 4KOAA 2Q46A 2CDBA 1ENYA 5I9MA 5FWNA 1HWYA 4NQZA 3E48A 3FD8A 3WGIA 1VC2A 3DHYA 1ADBA 4G65A 2BFMA 3I1JA 1LDYA 4FJ1A 4OJNA 1JTVA 1OFGA 5FI5A 2PZJA 2QYSA 3TOZA 5AOVA 3PI7A 5DDIP 3WX0A 4GGOA 5TIIA 4Z6KA 4WCFA 2YY7A 1H9AA 4PIVA 2HQ1A 4JQCA 5I7VA 3GQVA 1ISMA 1A9YA 4C7KA 3ENKA 4AL4A 1I10A 1YQGA 4II2A 2JD0A 3NT4A 1JA9A 4NH4A 5DNAA 1HSOA 4Z3DA 1RJWA 4J6FA 4W82A 7MDHA 4AJPA 3IKTA 2Y1DA 4EEZA 3WNVA 4BNJA 3PHGA 3WS7A 4B4WA 1O8CA 2B5VA 3NDJA 3NTRA 2QHXA 1NM5A 4DPMA 3I5MA 1Q0QA 3LT2A 4D41A 1LXCA 3I9KA 4I5EA 1ZSNA 3ETEA 5I9NA 1SEVA 4GWKA 5A1TA 4Q9NA 3CZRA 4PLTA 4N5MA 5F1KA 3DBLB 1QLJA 4PGFA 4BS9A 1T26A 4GQAA 1AGNA 2VHWA 5IZCA 1VJ0A 4D42A 1B15A 4ROSA 4LN1A 4ALJA 4B4UA 1LQUA 1PZFA 4EEXA 2H5LA 5CDSA 1EVZA 4B7XA 4Z9XA 3DZBA 4CODB 4NU5A 2I65A 1I3KA 2WD7B 3C8MA 4Y9DA 1V3VA 1LLDA 4UAGA 1T2CA 3QVWA 3WYEA 1QG6A 5JAZA 2BGKA 1QXSA 4BNTA 3PWKA 1V3UA 1GZ3A 5DCYA 4R54A 5JC8A 1E1LA 3JV7A 3TSCA 3WIDA 4F3YA 4YWJA 4L0QA 5K6AC 1DLIA 1A71A 1Z75A 2HRZA 1X1TA 4YJFB 3PGXA 5IAAA 2VWPA 4IGEA 1CIVA 3FNFA 5I8ZA 1ZSYA 1IZ9A 3P2YA 1E3EA 2NTVA 4AJHA 2FPPA 1ULSA 4UUPA 2HK9A 3CSDA 2PNFA 1UXHA 4UVGA 3KYBA 3OA0A 1PS9A 1DJNA 4BOYA 3I9LA 2O23A 5BQFA 3GN2A 1WAMA 3GNSA 3DHNA 2VYND 4RF3A 1U2GA 2NVWA 4CV3A 3QWHA 1LEHA 4EZBA 1FDTA 2DKNA 4KUGA 3IUPA 3C7DB 2NNLD 2RH4A 4R51A 4PLVA 3DMTA 2FMUA 1AXGA 2ZTVA 3DQPA 4CM9A 3L77A 4U8GA 3IJRA 1HKUA 2WTBA 5IN5A 1LJ8A 3MEQA 5L53A 3HN2A 3LDHA 4J2HA 4JXKA 1YBMA 2BFOA 3I52A 3QWBA 3RC1A 4BNWA 4YPOA 1I2CA 3GG2A 1JKIA 4CMGA 1W6UA 2Y1CA 3OIDA 3ROKA 4GX0A 3WGHA 5TGDA 3IMFA 1U2DA 1P1IA 3KLMX 3PHLA 2HUNA 2PD6A 2PLAA 4D3DA 3E03A 4YRBA 3PDUA 3ZNPA 5K0ZA 3PHJA 3ADOA 3T4EA 1NPYA 2EXXA 1BW9A 1SAYA 3L6OO 2QQ5A 4LVUA 5KVQA 5I8WA 3AY7A 2CY0A 2QG4A 3NT5A 2Q2QA 2B4QA 1GFSA 1HSZA 3L0DA 4RVGA 5AYVA 3OETA 4QEDA 3UCEA 1NWHA 1DRUA 2DLDA 1PSDA 3QWAA 4JP3A 4KQWA 4BNYA 4RVFA 3NJ4A 5EN4A 4ILKA 1EEHA 4YRAA 1VPDA 2NM0A 1UXGA 2G1UA 1H6BA 4II3A 5U1PA 4R5MA 3UH1A 3F5SA 3RWBA 2I76A 2CMDA 1ZFNA 3TL2A 2AEFA 2ZIZA 1A27A 1KVRA 2E37A 5KJCA 2O2SA 2YHIB 4KWHA 1LSJA 1PEDA 2YFHA 3JYOA 4ND1A 3GDFA 4CMJA 2ZTUA 1JWBB 2HRBA 3PXXA 3LT1A 3OJOA 4RZIA 1NFFA 4P4NA 1A7KA 5K6AA 4AJOA 1PL6A 2FWMX 1D1SA 4DPLA 1JVBA 4YAKA 5L7WA 5CG2A 5L4NA 2BRUA 2O3RA 3RUCA 2I3AA 4ZJUA 1ZK1A 1V8BA 3U62A 3JYNA 4RQUA 1XELA 3GF4A 4DPKA 4I5GA 3I23A 1WWKA 5LDHA 4DUPA 3DBLA 1EDZA 3GGOA 3RSHA 3ZV5A 3AOEC 1RM5A 4GX5A 2JJYA 1I3MA 3U4CA 4XWYA 3IP3A 3PGJA 4XX0A 2EGGA 3S8MA 3D1LA 1WW8A 1X0VA 1GEGA 1AHIA 2W90A 3TNLA 1OOEA 2ZQYA 1CYDA 2ZTLA 3ZU4A 1IHXA 4MVJD 2FPGA 3GAFA 1AXEA 3E82A 3CEAA 3DZIA 2I9PA 3R0IA 4XYEA 1DLJA 2BH9A 5G0VA 3BHMA 1E3JA 2DFDA 3LC2O 1PR3A 4JGBA 4Z0PA 4DGSA 2O2YA 4IXWA 1H9BA 2BF7A 3M6IA 2VHZA 1VSVA 5IDQA 1I8TA 1YJ8A 3S2EA 3D5TA 3DC2A 4HFMA 2A4KA 3E9NA 5ITWA 2EF1A 4D7AA 2GERA 3GZ4A 2CVOA 1OC2A 3GHYA 4M87A 3IC5A 9LDTA 5JE8A 1M66A 1HDCA 3AJRA 3IP1A 4J1SA 4LSWA 1QYCA 1UDBA 2I3GA 4XRGA 2QRKA 4CLDA 5MDHA 2WSBA 1PJTA 4NI5A 1Z6ZA 4P22A 2O3TA 3K6JA 4Y98A 4FFRA 5TJHA 2FY8A 4EJ6A 2C5EA 3ZCXA 1FDVA 1NNUA 1XU7A 3K73O 3NX4A 1SMKA 3BHJA 3LC7O 4G81A 1T25A 4I1IA 4WJZA 2C29D 3BTVA 2IEBA 4TQGA 4U7WA 3FBGA 2ZB4A 1PIWA 2AMFA 2FRDA 2GRAA 3AM4A 2VYVD 2J5RA 3H5NA 2J5QA 3WOHA 1EQUA 2XXJA 3BA1A 2Q49A 1LU9A 2W8ZA 1ZJYA 4R3WA 3P2OA 4C4OA 5TF4A 4XYLA 1RYEA 5KKCA 3HB4X 4AJ2A 1ZXLA 1I32A 3EW7A 3AUUA 3GDOA 1I01A 3BTOA 2HKIA 2P2SA 3RUFA 3ZU3A 2D1YA 4E32A 2VRBA 2X1HA 4GKVA 1M2WA 1PJ4A 4NMHA 3UVEA 4HNHA 4GLOA 3VAZA 3W8FA 4DREA 4GGPA 3RBVA 4Y8VA 5C37A 4EGFA 4XB2A 2VOJA 5FEUA 1A5ZA 4KUEA 2IZZA 2AE2A 2P9CA 1HDZA 3ZNNA 1ISIA 5IDWA 2UVDA 1IPEA 2Z1NA 3WMXA 1T2EA 2DFVA 2PKQO 1BDMA 3AOEA 4HFNA 2VCYA 3P5SA 1H94A 4YQZA 3GLQA 1EUZA 4XZ3A 2VTEA 1M75A 1Q7CA 3AOGA 1ZMTA 5BNFA 3K2EA 2G17A 1E1NA 3KVOA 1MX3A 2CNBA 2GR9A 3E6AA 4J0EA 2Q4EA 4F46A 3RKUA 4U0JA 2Q1UA 1K6JA 2YHIA 4FGWA 1MFPA 2Q50A 3NDIA 1I30A 1U8XX 1P3DA 1NFQA 1U7HA 2Q4BA 1GCUA 3GZNB 4CLEA 2QW8A 4NK5A 5G4KB 3STHA 3D5QA 5GZ6A 1Y5RA 4W9NC 3JYQA 1EBFA 2GN8A 4CR6A 4YT4A 1EUCA 3C1OA 4J90A 4CLRA 3PFFA 2PH3A 1QYVA 2I99A 2ZJ0A 3FWZA 1XWFA 4AG3A 1CDOA 5G4LA 1T2FA 4I9HA 2X9NA 1ENZA 5U4QA 4Y6PA 1YOVB 3RQSA 2AQIA 4W99A 2NVUA 3NRCA 3ZU2A 1N1GA 1HT0A 2H6EA 3G49A 4M1QA 3VH2A 4FFLA 2J8ZA 4IY1A 1IOLA 1DHRA 2CF6A 4J4HA 4YACA 3ZH2A 1UZMA 2DTEA 3H9UA 3ONDA 3VPHA 2P68A 3C7CB 5EERA 3OEYA 3WQQA 1H0KA 1KS9A 1LRJA 1LLQA 2UDPA 1Y6JA 4MDHA 5CPFA 5G0SA 1Z73A 2YJZA 5F5NA 3ZWAA 3E1KA 4PG7A 1B3RA 3GUCA 3JQ6A 4BQRA 4D45A 1AHHA 1Z82A 1ISHA 2IYOA 3DAFA 4OH1A 4ALLA 4J4TA 3TOXA 2OP1A 3JQDA 3BAZA 4K28A 4M54A 3HUDA 1GZ4A 2Q1WA 3C24A 4KTVE 3FSRA 2Y05A 3L9XA 1PGQA 1WVGA 1EE2A 2POQX 2AEMA 2NADA 3PLRA 1ZBQA 1GR0A 5JAMA 3FNGA 1UAYA 1U4SA 3R1IA 3KYDB 1BVRA 5EINA 2X7HA 5JCXA 1R0LA 3PJEA 4BGIA 1UUFA 3DOOA 4HFRA 2I67A 1N7HA 2IZ0A 2OGUA 2X58A 1ONPA 3F6YA 3MTJA 4Q3CA 5DF1A 2W2LA 3RI3A 4A2CA 5G0TA 3K8ZA 1HE4A 4J7XA 3V1YA 3RFTA 2Q2WA 4MVJH 4PRKA 5GMOA 4HUJA 3ZGYA 4A7PA 4CUJA 2GSDA 3ZWVA 2Q2VA 4CM5A 2JAHA 4FBGA 2Y0CA 1PU2A 3EHEA 1O0SA 2DPGA 4IMPA 5L95A 3EMKA 5BSGA 4XQEA 4EUEA 2BD0A 1X0XA 5IFLA 3SC6A 4MVJE 1B2LA 4RZHA 2YHUA 4BO3A 1MXFA 1BHSA 5T8KC 3U9LA 2QYTA 1QKIA 5TNXA 2UYYA 1S7CA 3KB6A 1P0FA 5HTOA 3ASVA 1CETA 1B16A 1WDMA 2D0IA 3NT2A 2DTXA 4YVFA 1W0CA 4A26A 4YT2A 3PJGA 3RFXA 5AQ1A 3DB2A 2X5OA 3L07A 5A5EA 3QWFA 3S1LA 3C1TA 1JW9B 4W9NA 4PZEA 1E3LA 5DCUA 3W8DA 4TVBA 1Y8QB 1KY5A 2NWQA 4D3SA 2B4TO 2AG5A 2EEZA 4NDNE 4CLHA 3K92A 3TWOA 1EVYA 1I2BA 2VUTA 1C1DB 4R41A 2BFPA 3ZWBA 1I0ZA 2PTGA 3DO5A 1JWAB 4URFA 1PQPA 2XAAA 3PIIA 5IXYA 4ID9A 2DBRA 1HETA 3FR8A 5AVOA 4RPLA 3KSDO 2GCGA 4UUNA 5B4TA 3VKUA 2WYVA 1MA0A 5ES3A 1DIGA 2PV7A 1YQXA 2DQ4A 2QZ9A 3D3WB 2GN6A 3I9NA 3HHPA 4RJTA 3WGYA 2GGSA 3VPGA 3DBVO 4DTIA 4WGGA 4N54A 3WGQA 2IXBA 1LC3A 4XGIA 5B37A 5JLAA 4L73A 4IPTA 1G0NA 1I2ZA 4IDGA 1CEQA 1D1TA 4E33A 4BNMA 4NG5A 4BGEA 3IIEA 1P45A 2B69A 3GZNA 5KIAA 3FCOA 1NBOA 1YONA 5G4KA 1Z74A 3HFSA 2BLLA 4CR8A 3GG9A 3TZHA 4Q3DA 4IJKA 2Y0DA 1YRLA 8ADHA 3Q6IA 2OP0A 4M86A 4PG6A 3PIDA 1NVMB 2OOSA 1LDMA 1VL0A 1B26A 2AG8A 3IDSA 2CDAA 4YAGA 1YOVA 3FR7A 1T1SA 4Q39A 4BNHA 1HDOA 1HYHA 2Y66A 2HMWA 1TVEA 3RC2A 3HZZA 4DMMA 4RF5A 2EHDA 1ZNQO 3QIVA 5G0UA 1O95A 4EUFA 1P77A 1R4NB 3W4IA 5JY6A 1QV6A 3PK0A 1VM6A 5ENDA 4YEDA 5BSFA 3BTSA 4O0LA 3UUWA 3JQAB 1ISGA 3ZWXA 4EW6A 2IDZA 1E3SA 5ADHA 5JXWA 1NQTA 5HS6A 1EQ2A 4M89A 4JP2A 3F46A 3PHIA 3E18A 4HXYA 1KVQA 3KOUA 5A02A 5T8KA 1HRDA 3F47A 3U3XA 3CH6A 3OH8A 4QO7A 4GKBA 1P44A 3K2BA 4GL4A 4RCVA 4ZU3A 3VOSA 4CMIB 1B0AA 5CEJA 3DZGA 1L7DA 1JAYA 2NQTA 3KLPX 1K6IA 2HK7A 1KOLA 5DULA 4IXTA 1ZEMA 3E9QA 3SJUA 1JQBA 2QRLA 1BXKA 2JHGA 5FI3A 3ZWNA 2WE7A 4XDZA 4XYMA 3PJDA 2NTNA 2EV9A 3SXPA
chains in the Genus database with same CATH superfamily
4GOJA 2WT8A 3FTDA 2ADMA 1XCBA 3P0JA 4QU0A 5TE9A 3H3FA 3DMTC 3M1LA 2CD7A 1X7HA 3GDHA 2O7SA 5JEDA 1M1XB 2QTGA 1D9XA 2ZAGA 4CKCB 3CUSA 2QZZA 4EB8A 1N5DA 1J06A 2ZTHA 3FYDA 4JJ8A 1AZWA 3MJSA 3U0VA 2Q7XA 3R3WA 4K9SA 1UMCA 1MG5A 1YA8A 1QP0A 5IM4A 3HUUA 3W5HA 5DGXA 3E22B 2CLSA 1GT6A 1IQ0A 3QTTA 2WB4A 4JITA 3BN3A 4E1VA 5AKXA 4ZZ3A 3G88A 4M8NE 2FWAA 3TL6A 4N0MA 1WVIA 5LLDA 4YCAA 2YASA 4FEGA 4UHDA 5ALIA 3CLHA 2GK3A 2WHYA 3UY4A 2IXAA 3ZNQA 5JVDA 1JFRA 4NAUA 1CF9A 4YMGA 1KARA 2YJ4A 4NNOA 5DSZA 5LDGA 2GN4A 2EEPA 5FL3A 3E9YA 1MH1A 2XNJA 1VL8A 4P3KA 4JL6A 2WOJA 4AYWA 3H1FA 3QU5A 1XRMA 5F4BA 2WHXA 2L42A 2J3EA 3I04A 2GCOA 4WD3A 4M9RA 3HCRA 3NHAA 1UBKS 3E53A 4AFNA 3SYNA 3NM5A 4ZV9A 2YWDA 2O4CA 4DNXA 4B3RB 2JAPA 3MTDA 3EVNA 5D3MB 4R1MA 3ZPXA 4DWVA 1M10A 8GPBA 4OLHA 3TB4A 4TXNA 3EQ8A 1S3FA 5IAGA 4GLLA 1TVMA 2WYOA 4HLCA 1E1QA 1TKCA 2H2DA 5F35A 1DUIA 1QIIA 2ZIUB 1P3JA 5K0NA 3DB1A 2UZ3A 1PW7A 1YD7A 3L82B 3IKMB 4DSTA 5BT8A 3OD5A 1RLOA 3U4QB 1T8TA 1B0PA 1R0XA 2Q3FA 1NG9A 3AHFA 4EECA 3EZGA 3DFZA 4IJWA 1U0SY 4A8JA 3UMMA 4E13A 1DAOA 3F3YA 1GARA 3IPAA 4GSLA 4A6XA 3QVGB 1WUYA 4MKZA 1DO2A 3L84A 3QX7A 1HORA 3OZVA 4AKSA 4B84A 1M34B 4LCEA 3V9PA 4DM7A 1XE3A 2BMJA 2WJVA 2NLOA 13PKA 2H4HA 4NX2A 1QORA 3VJMA 1SKQA 2ODEA 4UNNA 1I2MA 1P5JA 1MV5A 2YH2A 2ENUA 2YYSA 1VYUA 3H9EO 3BGWA 1SCJA 3ROTA 3VH3A 1U11A 3R7NA 1HV8A 1JB9A 3LWBA 3VGJA 2A1TS 4Y2SA 2JCSA 2VKQA 4H3SA 2UUPA 1YK0A 3G7SA 4D4IA 1AJEA 2HZBA 1YRWA 2YWRA 4NOJA 4Q6BA 4EWLA 5JO0A 3C5WP 3QKRA 1VDMA 1NDQA 3OF5A 1S2NA 5BV7A 3EPRA 2M1ZA 3MGCA 2FMKA 4IZOA 1NX9A 4MMYB 3ZV6A 3D02A 5JFGA 5EIAA 1YB5A 3NKFA 3WBFA 1G98A 2ODWA 1DX4A 1ZH8A 3PWZA 3TI9A 3UEOA 4EW1A 2B3TA 1NP3A 2JG3A 4OFXA 1C3XA 4DCUA 5HM8A 3NAQA 1NR1A 1L1QA 5DBEX 4EA9A 5AM3A 3RBZA 2RHBA 4GI1A 5FBQB 3RVDA 2C3UA 1TQ2A 2Q5FA 4FVTA 2X3YA 4MWBA 3B1KA 1XEFA 3TX6A 5JAIA 3HVUA 2ECPA 1N2IA 1BEZA 5LA6F 5JRJA 1Z7BA 1KDZA 1NXQA 2X40A 4C0HA 1BXZA 4D9KA 5I4CA 4V02A 3NHKA 4FC6A 2AJLI 1W8IA 5CK5A 3U31A 1ND6A 2XWSA 5EZSA 1P1KA 1OLUB 1V8DA 9LDTA 2Z9CA 5J4YA 5JCOC 2Z8YA 1TUBA 1XRLA 4UUQA 1IEWA 2FW1A 3G2LA 4XUEA 1WEHA 2OCIA 4A27A 3C7KA 2ECKA 3NVDA 2HREA 3ASUA 3LCUA 3NHPA 2AXNA 1V25A 2XKBA 4CM9D 2HQRA 5JI3E 5B6IA 5HPYB 3LMKA 5FULA 1L4NA 2XIQA 3LLVA 1G3MA 1KZ9A 2RD2A 3MOSA 2D5AA 3QZUA 3E5NA 1I3NA 5JJ5A 4NCAA 1ML3A 4RJKA 1U1IA 5T6BA 4QBGB 1CUJA 4QULA 1O97D 5DYWA 4DRZA 2XD4A 1EFAA 3FETA 3CF4G 1Z6TA 4V24A 5FOQA 3PFGA 1CRQA 3WLNA 4J1TC 4EATA 1FW8A 2Q2OA 3U1BA 3I37X 1XYGA 3TFQA 4L9RA 2DHRA 1SY7A 1NBAA 2NACA 3Q6MA 1QPZA 1ZRMA 1ZK4A 1UXJA 2W2OA 1M73E 4LWQA 5KYVA 3MS4A 3RC9A 3S2UA 1OD6A 2F4NA 3AG6A 3UFXA 4DA9A 3GLHA 1QIKA 5ED0A 5F3DA 5EJEA 1W7AA 1PTKA 2CSUA 1QGDA 4PLGA 4MYCA 2AC2A 5DLYA 4NIMA 1GRVA 2IHUA 1WP9A 5CH5A 2V55B 4DIBA 1T3LA 1XZJA 4TTRA 5EP3A 5LQJA 1IMJA 3BJRA 1LA2A 3IAS1 3KJXA 5DGCA 1J5PA 5C32A 2WOOA 3GY0A 4FEAA 1F9EA 3VU9A 4E4YA 5JNVA 3GYGA 4FC7A 2Q6OA 1WPGA 5EJMA 1NXSA 3VR3D 1NVDA 2H9IA 2J32A 4C6TA 5LD2C 2YOGA 1F6DA 1GNTA 5E0KB 1R5BA 3HEAA 2IKQA 3Q3JB 1L4UA 4JZYA 4ZO4A 3UAGA 2UUAB 2PUTA 1PFQA 5LWHA 4WXMA 2GF0A 4FE4A 3P9KA 1PJAA 4OH7A 1D6NA 4RESA 5C51B 4XSGA 3ZHUA 3PFIA 3P2MA 3LUJA 4OQEA 3U48A 5EJ6A 2PMBA 4BNDA 1H4QA 3U9TA 2HRDA 1KE2A 2JGDB 2D2EA 2DSNA 2FF7A 2P2LA 1V95A 4PR0A 4Q4JA 4D0RA 1FRVA 1QGZA 2DF8A 3DQZA 1WCIB 4KR0A 1SUDA 4R9RA 5DOZA 2WWRA 1KZHA 1E1YA 1ODFA 3R24A 1XLTA 2V7TA 3QVSA 2A5GA 1MC4A 2NVUB 3ZIUA 3VHQA 4BIMA 4DOMA 1DQPA 2GDZA 1C7FA 4NK4A 1OWOA 3ML1A 4X8OA 2AOUB 2JEZA 2P3QA 2WF9A 4G24A 1LWOA 4R2IA 3TSZA 3UHPA 2Z57A 1UBMS 3OEEA 4TMWA 4UEQA 4DIFA 1EG2A 1O8BA 4JEMA 2EX1A 2XWBF 3PT5A 3JR3A 4LTNA 1YGYA 2RJOA 4KSCA 4DYVA 3MS2A 4FE7A 4MEBA 2R2GA 2WUDA 2Y1EA 4XKJA 3GLIA 3U16A 3EYAA 3PA8A 4D3FA 3HYTA 1YQTA 4OG2A 2WKQA 1ZGBA 2V6JA 1GRCA 2GM5A 1PZNA 3CTMA 1QV9A 3VZPA 4AY2A 1ZLXA 4GOLD 2QIOA 1PR9A 2WTEA 3WJAA 3PC8A 4HVLA 2D2IA 5BR8B 1FXWA 1SWVA 3MTEA 4HMPA 4IDFA 5DRTA 2NU8A 1TO6A 3IBYA 2EARA 3V9AA 2AF4C 1RFGE 1CHDA 2BSQA 3TLXA 2O3UA 5I9LA 2VZLA 1OBFO 1XRRA 5DSXA 3HLKA 1Z5OA 4S0ZA 4LGCA 5C5IA 3BRQA 3OZBA 3N2KB 3SZRA 3V8MA 1W4CA 4I8XA 4ZVQA 4BUJA 5F23A 3TW0A 3I9OA 3OZUA 5KJEA 4L2IB 1NKTA 4B6SA 3DR5A 2RBEA 3NBUA 1AKUA 1XAHA 3P9CA 1MXHA 2YJ6A 2G76A 3O4FA 3PFCA 3WKBA 5IN4A 4KLCA 4P84A 4P9NA 2TMDA 6GPBA 5D1NA 4ZOEA 1DE0A 2RGNA 4FS3A 2BI8A 2DQYA 4K46A 3AERA 1FVXA 4Q7JB 4B40A 2GD1O 1ZSVA 3RS7A 4EY7A 4OMDA 2XB4A 1Q7GA 4IUDS 1NY6A 1XIVA 3KXDA 3OSUA 4TM7A 1L7QA 3VHXA 4G1CA 1PJ3A 4NYJR 1JXAA 4IQ4A 2Z2KA 1DQRA 2LIPA 3KT8A 4PHHA 3PDIB 2VTDA 3AF4A 4X6UA 3PR3A 4UTRA 1RXUA 2PZMA 3PVCA 1NA5A 1G7CA 1HPLA 1JAHA 4IX1A 2SICE 2ETXA 3BCUA 5JZVA 1JVSA 3B1XA 4BXOB 2TMGA 1XHLA 3JW8A 1ZO8A 5D7NA 3TPCA 4F92B 4V0KA 4BKOA 4BVFA 3COSA 4LISA 3HSKA 3WBKA 4BATA 3ZHXA 1YOBA 4RQAA 2O2GA 1QZZA 3L18A 1U4NA 4NEHB 3R6TA 3UGQA 4P86A 4IBOA 1CNMA 3TQCA 1RAIA 5F52A 2MR6A 1YDEA 3ANLA 3CZ9A 2BKAA 3DD5A 2J3DA 2QD4A 3I5XA 3EPHA 2DFPA 2HRRA 2QUJA 4MW1A 2QRVA 3C3AA 2I03A 1DKPA 3DO6A 2QRJA 2DVMA 1G3QA 4MW6A 3Q3VA 1GFWA 2IDMA 2YJTD 4FWTA 4FFMA 1LRKA 1TIBA 1ZA2A 3LM8A 4US1R 3OU7A 3DV2A 1MQ9A 1XA4A 3SYRA 1OBOA 4YMUA 1BFDA 2QR5A 1OLSA 2CDCA 1NAIA 2XXAA 3KJEA 3LV8A 1FDUA 1KS2A 2G0TA 4PZPA 4QOJA 5BXYA 2FTKE 4Z7JA 2FE1A 2HRCA 2CNKA 3FCYA 1F06A 1JR3E 4NCBA 3PKIA 1KJIA 1T2NA 1N78A 5F98A 2FX3A 3VVCA 4BQIA 2Q5JA 3F4BA 4TYWA 1HG1A 1ZU5A 4QVKA 1CT9A 3AH8A 2ZZMA 2IC5A 2C92A 1JDJA 2HD4A 4DR4B 4L6CA 1Q12A 1PDOA 2BFDB 3GNTA 4FFPA 3ENWA 5CVJA 3C2QA 5FT9A 3OTOB 3NXSA 4AJIA 1FQOA 1YCHA 2R6GA 4Y1GA 4B7ZA 4I7EA 1T8YA 3NLLA 5DIZA 2B7BA 1XMQB 3QFFA 4GI3A 1JJ7A 3SQMA 1M3SA 5ITSA 2WDZA 3G8AA 1FPQA 2BDTA 4JLAA 2EGHA 3Q72A 1KYIA 2WLSA 4ODIA 1L7AA 4RMGA 2Z9BA 1S6YA 2N9UA 1IL0A 3L6RA 4KQMA 2G77B 2JGIA 4CN8A 2RHOA 1BGWA 1DT5A 1KOFA 4EUHA 1LDEA 1CUHA 1XGKA 1ZCBA 2YZ7A 3W5JA 5LUBA 1S4MA 1A9OA 1XZ8A 2JIZD 3IQIX 4LZZA 3WFJA 1W4ZA 2BJHA 4GRAA 4WLVA 4PXYA 5JCJA 1B14A 1OY1A 4D79A 7ABPA 3L0PA 5CEFA 3IUMA 1G6OA 2B1RA 3I04M 1SHTX 3I01A 2ZPUA 5FNZA 1H5UA 4RVSA 4WNAA 4G1MB 5KTSA 4UAJA 4JXJA 5AVTA 3L06A 4YAJA 1YVPA 1N2BA 3BRSA 1U7DA 2OMKA 5EY5B 1MAHA 3PUXA 2IUYA 2IX9A 3I2IA 4YREA 4DA6A 4EL5A 1NZFA 1UQTA 5JW6A 1J20A 4B3HA 1YT5A 4LX0A 5EHQA 3GMDA 1BVUA 1JVNA 1HGXA 1TJYA 2P3LA 5HBRA 3PFWO 4OQYA 3DMFA 2XWQA 4CL3A 1TTQB 4YB8A 3S2GA 1D2RA 2PSHA 1DMRA 5HP4A 3FWNA 1E4EA 3M0EA 1VLMA 4CTOA 4CETA 4CKZA 4DMCA 2GN2A 2JFPA 5AM2A 3EZYA 2XGSA 3PICA 4CQMA 3WC4A 3JD1A 5FAKA 4ZMBA 1JIQA 1CJSA 4O3MA 4PLYA 3TNYA 4AT1A 4XQGA 1AS3A 2HK8A 2IIQA 3PUYA 2DCUA 1QRRA 3AHIA 2KE5A 1HYGA 3NBFA 4KSYA 4PZLA 3FNIA 1H66A 4K9DA 1QB7A 3GLTA 3K1JA 3ZGLA 5A4IS 5KU7A 1KP9A 3K1AB 3MJCA 4TQUS 4EG5A 1YS2X 1ZN2A 2BZGA 1M0SA 3L05A 3RYFB 5A5FA 2ZYHA 1EH5A 3R7FA 3LKVA 3R7WA 2PMCA 4CHGA 1YI0A 4R1SA 4RF2A 3T3MB 2ZCJA 1K8XB 1KYXA 4DA4A 4UBMA 2OPBA 2PZBA 2PFSA 4MVJG 1AB5A 1Q0RA 2C4MA 3BIOA 4JQOA 3AZOA 3JAKB 2E82A 3WLPA 2P6UA 5AKGA 3L7LA 2E85A 5IBCA 4AZ3B 2WJHA 5JARA 2O0JA 3EVZA 1IEXA 1SB9A 4GQBA 3A6EA 3GT4A 3M6LA 4GVLA 4TS3A 1QF9A 2FPOA 5HIAA 4HDAA 2P9FA 3GA5A 3LOPA 3B38A 2AG1A 3VH4A 1XR3A 2QLFA 4KGZA 1QKKA 1UDCA 2R6ZA 2V3CC 2EZ9A 2VZ0A 1T5OA 4Y30A 5IKEA 5AOBA 3B1FA 4YONB 1NUHA 2EBFX 1GAWA 1C4XA 2CNLA 3N5CA 2GYVA 5DASA 1IN8A 2B6HA 4G5OA 4BVHA 5C8YB 4OXRA 2P6OA 1U8AA 2TSYB 5FWYA 5L3SB 5A4MS 1F12A 1RSZA 1RYZA 2GSWA 3KV3O 4DARA 1G8GA 2AR9A 2QL6A 5K51A 4EB6B 1PVOA 3IDOA 3M83A 2UZ0A 4TTJA 2IS2A 1L3IA 2Q6TA 5LB2A 2F8SA 3BRCA 2BGWA 2NUAB 4JHXA 4Q03A 1W36B 2Q8NA 1TUEA 3N2YA 3ZXUB 3ILXA 2GPTA 1DAMA 4F2WA 5CDGA 2Z8YM 1W34A 4R69A 1NFRA 2AR7A 2E4UA 1EAYA 2AN5A 2IF0A 3TZCA 3WWCA 4NBKA 4PCUA 5HKOA 1VB3A 1E1DA 1EJBA 2FRVA 4LC0A 2YCBA 4R8RA 2VWGA 1Z8HA 1A76A 2JI9A 2XYGA 3HS3A 4FX5A 1UM8A 1NBMD 1EZZA 1NNI1 5K99A 1QIHA 1Q22A 2TS1A 3RAFC 1TQ6A 4F2PA 3JQEA 4H1TA 4PCVA 2O5RA 1MV8A 1YHYA 4N8EA 5BWNA 4V3CA 2X8JA 4WKGA 3HA5A 4LY6A 3KHUA 2KS6A 4YBRA 4DBLE 4DHWA 5I7EA 4YXWA 2AHRA 1GKIA 2BR5A 5IF3A 3QMPA 1IY2A 1T9KA 5LWQA 1EK0A 1MENA 2Z6UA 3LT0A 3P9RA 4YECA 1SKAA 4PVCA 3N8GA 1PYDA 1EXVA 1EE9A 4DUYB 3WJ7A 3OFNA 4XEHA 2IUFA 2WJWA 4DLBA 2BZ0A 4HLUC 1UAAA 3PRJA 1TAQA 5DHQA 3FCAA 3V7NA 2DERA 5DJ5A 1J33A 1OBHA 4BNXA 4EABA 1YR8A 4DCGA 2X3UA 3B6IA 3A31A 2GPNA 1VYVA 10MHA 2Y9ZA 1UOQA 4RKWA 5F2NA 2ZI7A 3T1HB 2UUBB 3GRPA 4BLPA 2H65A 2CLOB 1A0OA 2AQHA 5DBGA 1VSQA 4K6KA 3J81A 1X7YB 3KHTA 4UQPA 1TPYA 2V96A 2ILTA 2PKQP 4D5GA 4EQZA 4RKEA 1SWWA 1PR0A 2WV7A 2PZKA 4NULA 2A30A 2QTCA 2EKQA 5EMJA 1ENOA 4KNVA 1YZUA 3NDBB 3HZOA 2E4ZA 3EISA 1Q74A 1J7KA 4A2QA 1ORVA 1GRNA 3AETA 5I5GA 3PYXA 5KC9A 2PUDA 4H27A 2XCIA 3PQ5A 1RWBA 3R5TA 1R0ZA 2GEDA 1WF6A 1B8UA 1BROA 2P90A 3SZLA 2XGJA 3JZDA 4Y1RB 2YIDA 5IJ0B 1RYMA 2BR4A 1Y3AA 4MRMB 5BN3A 1FP7A 2HGSA 1ZRHA 1ZCJA 2C59A 2O2HA 3UMFA 2P6RA 4L5JA 4GZ5A 4UUMA 1QMGA 2Q0XA 3K31A 4ZVPA 3JQQA 3QJ5A 4OF4A 4L0MA 3ADPA 3RVPA 3PEFA 4B7CA 2H5JA 1EX9A 1P91A 4E5SA 2W7TA 5CXQA 2XQJA 2CF5A 3EBLA 4QPJC 1TFUA 1WD5A 2X9GA 5HF8A 2O8FB 3DMPA 1VJ1A 1WXGA 2OBNA 5CPBA 5ALRA 3URKA 2D5LA 1KETA 4I9NA 1TX4B 4HB4A 3N87A 4X1YB 3VZQA 4A5SA 4OSPA 5L6MB 4CUKA 1Y81A 3P20A 4ND7A 4REOA 4JI0B 2OEPA 3QE2A 3FTPA 2JEYA 4M36A 1DRVA 1R4MA 1DC6A 1XCOA 4B83A 1S8AA 2FZWA 5AW4A 2L19A 3IBTA 5DLQC 3PC2A 5JOQA 1AGPA 2Q3HA 4MHOA 3CTVA 1I5OA 2WAXA 4I5FA 4Z9BA 2YMMA 4Y9RA 3WB0A 1G19A 4EY8A 5DM0A 1N3IA 1RQRA 1VHDA 1X7ZB 2VUSA 3KEFA 5TARA 4AJEA 5CDTA 2W22A 1G3IA 2I33A 1KR2A 1YWGO 1CWUA 4JLVA 1KQFA 1XQ9A 4HNGA 3A9UA 4JC5A 3P5BA 3QBEA 1FFSA 4IW3B 2VJYA 3K0FB 2JI4A 3HVHA 3KJNA 3NBZC 5HOQA 1T3TA 1GSAA 4UEJA 4DHEA 4JH0A 2J45A 4J07A 2DP4E 4KAAA 4FJ0A 2XKKA 2XOKA 1J8MF 1QYXA 2PLNA 2ZXEA 3AG5A 3OJFA 4NCNA 1W0KA 3ZX4A 721PA 1JPUA 3FHCB 3KWFA 1DC5A 4DQUA 5FFMA 3CH5A 3QFCA 1R16A 4TZKA 5DGTA 1N5OX 4KQHA 5CFPA 5LZ7A 4S1PA 4JOSA 2B4RO 5DGDA 2B99A 5H0IA 1U3CA 3E8SA 3KU1A 4LECA 4YK7A 1GXSA 1Z47A 4DZTA 4G8BA 5LKRA 3D6TB 1TB4A 1QAMA 1O95D 2ZVPX 3TZHA 3AUKA 1SCDA 3JQGA 3ZBPA 1ZH4A 2CDRA 4MUKA 4B80A 1SXIA 1MX5A 1MN6A 3G2NA 4M88A 1U9JA 3KZXA 2G82A 4L8LA 4XIYA 5H82A 5C8YF 2SKCA 5EOVA 3TDKA 1CUFA 3DV0B 5CCEA 5IEJA 1X7WA 3OJLA 1G20E 1OYYA 2H7CA 3D7RA 4KIGA 1A5SB 4UNIA 3QQ5A 3LA6A 2V7VA 5FOTA 1UR5A 5TMBA 2G08A 3AC0A 2XXBA 3BH7A 5EHNA 4B6JA 4JYZA 1FYEA 1L5RA 4O4LB 1I33A 4G26A 4G97A 1SNYA 3DMNA 4RQTA 3MAJA 3QBVA 4O08A 5JDCA 1MW8X 1KQ3A 2EU8A 2G4LA 3QI7A 4JP1A 4IRXA 1SKUA 1N1MA 1W35A 3E35A 4DY6A 1I1HA 1WZEA 4G37A 1IIBA 1J90A 5CT8A 2B83A 1C3VA 4QUGA 3S2ZA 4F06A 4KO4S 4ZO6A 4RTLA 5EIOA 4B17A 4GZ3A 4UCWA 2R7NA 2RCYA 2BMEA 5FBHA 1BMFA 1KTVA 2VDMB 3JZFA 3FMOB 3VJRA 3H19A 2FSFA 3ZR4B 5I7SA 4EG1A 3QSGA 1ZUHA 1PQ4A 1XCGB 1E2NA 2X77A 1NWCA 2JCVA 3DVQX 5B3LA 4KXFB 1W2HA 3U7HB 3ZHZA 3BGVA 5E0OA 1U1EA 4FS8A 1CJVC 1Z2NX 2Z08A 5CDHA 3ZE7A 1SUPA 4IV8A 4XIGS 1L5NA 3SLKA 3BSFA 4R7TA 1DEXA 1JFLA 3GLKA 4ND2A 1P5RA 4R98A 3RARA 2R8OA 5K20A 1JXOA 2C96A 3P32A 4MUXA 3ZS8A 3T3NA 1HNZB 4IDBA 1E2DA 3ESRA 3AVXA 2B78A 1U2SA 3PCXA 2QZJA 3BD7A 3RVLA 3TIXB 1GPH1 1FLNA 1QH8B 2SKEA 3JQRA 4Q5IA 4TLAA 5IAJA 3OSZA 3JALA 1AMNA 1PT8A 1JA0A 5J4LA 3ZDBA 3QMMA 5D5HA 1FPMA 2H1LA 2YVAA 3HE3A 1WSDA 3HL4A 2OVBA 3QXGA 1EFLA 1N9GB 3OQHA 3A6GA 1J21A 3IIJA 3MTAA 3NUGA 1C1XA 3Q1LA 4JWKA 5HR5A 5HEKA 1U3TA 4G25A 4BO2A 1QYDA 1P4RA 2WU1A 2RMKA 3SKYA 1Y6QA 1DRWA 4YV7A 1FS5A 3I01M 3R41A 3RU3A 3WI7A 2XNHA 4WVFA 4ZV7A 3C3XA 2ERCA 1V16A 3EJ6A 3TB6A 3DMHA 4M9XA 2CVQA 1XU4A 3BFVA 4ZEWA 4QOHA 2DE0X 2IS6A 1P19A 2BI4A 2BPOA 2R5NA 3MCZA 4PHFA 5A1JA 4GU5A 4UNPA 5CT4A 3IOYA 4Q4CA 1HFJA 4KQ6A 1LQTA 2XNSA 1LNQA 3QY9A 2IZOA 1JT9A 1VPTA 1C7JA 4M1SA 2AN1A 5BN4B 3S7ZA 4ASUD 2E3JA 2WVJA 4YMVA 3O8OA 2VP6A 4TSRA 3IP6A 5HE9A 1GGNA 2A94A 3TDNA 3TZLA 1ESDA 4ZI2A 2PK3A 2BUAA 1Z2OX 5GIOE 3OY7A 4I1PA 2QN9A 2PFGA 3IA2A 3DE3X 5F1PA 5M29A 4YDSA 5BYBA 3EG9A 2BLNA 1JEYB 2ODTX 3Q2IA 4LW8A 2G09A 3SR0A 3VC3A 4FR5A 4MS1A 4O33A 1OAAA 1ZD2P 4KFSA 5CYGA 1RTTA 1Y1QA 3B2NA 4NPCA 1CQPA 3KL4A 3BILA 4TKMA 3DOEA 1JBQA 4G9BA 3ETGA 2ISSD 2BVNA 1NW4A 2I1QA 2EBHX 1LLFA 1N0HA 1OGJA 1RPNA 3L6EA 1GYRA 3R74A 3QFHA 1D4AA 1QHNA 3LU1A 4BMVA 1LPNA 1OI2A 3P4YA 4Q93A 3B3GA 1XQYA 2QJTA 1Y7PA 2JH9A 4EO9A 1WA5A 1WF3A 2FMFA 2QIPA 4ALMA 4B6FA 3ADDA 4B79A 1EE1A 2EP5A 5CYOA 3D0OA 2LCIA 4FFWA 4K2HA 4F4JA 3HO6A 1T1JA 1W59A 3I4LA 4E09A 4NU6A 1XQ1A 2H63A 2JJ8A 3GCWA 3UGKA 4EZIA 3C1UA 5DYYA 1RCUA 1ZGAA 1YR6A 1MC5A 3RAEC 2AI1A 3KQMA 4RIIA 4HEA6 4H4EA 4HHEA 3QF4A 1AURA 3KSZO 1KNQA 5TMDA 1NYTA 2NU9B 2AD1A 4OGGA 4UDOA 2RHWA 1TLTA 3PX3A 4CNBA 1DI0A 4KL8S 3ELYA 1NONA 2ORED 3LQQA 3S2SA 1FDIA 2XHEA 3MB8A 4ZAXA 4K03A 5HKBA 1ZMXA 1GPJA 1FC0A 3E3MA 4C4AA 5CA1A 3FHLA 3EXEB 4R1QA 4OQMA 4ZVOA 3NHLA 5BNWA 4P38A 3W4JA 4BNZA 3KZ1E 2OFFA 3NM6B 4BZWA 4IEIA 2VQSA 1Q2XA 3DZFA 3SFTA 2XMCA 2YS6A 5BNTA 3G9UA 2HJGA 1CJCA 1UP4A 1FFAA 2NT3A 1V5FA 3D6HA 4TTPA 2PYZA 3NIFB 4I4NA 4N1AA 4YDHB 2F9FA 3B9BA 3UK1A 4DF3A 1QO9A 4UZFA 3DZJA 4KMSA 4JK3A 3ZDZB 5HQTA 3G0HA 3AU8A 1GUBA 2GAAA 3DYVA 4I6EA 3I2KA 1HE1C 1UH5A 4WKOA 2EKPA 4O4LF 3GA0A 3CZQA 3ILSA 2EFDB 5ICMA 1I7LA 3EVEA 5BSVA 2D0DA 3JQAD 1QM5A 1LCIA 1W93A 3HPQA 3HUFA 4R68A 3BMNA 1JR4A 1ECJA 1MABB 3MUEA 3M2PA 4FHDA 3TVDA 1EFRA 3JVEA 3MK31 3DG9A 4C0XA 5LXTA 5T6MA 3P0RA 2C3PA 4M8KA 4MPTA 3RUAA 2O19A 1BIFA 1XZQA 2EW8A 4GWLA 4ALNA 3DFIA 3NWJA 1MQSA 2PAFA 3CW8X 4JJGA 1Y1TA 2C4NA 4KJZA 4LY3A 4N3CA 2NV2B 2R65A 2H06A 1ICEA 1GZVA 1WXHA 2XJ4A 2ZVDA 4DBVO 1OIXA 2JLVA 4LXXA 4M0MA 3OG9A 3TG8A 1IUKA 3PQFA 1KP3A 1B7GO 1YMUA 3AY0A 3CONA 4L3OA 5JWHA 2FMIA 5F21A 1W25A 4PZDA 1BKSB 2GEBA 1K7EB 3A1NA 1D0IA 4DG8A 1PYOA 1RRMA 3KP1A 4MR7A 3H75A 2A84A 4HMQA 4RV9A 3R9XB 4RCZA 1OJLA 2R8EA 2GNPA 1V9SA 2C9CA 3JZIA 3QFRA 4RTOA 5EKUA 3AY3A 1B0UA 1TYBE 3VZCA 3L9WA 3ZIAA 4NFYA 3EBPA 1CTQA 1CVRA 3DOUA 3MGKA 4TOIA 4B8WA 2D2FA 1TTHA 5AI5A 2NP7A 1HDEA 3LCCA 3LI2A 3B12A 3PT9A 4HQKA 3SS9X 2ONJA 4R2MA 4HNSA 1LD3A 4D82A 1ACJA 4O63O 1RM0A 2P0AA 3CUUA 4LV8B 3TQFA 4OL9A 4BL5A 2BZ1A 1NSYA 2XUHA 2AKYA 2VUUA 4Y6RA 3CB4A 3N76A 3TXAA 4LK3A 5K0BA 2H00A 3SFVA 3OIFA 4P81A 4U9HS 1G4UR 1SELA 4PONA 4B9AA 1WNTA 2BDUA 1E2HA 4TKLA 1SD1A 2VZEA 3BYZA 3LHKA 2OT3B 3M4YA 3U44B 4LF6B 3GFBA 1BN7A 1P72A 4WXEA 1KJJA 4PLCA 1LK7A 2R8XA 2C5FA 1UBSB 4U5XA 1UJNA 4EDHA 5JDIA 1ZM9A 4JEUA 1C7QA 4Y2JA 5TEVA 1TCCA 3S0JA 3WOVA 4QDUA 2JVJA 4D4MA 4QAJA 1V9CA 4JEIA 3UKOA 4X92A 5BW4A 4PPYA 2C1XA 3O8QA 2X0NA 3GELA 4WOPA 4B3MB 2GCEA 5DM1A 4KQEA 5BN5B 1PT9A 1CJBA 3EOAI 3UOWA 4JP5A 2FXIA 3DOFA 2RBGA 3KUCA 1O5TA 2ZGVA 3ZW9A 2OHXA 1EGHA 3FMFA 3R7AA 4CMHA 2P6PA 3ZD8A 1W6RA 3LQRA 4I9GA 1H5QA 3X44A 1QFXA 4F1WA 4FFNA 3EN0A 2GVZC 2QN7A 4OI4A 3VYUB 2EOAA 2Z4SA 3KYJB 1EM8A 1TF7A 4BMNA 4DRXB 1I6MA 3WBJA 4U5QA 1IBSA 1CR0A 1P7WA 2QTMA 3M9XA 4WASA 5DV9A 4M99A 5J5CA 4XOUA 1KI4A 4N0PA 4BB6A 3DMYA 4P4LA 1Z37A 4ER7A 2NMVA 1XMJA 4NYIQ 2OKGA 1BC5A 1HEIA 1ODSA 3NMUF 1IN6A 1PJRA 1A5AB 3AHEA 4C20A 4K6OA 1UBHS 3SXUB 3ZE1B 2GUGA 4R7ZA 1JU4A 5FYQA 1TM4E 1U8YA 2AWOA 2JIOA 4C21A 4GYKA 5CFRA 2LZ0A 2ID8A 4EELA 3QH4A 1DV2A 1JHPA 1YE5A 1TA0A 4KR6A 4YAEA 5JAQA 1NNEA 1V45E 2R1VA 4P7KA 2C58A 1U9ZA 4TT3A 1KYQA 5H3LA 3K6SA 1MFZA 2JD1A 3F6RA 3H8JA 4IIJB 4BMYA 4YJFA 1INLA 1YTLA 3O4RA 4L75A 3IGFA 5EXSA 2ZQZA 4XLZA 1CY6A 2B4YA 5CURA 3A26A 4PXSA 1FY2A 1GFZA 1T4CA 2HPAA 3QBTA 1XYVA 3H9QA 3VAYA 5U9CA 3B20A 1QH1B 4R9SA 5BO5A 1R66A 4GM4A 5AJVB 1NURA 1SCIA 1DAKA 2ZWOA 4WEOA 5CUQA 3T3IA 4E30A 3RGWS 4C2BA 4ZEXA 1K97A 3CEMA 3M2TA 3UXYA 3GGDA 3A7EA 4IDNA 4E7OA 1G42A 2VYVA 3N86A 5C5DA 2FU5C 4MUEA 2ZYTX 3TR5A 1PSZA 5TQVA 1Y9AA 3MCVA 1QS0B 1ODJA 1X3SA 3HXMA 1I5EA 3R3JA 4FOOA 4GPD1 3TZQA 5J43A 1H93A 1RE1A 2JGRA 1J1UA 2PZ8A 1H22A 1PGOA 1OXSC 2J4CA 2XZTA 4HJRA 4DT1A 1YKGA 2AFIA 5EKSA 3SJAA 4GECA 1R9GA 1G4HA 3R23A 1JQJC 2ZVQX 2QTFA 3B60A 3HSYA 1PL7A 2VPIA 3PXDA 5KYYA 4HBGA 1QPBA 5IDVA 1PZEA 2GBFA 4GDMA 4N3BA 4NFSA 4ZVUA 2GO1A 1G4AE 3N39C 3S27A 3FHJA 1EX6A 1G8YA 3HO8A 2NUTA 3KM0A 4XM2A 3F5QA 4IQ8A 5JFTA 4K26A 3IR5A 3IL2A 3BJMA 1CX9B 2ECQA 5IJ9B 4N7RA 4L8GA 2D1SA 4XEUA 1H8ED 3HQ4O 4TVOA 4EGJA 4D99A 3ZUGA 4ESOA 4Q4DA 4GMGA 1J42A 2EIXA 4KZKA 5LCXA 4NH0A 4DAOA 5BR4A 2NSDA 3UF0A 2HEGA 2ZJBA 4FLEA 5DBHX 1URPA 3WAJA 4CLOA 5IT0A 1TT5B 1IAQA 2V7EA 3GGPA 4GX2A 5FLYA 5LMUB 1H2XA 1Q0UA 3KR2A 4XWOA 3F98A 1XZLA 4RLHA 1RKVA 1O4VA 2DUUA 2RFLA 2X3FA 3N0XA 1ZJJA 5JEEA 4XYBA 2FR1A 1CUVA 4AQYB 5THXA 3B70A 4CF7A 5K9ZA 1GZUA 2A9FA 3GJTA 2PRYA 2IOQA 1AG9A 3RU2A 5B5SA 1KAMA 2IYQA 3OPMA 1OVGA 2NQ8A 2IY9A 2W6QA 3OF2A 3P9PA 5JAHA 1EUDA 3BXEA 1J2EA 3FVQA 5JS6A 2JF0A 4GX1A 4FSXA 3TM4A 3WG9A 2G07A 4W1PA 5KAMA 3OQNA 1M7GA 1IH8A 4DDHA 1RVDA 4EYGA 2E0IA 1QJCA 1M6HA 2J3QA 2O7NA 2IEZA 3EZ7A 2I3DA 3KUDA 4TKVB 5EJ7A 2V0GA 2BJWA 3E3LA 1UJ5A 2QTVB 4IVPA 3TIGA 1XL1A 1XP5A 2IHBA 4R2HA 3TFOA 3C6KA 3FF4A 5H68A 5BORA 1MAWA 2XQVA 3BEDA 3P2IA 4G0XA 4OGWA 1K88A 1SN7A 5TS2A 1R6UA 4LOIA 1XSEA 2H8KA 5IULC 4ALKA 6CHYA 2HCRA 1CERA 3KK0A 4LXGA 1IY8A 5GV7A 3SLGA 3K96A 2A9QA 3GWZA 2HU2A 1Q7RA 2AKAB 1OBVA 3B89A 4X24A 2ZYAA 3DKVA 4AUKA 3IB6A 1YAHA 1N9KA 3E15A 4AZSA 1WTCA 5JASA 1QKJA 4LSMA 4BMPB 1D5CA 2BMVA 5JYDA 1W8DA 4ARZA 2PXXA 2J9YB 2VEDA 2VHUA 4TS4A 3OI7A 2Q4TA 1L7VC 2W48A 4D92A 1DFHA 2C97A 1Z4IA 7GPBA 1B0ZA 1MTZA 1Q15A 2WNHA 4IMRA 4X8HA 3Q8WA 3COZA 5B7GA 5LOVA 1NQXA 3KX2A 4NOLA 1TQHA 1E1CB 2NXCA 3HJTA 4Q1BA 3WB1A 4BEVA 3ZWWA 1NBHA 1V41E 2XQGA 4FYMA 4EJFA 1DPGA 1GP2A 1IUOA 2A9OA 1FQJA 3N0RA 3OFJA 2V8OA 3BEOA 3LT4A 4KPGA 3T3PB 2ZBPA 3S68A 4CM4A 1KBOA 1L7MA 2D74A 1DAFA 1T1IA 5LJIA 5F9FA 5G1OA 3E8MA 1NVEA 5MF6A 1SZJG 3O74A 3QY0A 2J5BA 2C84A 2IHVA 5C53B 2VQFB 1ISRA 3OCUA 3Q4GA 4JT9A 4YCSA 4BKQA 1KEVA 1SBQA 1C81A 1RJEA 1P4JA 2HDWA 4R05A 4WXYB 2IA5A 5EIBC 3AKZA 1OAOA 4QTTB 4BLUA 3PE4A 5LLTA 4BDSA 4E5YA 1UMBB 4CPDA 4PNEA 5JXIA 2A9KA 4IIJF 1Z2AA 1ZN7A 3M3DA 5B2FA 3LNCA 5NLLA 3ZWMA 2ACEA 2Q8QA 2MMGA 4MCJA 2QVBA 4UVEA 2JJMA 3L02A 4QJ4A 4Y6LA 1KDOA 3BMCB 4NAHA 4ZQBA 1M7BA 4WINA 5FQOA 3RKRA 4ABYA 2IEAA 4A0HA 1AVTA 4ZYVA 1BFUA 2FLVA 2PQ2A 4DS3A 4YUXA 1L5OA 2QTWB 2W2LD 3PGA1 4S24A 3R3UA 1XD2A 5HNKA 2H1VA 2VNIA 4OU5A 3LFTA 2ZW9A 3GEDA 4KQCA 1K8QA 4EMTA 1NBMA 2WRZA 3H84A 1G21A 2W71A 1JU9A 2OLEA 5ALWA 2JHAA 3EGXA 3MD0A 1RXIA 2OHIA 4LCJA 5AJYA 5HWSA 5F1YA 3BE8A 1E6KA 1XRPA 4WY5A 3DBRB 1GAJA 4B46A 5DHRA 4DTCA 4C3VA 4Q34A 1Y8CA 2QW1A 2R6JA 2G5PA 3HI6A 1G1AA 3IV7A 3FBWA 1NUAA 4TXHA 4WK0B 5CMLA 4PX9A 2ZULA 4WCFB 1OFUX 2PT9A 3DL7A 4DG9A 5EPOA 1YB4A 1Y7HA 3GMSA 3BIXA 2HF9A 1TYCA 2G1KA 1L4KA 4FOPA 1HG0A 2YC4C 3V97A 4F96A 1Z8DA 3F7TA 2GA9A 4H3KB 1Q2UA 1FSPA 1QTNA 1IY0A 5C8VA 4HNTA 3RS2A 1TUIA 2Q4RA 4ZHQA 1QGUA 3O75A 2PU7A 2ZATA 3DFMA 1Q0ZA 1IXKA 3SDBA 3O8LA 3X43A 3FB1A 4IOKA 3L0CA 2J46A 4ECAA 3DTYA 4TYMA 1DOHA 2G67A 5ER6A 4H7HA 4JYAB 7AT1A 3HEBA 1EWTA 4X7MA 2ZJOA 1D6MA 3CZMA 5MFPA 4HZUB 1H2HA 1X3LA 1GDHA 4UHKA 4BX0A 3RAJA 3AVPA 3RTCA 4M1TA 2P7HA 2ZB7A 5TQ2A 4DCOA 5AKLA 3HA3A 1WZNA 2WJPA 1KIAA 2ZZKA 2HSGA 4BE9A 3NHJA 1PTJA 2NU7A 3LY8A 4ZVTA 3O26A 3EXFA 4KX5A 1VZ2A 4P36A 3LPNA 2J0SA 2CJYA 2FCAA 2IOFA 4BZZA 4Z4GA 1QYIA 3GMIA 3MWLA 1QCZA 3BOSA 4F38A 4ZAZA 2G9ZA 3KQNA 3OE7D 4A03A 3D3QA 1XDWA 4RS4A 5IC4A 2GK7A 1ADYA 4KQKA 5LU9A 4BJ5A 3OFSA 4Y7CA 1VLVA 5K4HA 2HF7A 1I7DA 4EW3A 1WO8A 1HDXA 3LSTA 3BC1A 4OHFA 2WUWE 2P8JA 4BCCA 1DQNA 2O59A 1FTYA 3LHDA 2RCNA 3RU7A 1QHEA 1K4MA 1AK1A 4BC0A 4GVXA 5KNCD 3BFXA 4RA6A 2R4UA 1OXTA 2Z5LA 1DO8A 4AN0A 1XTJA 4Q9AA 4X1IB 1AKQA 1QYWA 3U7IA 3S55A 1FSZA 4KO2S 5IHXA 1OVMA 2G9QA 3R5KA 4JYBA 2XB2A 2GF2A 2HA2A 4KJXA 4KFRA 4MQ6A 1P61B 5KDDA 3NBKA 2PGAA 4N5DA 1QO0D 3FUUA 3G6KA 3KSRA