2I76A

Crystal structure of protein tm1727 from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
256
structure length
247
Chain Sequence
VLNFVGTGTLTRFFLECLKIGYILSRSIDRARNLAEVYGGKAATLEKHPEVVFVIVPDRYIKTVANHLNLGDAVLVHCSGFLSSEIFKKSGRASIHPNFSFLEKALEMKDQIVFGLEGDERGLPIVKKIAEEISGKYFVIPSEKKKAYHLAAVIASNFPVALAYLSKRIYTLLGLDEPELLIHTLMKGVADNIKKMRVECSLTGPVKRGDWQVVEEERREYEKIFGNTVLYDEIVKLLREVAESERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein TM1727 from Thermatoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
total genus 62
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10728 DUF2520 Domain of unknown function (DUF2520)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.20 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 ProC-like, C-terminal domain 2i76A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i76A01
3QW2A 3QWAA 2VYVD 3PJDA 1N1EA 2AW5A 1MFPA 2YHIB 3K9QO 4OXKA 1BDMA 1E5LA 2Q50A 1LA2A 1SOVA 3GNTA 2PK3A 4U7WA 4D43A 1GCOA 2DC1A 4RVHA 3ROKA 1UP6A 5I7SA 1K6XA 1T2AA 1H6DA 2BD0A 4AJEA 5KNLA 3E9QA 2I3GA 3F9IA 2FPGA 4OXNA 3ZHBA 3BAZA 4ZQBA 2R00C 3JQGB 4EEXA 1YJ8A 4BGIA 4NR0A 3GMDA 2ZB8A 1Z7EA 1ZK1A 3UICA 4XD2A 4CV3A 3ZU4A 4R9SA 4MVJD 4ZRNA 4E5MA 3JQ6A 2GDZA 3BHIA 3P7MA 5CP8A 4LVUA 1E3LA 3ZZNA 1SZJG 2NU6A 1KY4A 2HK8A 5FFFA 3WJAA 2W90A 4J49A 4EJ0A 4CMIB 1JAXA 3Q3CA 1RKXA 4YAJA 3KHUA 1PJ3A 2OGUA 3PGJA 1XR3A 1LDNA 1WP4A 1YXMA 2LDXA 1P1FA 2C7VA 1RYDA 5JMWA 1PGOA 4CM1A 4D79A 1EUDA 1JWBB 4MPDA 5ENDA 5HS4A 1QV7A 3RJ5A 4ILKA 2G17A 3JQAD 2WYVA 3KLPX 3TFQA 3GR6A 1XU7A 1C0KA 2WM3A 5KJCA 1RYEA 4XJTA 3RBZA 4J2OA 1V3TA 1IPEA 1IHYA 4B79A 4XYLA 3KUXA 4C4OA 3WOHA 4GBJA 5EERA 3V1UA 3GGPA 1DFHA 3OQ6A 4YDRA 3Q1LA 3I6QA 4FN4A 1ZCJA 3VPHA 2FN7A 1BG6A 3GVHA 3QLJA 2AEMA 2BGMA 3E9MA 1PZGA 3QVTA 3HNPA 3F5QA 4BO1A 1YOVA 4DTIA 3U5TA 2I66A 1ENPA 4LK3A 1CQJA 2P9CA 3FR7A 3H6KA 3KTDA 3D0OA 3KZVA 4MVJM 1C0IA 5BSGA 4QSMA 1VI2A 5A9TA 3VPGA 2NV6A 4Q39A 3F4BA 4XQGA 1RPNA 1CJCA 3I6IA 4QTZA 3VZPA 3OA2A 3C1OA 1ZKMA 1YBMA 4HX5A 1TT7A 1MP0A 2FOIA 1GYRA 2HO5A 3H7AA 1XLTA 4FFRA 4QT0A 4UUNA 4TVBA 4JK3A 5H82A 3TWOA 2GRAA 5A02A 1I5RA 2BI7A 2EKLA 3OFSA 4R1UA 1QYVA 3DHNA 3DBVO 5HWSA 2YYYA 2AE2A 3DFUA 4RQTA 3JQAA 3E6AA 4E2YA 4P22A 2YQ5A 2E37A 2GN6A 2P9GA 1UXJA 3FWZA 3ICPA 1NFFA 3K73O 4JP2A 4OQZA 4OSOA 4CMAA 3FI9A 3NV9A 1SNYA 1ENZA 3JV7A 3BXXA 2CZCA 1RWBA 2DM6A 1ZJYA 3EC7A 3ZU2A 4TZTA 1JDJA 1DO8A 1QSGA 4KZPA 1QKIA 1H94A 3IJPA 3QV1A 4PLTA 4YCAA 1QRRA 4GX1A 1Y5MA 5THKA 4E13A 3O8QB 2UV8A 3HJAA 4HFRA 1ZK4A 4BNJA 5TGDA 2D1YA 5EMHA 3OBBA 3QY9A 4PGFA 5JAIA 2QZZA 2CVQA 3PZBA 4K6CA 5CG2A 1GYPA 3Q6IA 1JVBA 3FHLA 1VM6A 3L0DA 4IINA 3MOGA 3GNQA 3FNEA 1JA9A 3OEYA 5TRTA 2D0IA 3WLEA 2HRBA 3AW9A 2HSDA 5DNAA 1PGNA 5THQA 3SJ7A 2CDAA 4KTVE 5AXDA 3V8BA 1W6UA 4UREA 4N54A 2O2SA 3K92A 1VJ1A 2EERA 4UEJA 2AQIA 3AUUA 3L6EA 1PSDA 3FWNA 1FDTA 3JYQA 3ROMA 3U4HA 3HN2A 5BSEA 1KVRA 4J91A 4YRDA 3JQFA 2E6UX 3RASA 2FMUA 4EI2A 3FF4A 2FY8A 4BO5A 3ST7A 1X7GA 2O4CA 3DAPA 3KRTA 1DIHA 3DXFA 4M86A 4YJFA 1IHXA 1XSEA 2EKQA 1Z6ZA 3ENNA 4ROSA 4TRMA 1NPDA 4XYEA 2VT2A 4C7KA 4J0EA 3PTZA 4IS2A 1EVIA 1E0DA 1HDCA 2P4HX 2P91A 2YJZA 4UEOA 2GPTA 4U6SA 2QW8A 4II3A 4QFCA 3DQPA 3H9GA 8ADHA 4IDAA 4CMGA 1PGJA 4I8XA 1ISGA 1GV1A 4WKGA 2Y66A 1X1TA 4BKOA 4BNFA 3U4CA 2OO5A 1GR0A 2V6FA 2B0JA 4E2XA 3A1NA 3MJTA 1T2EA 3JQBA 1QP8A 2HKIA 2JD0A 4IJVA 4YRBA 3ZU5A 3FBGA 1L7DA 3I4FA 4QXMA 1CERA 3GZNB 4D3SA 1Y8QA 3VC7A 1ZXLA 3C7DB 1MUUA 1KYQA 4B7XA 4E2ZA 2VOJA 2C5EA 4IXTA 2NTJA 3A9WA 4XYGA 1T2CA 2NU7A 4ZHSA 3DOCA 3ZWCA 4CUKA 2R6JA 3F1LA 2RHCA 3BTUA 2QG4A 4IJKA 2PD6A 1MA0A 3QVXA 2B37A 5FYDA 4BQRA 2NVUA 1LDYA 2HU2A 4DMMA 4ND5A 1C1DA 3V2UA 3GQVA 2CVOA 2SCUA 4UVGA 4RLSA 1SC6A 4NJOA 3CZMA 5DZSA 4BNIA 1PEDA 4MJLA 5DN9A 4EUFA 2BFOA 4HP8A 3LZ6A 3WBBA 3ZWVA 4J1TA 1Z73A 2FSVA 4WASA 4UULA 3T4EA 4GSLA 2X5OA 1DAPA 3CMMA 2FWMX 3PK0A 3R0IA 2GNAA 2OP0A 3EZLA 1DRWA 3I9LA 4AICA 4Q3BA 5MGBA 3WSWA 3KYDB 3TZKA 5IJZA 3O03A 2O3UA 4WEQA 1JVSA 2DVMA 3M6IA 2EXXA 1KERA 5DOVA 3AU8A 1M66A 2C0CA 2C7GA 3E5RA 5C5IA 2IDZA 4U8GA 4HFNA 5A3JA 3D1LA 1HL3A 1KS9A 1VSVA 5U9CA 2HJRA 1QYCA 5A04A 3SVTA 3OM9A 1BW9B 2X7HA 2X6TA 3FBTA 1QYDA 6LDHA 2E4AA 5DP2A 1HTBA 2UYYA 3L07A 1E7YA 3QWFA 3RKRA 2Q4EA 4XQEA 1P3DA 1P31A 3CXRA 2AEFA 1HSZA 1GPJA 4GLOA 2OFPA 4JX8A 3I23A 1OBFO 4OYRA 5FEUA 3OH8A 1CIVA 1I10A 1LI4A 1NVMB 2YV2A 3UAGA 1NAIA 3ZV6A 2WE8A 4CL8A 4KUEA 4NFHA 1BRMA 1A4IA 3ZW8A 1YONA 4XQCA 1XCBA 2Y0CA 4BOYA 4TKMA 1C3VA 1H9AA 4Y8VA 1P1JA 3PIIA 3KV3O 4J6FA 4I08A 5HM8A 4YQZA 1XQ6A 3IDSA 2HUNA 3S2FA 4U0JA 3WLFA 4H7PA 2X5JO 1J49A 1JKIA 3RC2A 4CM4B 4JGBA 1F8FA 1A9YA 4WNCA 4H3VA 3HFSA 3E48A 3MTGA 4RF2A 1PJ2A 5C37A 4K1LA 3P2OA 2Y1DA 1BGVA 5ENVA 1T2FA 4BNZA 1PJSA 1LBEA 4ESOA 3PRJA 4FC6A 2O3JA 3TSCA 3KVOA 4GQAA 3JQAB 4XIYA 4CQLA 4W6ZA 4I5EA 2Y1GA 2PZKA 3Q9UA 2W2KB 5EQDA 2XXBA 4ND2A 4CV0A 2FZEA 3RUCA 4YB8A 1CWUA 1NQTA 3Q0EA 1ULSA 2Q2VA 3I5MA 2UUPA 2EG9A 2P4QA 3K5PA 2CY0A 2IYOA 4XDZA 4LVCA 3G0OA 3I9MA 4UAGA 1OC2A 4ALJA 4J16A 3P5SA 1QORA 1KETA 1A7AA 1SEPA 1WWKA 4O0LA 5JMPA 1NYTA 3UCFA 3DAGA 3A14A 4UUPA 4DUPA 3E5MA 3H5AA 1NQOA 3FTNA 2HAEA 2PD3A 2ZCUA 5G0UA 1VL8A 2B5WA 4AJ2A 2JD1A 1OOEA 2J6IA 4BO4A 3KLMX 3SJUA 1FK8A 3DR3A 2P2SA 1BVUA 3E8XA 4GMFA 5GZ6A 1HSOA 1X0XA 3OIFA 4W7IA 1HYHA 1TT5A 2PKQP 3KBOA 4NG5A 4CODB 4J1QA 1BXKA 5T8KA 1QLHA 3ITDA 4BO3A 2C59A 4IGEA 3GNSA 3HWRA 5EPOA 1YL5A 3V2HA 4CLHA 1YH3A 3KSZO 1PQPA 2RCYA 3VHRA 1Q7CA 5T67A 5ICMA 4NK4A 1U28A 5AXCA 4J1SA 1C0LA 5IZ4A 1ZH8A 2FPPA 1GZ3A 5J23A 4MVJI 3ABIA 4CR6A 1ENOA 1RM5A 4GX2A 3DBRB 1ZZEA 1VSUA 3JQEA 3LC1O 4BMVA 3W4JA 1A71A 1DFIA 4NDNE 1YWGO 4R16A 2JHGA 2VRCA 3VH1A 3GF4A 4TRRA 1X7DA 3ROQA 4CLOB 3Q2KA 3DZIA 3H65A 3IKTA 3RC7A 2AQKA 4YJFB 1CQIA 3DMYA 3C8MA 5EQFA 1CETA 4L4XA 1E1LA 2OORA 1N9GA 1XA0A 5BNTA 4CLOA 3LT1A 4J4HA 3O26A 3KB6A 3GHHA 2Q2WA 3IUPA 1TEHA 5A05A 1ZJZA 4NQZA 4XYMA 3RUFA 3KSUA 2FSSA 1B3BA 2FZWA 4DC1A 4R54A 1MFZA 3GEGA 1JKJA 1VRWA 3QP9A 1FF9A 4WCFC 3ASUA 4LRTB 1LUAA 4ZQGA 2WJPA 4H15A 3TQHA 1H2BA 1OAAA 3LK7A 1XWFA 3W4KA 4D3FA 5TT0A 1WXDA 3D4NA 3FPCA 1TLTA 1R0KA 4B7CA 2GSDA 4XRGA 5L45A 2O48X 1U2DA 1A9ZA 3OJOA 3QVSA 4BGVA 1ZUD1 2EGHA 1E7QA 1UDAA 4ALKA 4ALLA 2NVBA 2JL1A 4TWRA 1AHHA 4DLAA 3RU9A 3UHAA 1SAYA 5B4VA 5CEJA 2G76A 1LJ8A 1T4DA 3AWDA 2VZ9A 2VNSA 5H81A 4FGSA 3CE6A 1ZO8A 1NFQA 1HETA 5MDHA 2Y99A 4WLFA 2EJWA 2ZTVA 2Z5LA 2VNAA 3BMCA 1M76A 3NYWA 5JAQA 1IE3A 4YR9A 3VTFA 1CRWG 2CSUA 5EL0A 4A5OA 4S1VA 4DA9A 4J4TA 1F06A 3ZWYA 4DIFA 4E2WA 1B2LA 3ZN2A 3LT0A 1PZHA 2DTXA 1U7HA 4B3HA 1KVTA 1GV0A 1JU9A 1GQ2A 3D4OA 5AVOA 3KETA 4JROA 2VOEA 1K0UA 3S2EA 5LDGA 4CLEA 4P4GA 3UCEA 5JW6A 5IFLA 3DTYA 4D0SA 3PJGA 3JQ7B 3KOUA 3RIHA 4LN1A 5DCYA 4CM8B 1E7MA 2Q1UA 4E5YA 5GZ3A 3VZQA 2JFFA 1MV8A 4J7XA 1ZK3A 1X7HA 3EGOA 3SX2A 1XIVA 3MJEA 2C29D 2VYNA 2Y67A 4K9DA 1YKFA 4URFA 1LEHA 1RM0A 4NBVA 5I8ZA 4EZBA 4R9RA 1ZK0A 5JSFA 2PA3A 4IGFA 1V3VA 3K8ZA 1O5IA 3K6JA 4GAEA 3HUDA 1GQYA 3ZV3A 1NNUA 3PLRA 4DGSA 2BLLA 3ZCXA 4MINA 4CLXA 3QQPA 4M54A 3LSYA 4J2HA 2R00A 3PPIA 1IUKA 3G79A 1P44A 4OM8A 4Z9YA 2YZ7A 2DFDA 3MWDB 1O94A 1JKFA 3CTMA 4F6LA 5B1YA 2AEJA 5IXSA 3FRJA 4BMNA 2AQHA 3B70A 4IZIA 1GCUA 1WZEA 3H3FA 3R3SA 1GEEA 2X0JA 2VUUA 3O4RA 2VQ3A 3BZUA 1WMBA 3AM4A 3DHEA 2PZMA 3JYPA 3K31A 1LSOA 2DUWA 2YV1A 5G0VA 3UF0A 2GCGA 3AY6A 5IDWA 4RPLA 1JWAB 4GLLA 3RJ9A 3A06A 4HKTA 3D3WA 4CMJA 1D8AA 4J7UA 1HDZA 2GD1O 2GO1A 4OJNA 3RKUA 3NRCA 1GL3A 3ZWWA 4RPKA 5KTKA 1R16A 1Y9AA 3OQBA 4KQWA 4N5LA 3G1UA 1T4BA 4BV8A 1NBOA 4ONEA 1I3MA 1G6KA 4PLYA 1DHTA 4W82A 1LC3A 4LISA 3F46A 3RCBA 4A27A 1XQ1A 3H8VA 3KEOA 3GH3A 3GY0A 3WNQA 4BS9A 4F46A 3AY3A 4DVJA 2NQ8A 3ZI0A 5CFZA 3L9WA 2VWQA 4L0QA 4WLVA 1AXEA 3F1KA 5KJEA 2X23A 3PZRA 4TRJA 3CH6A 3K2BA 3C7CB 4RL6A 1NP3A 1S6YA 2VRBA 3EUWA 3HSKA 5F5LA 4AJHA 4CM4A 1HE4A 1B7GO 4N5MA 4BMSA 1E5QA 3AI2A 1A72A 1VL6A 4BO9A 3OA0A 3ZNQA 5G4KB 5HTOA 1I2BA 4XGKA 1NAHA 2AMFA 4YEDA 1E7WA 3NTQA 5KCZA 3OETA 1EE2A 3GG9A 4R4JA 3WFIA 9LDBA 4IDGA 7MDHA 5AQ1A 2B5VA 1UZMA 2Q46A 4II2A 3O9ZA 2W98A 2VCYA 1G1AA 4A0SA 5B4TA 1X14A 4IUYA 2XF8A 2CF6A 1FDUA 3AUSA 3ETGA 4D45A 4Y9DA 4WPGA 4J0FA 1AXGA 4RCVA 1BXGB 1WDMA 1SOWA 2PFGA 3LLSA 4YBZA 4YT4A 4OMUA 1DOHA 2YFHA 4KWHA 4A03A 2Q49A 4R3NA 4WGGA 3HB4X 3GFBA 1PGPA 4DLLA 3VVBA 3ZGYA 3VVCA 1KEPA 3WYCA 1WMAA 2EKPA 3HB5X 3D4PA 1DSSG 1BDBA 4Z0HO 4B4OA 1PX0A 1ZSVA 1GD1O 3AI1A 5F3RA 2ZATA 3SLGA 4K28A 2VT3A 2GN4A 3NT2A 4JLWA 3KM0A 2I99A 2Q99A 4QQRA 2QQ5A 1DXYA 1PR3A 5KOIA 1H9BA 2WTBA 1ADGA 1E1NA 4WUVA 4RVGA 3RUDA 4YT5A 2J5KA 3F5SA 2NTNA 1FMCA 1T25A 1R66A 1DB3A 2GN9A 1Q7BA 3V5NA 4FFLA 1IOLA 2WD7A 3HN7A 4F6CA 2BRUA 1GYQA 2CF5A 2GASA 1YB1A 3JD3A 3DDNA 3G3EA 3NJ8A 2XPCA 2NNLD 5L51A 5C3MA 3SXPA 5ICSA 1H6BA 2CNBA 4IXWA 4BL5A 2YHUA 1H6AA 1KC3A 2I3AA 4YACA 5EN4A 4MVJA 1C1XB 1EK5A 1NQ5A 5KJ1A 3ZNOA 4J4BA 2VTEA 2CFCA 5IN5A 3WX0A 1EUZA 4ZQFA 4NJMB 2JAHA 2V65A 4KP7A 1BWSA 5ES3A 1LSSA 4QECA 4PZDA 1L7EA 4J1NA 4DREA 2E49A 4O1MA 3MTJA 1VE9A 4AL4A 2HJSA 3COSA 4YAIA 1UXKA 4W7HA 2Z1NA 1B26A 1NHGA 3DBHB 1NQAO 1EEHA 4LCJA 4Q3EA 4BNLA 2Q1TA 1KEWA 3G49A 3VH3A 5HRUA 4B3JA 3BMQA 1EFLA 1GDHA 2RBEA 4OKNA 5U4QA 2A4KA 1DDOA 1JQBA 4XGNA 3VPSA 4O6VA 3RQSA 2Y0DA 3M1LA 4YAGA 3BMQB 1U5CA 3RVDA 3TL2A 1AGNA 1XG5A 2AQ8A 3INTA 4FW8A 4DBZA 5FI3A 2EHDA 4GL4A 4BNTA 2VZ0A 1VC2A 1D1TA 3PQFA 3NEPX 4YJGA 2EJVA 4BGUA 2AA3A 4MP8A 5IDYA 2JKVA 1KEUA 4LGVA 4PN3A 3CIFA 1E7SA 1E3WA 5JPIA 3HE3A 3U4IA 4Q9NA 3OICA 1Y9EA 3U62A 4F3YA 1FJHA 4NH4A 4YWJA 1VL0A 2EV9A 3GFGA 2OL4A 4YTEA 2IZ0A 2D2IA 2PNFA 2J5QA 3GEMA 1UZLA 3DZKA 3HDHA 3ULKA 3ENKA 5FF9A 4A2CA 2D5CA 4PG5A 3X2EA 1GUYA 1B8UA 2X86A 1PL7A 1SPXA 4PRKA 3O8QA 1F12A 4PLCA 4GVXA 1EBFA 1O9BA 2A35A 2B4RO 1ML3A 2BKAA 3JQ9C 4PZCA 3LF1A 1N92A 2X9VA 3TZQA 1Z45A 2IEDA 1AUPA 1EDZA 3HDJA 2EP7A 3JD4A 2PV7A 3WQQA 4MIEA 1T26A 2Q1SA 4MKXA 4GKVA 1LRJA 3UXYA 2EWMA 4XGIA 4OSPA 1Q0QA 3BMNA 2HDHA 4TZKA 4UUOA 3GEDA 4DPMA 2NM0A 4U5QA 5L4NA 4JXKA 2OBYA 3BMNB 3EVTA 2V6MA 3RAJA 1LNQA 3L6DA 2PH3A 4EUEA 3D5TA 1H5QA 4BNWA 1YE3A 1NR7A 1PL8A 2FR0A 3ZDFA 4C7JA 1ZVMA 2QIOA 3EY4A 3QJ5A 5DT9A 3Q2IA 1DC4A 4XKJA 1YBAA 3HZZA 3IOYA 3VPFA 4YXFA 2QRLA 4FGWA 3TN7A 3ZV5A 4I9UA 4NI5A 3ZHYA 4MO2A 5DCUA 3DOOA 1NASA 4YAEA 1TA4A 5TF4A 1IY8A 5JXWA 2NADA 5CEEA 3PFFA 3V1YA 5JCJD 5A3VA 1HDXA 2Y05A 3C1TA 4M8SA 4R5HA 1ZNQO 2R2GA 4EJMA 2RH4A 3CSDA 1LSJA 2O3QA 3L6OO 4FFOA 3JYNA 3MJCA 4BNMA 1Y1PA 4GI2A 2GF2A 1UP4A 4L76A 3M1AA 3BMOA 4FD3A 1NVGA 2YFQA 3GZ4A 4O63O 3UH1A 4DLBA 5L7WA 1EQUA 1HE5A 3ZH2A 3H5NA 3HADA 3VKVA 1EVJA 1OMOA 1SB8A 3GT0A 1P45A 4YQYA 5L4SA 3KEQA 4XCVA 1ZW1A 1DIGA 2X9NA 1GFSA 5T64A 7ADHA 4IMRA 2O3SA 4HNGA 2C2YA 4IDCA 3VPXA 1UUFA 4UVHA 4E32A 4BKUA 4FFNA 3RUHA 3MEQA 4FB5A 4D42A 4RVSA 1B3RA 5JLAA 3Q9NA 2DBZA 4Q3AA 2BGLA 1VKOA 1U5AA 4JBGA 3DB2A 1I3LA 4GWGA 2JAPA 1PJLA 3AOGA 5BNFA 4IDBA 3LVFO 4EEZA 1I3KA 3E82A 1B8VA 4AJPA 1PGQA 3ASVA 2F00A 4PLVA 2J3HA 3OQ1A 1K5HA 3JYLA 1X0VA 5F5NA 5JDCC 4D7AA 3GAFA 5TC4A 5BR7A 4M87A 2DTEA 1HDYA 3DBHA 4HADA 1PJQA 1I36A 1GZ6A 4Z9FA 1ZEJA 5JC8A 3WB9A 4IM7A 1YVEI 1U3TA 4KDEA 1PQUA 3SLKA 5JDIA 2OMEA 1YQXA 2NSDA 4MVJF 4FBGA 2WD7B 1ZXBA 4HBGA 5JAZA 3V2GA 3DZGA 4CLRA 3IQDB 2PWZA 3HFGA 4CMBA 4CJXA 3AUTA 8LDHA 4R3WA 3BMOB 4HNHA 4AJJA 2J3IA 5G4KA 4DIBA 4NZ9A 4ZICA 1C1XA 2OBNA 5TQVA 2VHVA 2C82A 4BNYA 3ORFA 3PYLA 4A7PA 2ZB7A 2NVWA 1IYZA 3VTZA 3WTBA 3DZBA 1EDOA 1NHWA 4TROA 4BNVA 2X0IA 3C3XA 3H9QA 4RORA 4CPDA 1ARZA 4IIUA 4BNGA 4D46A 3RC1A 4LCEA 4P38A 4PIVA 4R41A 3DMTC 4M1QA 3BYZA 4G81A 1BXGA 4IZHA 1VJ0A 4DRYA 4MVJH 2A92A 3D7LA 1EE9A 1JW9B 3PXXA 1DRUA 1Y8RA 4ID9A 4KDFA 2Y68A 1DC6A 4CM7A 4YT8A 3U3XA 1HDRA 3NX4A 3F3SA 3WQSB 3X2FA 4E0BA 3JTMA 5I8WA 3WGIA 4E5KA 3WNVA 1ISIA 4RO0A 4KUGA 2CD9A 1BMDA 1YRLA 5JYDA 4WEOA 2UAGA 5F1PA 1KVUA 4K26A 1MG5A 1U1IA 2DBQA 2Q1WA 3DO5A 4OXYA 1PIWA 2WEKA 3PJEA 4WK6A 2O50A 5CAEA 2Z95A 2W2LD 5DBGA 4DWVA 3QHAA 3WYBA 1NVTA 5TX7A 2DFVA 3TFOA 5TSDA 3TZ6A 4ZQHA 3D3EA 3ZWMA 4CMHA 4OHUA 6ADHA 1V3UA 4JBHA 5JDIC 4LRSB 3B1JA 1I24A 1P1HA 2V6GA 2X1HA 4KWIA 4W9NC 4BO2A 1P33A 2I6TA 2W4QA 4DQVA 5L7TA 2ZB4A 5IN4A 4WLEA 2YDXA 3WBFA 4QUKA 4PG8A 5KVQA 2BGKA 4FJ0A 1R0LA 4I5FA 1S7CA 3FD8A 1K6JA 5K6AA 4MP3A 1M67A 3TDKA 3BHMA 4BKQA 5FI5A 2CDCA 2E48A 2VWPA 4RF4A 1PWZA 3CEAA 4NBWA 1B8PA 3ROPA 3PYMA 1HDOA 2EGGA 4Q3DA 3BA1A 1XEAA 5ILOA 1TVEA 3H4VA 5FWNA 3IUSA 4WLNA 3MJVA 2GZ2A 4ZN6A 4ZA2A 2NTVA 4MDHA 1KOLA 4KQXA 4PLZA 4RVUA 1YOVB 2VHZA 3WGZA 5HA5A 2HK7A 4I9HA 3AI3A 4G5HA 3D64A 2B35A 1I2ZA 2ZB3A 3F6YA 5TJHA 3PHLA 2F1KA 4IDDA 4M49A 9LDTA 1KVQA 4PG7A 3FNFA 3WMWA 5BQFA 3BTVA 4IY1A 4NHEA 2UDPA 1WZIA 5DBIA 2AXQA 3IAHA 1Q0HA 3C85A 2PKQO 3N58A 1ONPA 1ZSNA 4FFMA 2PGLA 1TXGA 3W1VA 1VLLA 4YJHA 1H93A 4Y6PA 4XWYA 2DUUA 3WMXA 4JIGA 4E3ZA 2W2KA 1H6CA 3GPIA 3SC6A 5IDQA 1T1RA 1HDGO 3D5QA 3DZJA 4J90A 1GUFA 1L1FA 1Z7BA 1HEUA 1DJQA 2ZJ0A 4UUMA 1EBUA 5LC1A 3GGGA 1P77A 1AE1A 4XJSA 4N18A 5COBA 3UGKA 3ANNA 3VH4A 4E31A 3I9OA 4J3FA 4ITUA 4BGEA 3QA9A 3LQFA 1LU9A 1NTOA 3GRKA 3AM3A 4RDIA 3BTSA 2ZTUA 3GPDG 2IE0A 1I8TA 3ONFA 3VAZA 5ITWA 3N7UA 4Z0PA 1MC4A 1HLDA 4AJNA 4BO7A 4Z3KA 1D4FA 3R1IA 1GY8A 5JFOA 2JJYA 1OI7A 4HFMA 4BNXA 2GZ3A 3PYXA 1LQTA 5I7VA 4XDYA 1LRKA 1PWXA 4AVYA 5EJ2A 2IEBA 1YDWA 3ZWPA 4WE3A 1E3JA 4RDHA 3UW3A 1PS8A 1PJCA 2PY6A 3DBRA 4CR8A 4UVDA 1Z74A 2NU8A 1WVGA 1N9GB 4IBOA 5JO9A 2D3TA 1E1KA 2BFMA 5HS6A 2DT5A 1M6HA 3NDRA 4RPJA 3AK4A 1ORRA 5ITVA 2HQ1A 1O95A 1KEVA 1PZFA 2EF1A 3G1TA 5IXYA 4NBTA 5JO0A 4NK5A 5I9MA 2WE7A 4QX6A 4CR7A 3F4LA 3H5RA 3ADPA 4YVFA 1E3EA 2B4TO 2UUOA 1UXGA 5AYVA 5G2OA 3QWIA 4CLRB 2D59A 2G1UA 4I5DA 3RUAA 4ZU3A 1HYGA 1GZ4A 2VYND 2BFPA 1U8FO 1PR9A 3BHJA 3OJ0A 5KKCA 3DZFA 4Z6KA 3GMSA 3OJFA 4ND1A 3FSRA 4WLOA 2WYWA 2YV3A 4XA8A 1HF3A 2IODA 4BHTA 4DMLA 4E33A 4RF5A 4RGBA 1GTMA 4B4VA 1KC1A 4B8ZA 2BHLA 2X22A 5KKAA 4OOFA 1P74A 1UR5A 3WWYA 3UN1A 3ETDA 4YRAA 5JYEA 1VPDA 1HZJA 3GDFA 3HDQA 2DBRA 5IAAA 1V35A 3EYWA 4Y6RA 3GRPA 4FQ8A 2BFAA 4PG6A 2VZ8A 1AHIA 3B6ZA 5DOZA 4E5NA 5L40A 2I76A 3L4BA 1YS4A 4BKPA 4DXHA 4TKLA 2HRZA 3WGGA 3FCOA 4FJ1A 2QRJA 3E1KA 4FOOA 3WGOA 4CM3A 4I9NA 4MVJP 4XB2A 3OEWA 5I7FA 3FNGA 1F14A 3VDQA 1UZNA 5DDIP 2H63A 1U4SA 3WIEA 1ADFA 4EYEA 1N7GA 1Q7GA 1EUCA 3IJRA 3MWEB 3VH2A 3VZSA 3IKVA 3IP3A 1UDCA 5L95A 2Q4BA 1DFGA 3EVNA 4LSWA 4KUHA 3VOSA 4Q3CA 3HDYA 5EIOA 4ALMA 5IG2A 2FR1A 5TIIA 2RIRA 1UAGA 2OOSA 4BQPA 2G82A 3D3WB 1Q1NA 3NKLA 2ZYAA 4MKZA 2DBVO 4LSMA 1LTHR 1OZAA 2HMTA 2EIHA 4YYZA 4O59O 5A9SA 5I9NA 4AJOA 3ZNNA 3A28A 4PLFA 3ZHZA 5G0TA 3VZRA 4MP6A 5A03A 3ZU3A 4DPKA 1F17A 3Q11A 1NR1A 3KXDA 1E3IA 3JQ7A 4QEDA 4AG3A 3DZHA 3S55A 5DF1A 5AOVA 1V8BA 5CDYA 1WDKA 1GPDG 4JN6B 1M6WA 1T24A 3RD5A 3G17A 1SCUA 1LDMA 4OAQA 5BT9A 1DC5A 3ADOA 4P4NA 3TOZA 1F8GA 1R0SA 1P0FA 1MG0A 4H16A 1DJNA 2Z1MA 2ZCVA 4HY3A 1ISJA 1BXZA 1E92A 2Y1OA 1K6IA 1JTVA 1WLYA 1ZEMA 2GZ1A 3K2EA 3KYCB 4M55A 3RSHA 2TMDA 3IS3A 4BO8A 4BNKA 2G0TA 1A27A 3NTOA 1Y8RB 4IIVA 4NIMA 2IZ1A 3JQCA 3P19A 1TT5B 2FHSA 3IP1A 4QO8A 2C20A 2J3JA 1R6DA 1W73A 1QV6A 1JLLA 1QYXA 3JQDA 3JD1A 5DBFA 4R01A 1EZ4A 3PWKA 3ONDA 2VRCD 1DC3A 4E30A 5U1PA 5CPFA 5EINA 1ISHA 1TI7A 3UCXA 4R1TA 3VDRA 4E5PA 2P5YA 1FDSA 4ND4A 3GN1A 3JQ9A 4IDFA 4E12A 2OXIA 1UP7A 3H2SA 3U0BA 4Y98A 4CM8A 3OHSX 3PDUA 3QVOA 4TMFA 4UVIA 4CLDA 4DQXA 4CV2A 3S2IA 1B15A 2ZTMA 1ENYA 4R68A 3WJ7A 4ZD6A 1RM3A 3EW7A 5CDSA 1YGYA 3MZ0A 4NFYA 2ZK7A 2NLOA 4BKRA 3TJRA 3PGXA 3TPCA 4CUZA 3KSDO 5GY7A 1VJTA 1IULA 3PWSA 1R4NA 4YJHB 3C1AA 4BIIA 2HMWA 4WOKA 5JBIA 3LDHA 5KIAA 4DL9A 4IPTA 3DFZA 3TOXA 3DMTA 3KYCA 1HYEA 3NGLA 3DBLB 2P9EA 4U6QA 5IDXA 4RVFA 1U4OA 2Y1EA 3S8MA 2ZYDA 4B4UA 1RM4A 3WIDA 1W8DA 1K89A 2DU8A 1ONNA 2I65A 3OP4A 1QG6A 2GGSA 4EUHA 1V0JA 3C24A 4YT2A 3W8DA 1N7HA 3RWBA 1R15A 1MGOA 2NUAA 2O2YA 4RPGA 1WW8A 2CMDA 2G5CA 2WDZA 2Q3EA 3B1FA 3RFTA 5LDHA 2H5LA 3LLVA 4I1IA 2H6EA 5ILGA 2DLDA 4L9RA 4TQGA 3I3OA 4RQUA 2IRWA 2B36A 2I67A 3N74A 5JY6A 1EFKA 1P9LA 3LT4A 1MXHA 3U4DA 1Y6JA 2FR8A 1YDEA 3NDJA 1U3UA 4PLHA 3ZWOA 1F0YA 3A4VA 2J5RA 2WMDA 1UAYA 2WYUA 4CUJA 3O38A 3RC9A 4F45A 1HWYA 1J0XO 1P0CA 3NGXA 4FDAA 5CHEA 2YQ4A 1MX3A 4A26A 1J6UA 1W4ZA 4MIOA 1GEGA 2ZQYA 1I01A 4QFDA 3DTTA 2IZZA 1U3WA 2JD2A 3MCVA 3R6DA 5TT1A 4BUCA 2POQX 5B4UA 1D7OA 2PGDA 4DC0A 3NTRA 2YDYA 1U3VA 2Y1CA 3KYDA 1P1IA 4JJFA 1ZBQA 2V6BA 5DULA 2OP1A 4GMGA 4E21A 3GDGA 3PI7A 4AJLA 4KTTE 2X9GA 1DIRA 1NPTO 2VUSA 3I52A 3NUGA 2C07A 2IXAA 4CMIA 1BSVA 2CUKA 5CDUA 4R51A 4ZVVA 3UUWA 2DQ4A 3LF2A 5T6BA 4PVCA 2H9IA 3F47A 5A9RA 1YB4A 4WCFB 4J43A 4W9NA 2EEZA 4IMPA 2V7PA 3RI3A 1O89A 3GUCA 4NU5A 2PKRA 5BSHA 4PLGA 2D4AA 1K2WA 4OGWA 1ZMOA 4QO7A 1B16A 1OFGA 1GAEO 1PQWA 4PG4A 3M2TA 4L75A 2ET6A 1E3WB 5L7YA 3JQFC 2DPHA 3H3JA 5COQA 3WYEA 5L9AA 5G0SA 1DEHA 4AJKA 2C5AA 5CPBA 2GLXA 3RFVA 4J9UE 2VHWA 1LSUA 4NJMA 4AFNA 5L53A 1HLPA 1U9JA 1Y7TA 4PLWA 1ADCA 3L4BC 4CV1A 4J9VA 4AJ4A 1WDLA 1PJBA 3GOHA 5HBRA 1V9LA 4LMPA 5F1OA 1KY5A 3TZHA 1XDWA 4KMSA 3L77A 1EMDA 4GWKA 4P4LA 2XOXA 3U49A 1MXFA 1SB9A 1C0PA 2E82A 2LDBA 3GVIA 4AJ1A 1SO8A 3H2ZA 3KYBA 4XQ9A 5JAMA 3WFJA 1PJTA 2DAPA 5T8KC 4OQYA 2NWQA 2GN8A 2ILTA 3JD0A 4NMHA 4YJGB 3LU1A 2HMVA 3NAQA 3HQ4O 1T1SA 1YJQA 1NXQA 1Y8QB 4K6FA 4L8VA 2NACA 1I32A 1C14A 4PRLA 2ZYGA 1T2DA 2PTGA 3DL2A 3GG2A 3EDMA 1ZSYA 1KBZA 4HUJA 2O4UX 2PD4A 3B1KA 3RUIA 3AOEA 3ANMA 1XHLA 3QVWA 1QYWA 3RROA 4HXYA 5KJFA 4JNKA 5L4LA 4BO0A 1UXHA 1E7RA 3UFXA 5JE8A 3AJRA 3GDOA 2VUTA 3PHJA 1DPGA 1ADBA 1HE3A 1QMGA 3WSVA 4LMRA 1GADO 5K6AC 2JFHA 2Y0EA 3AFNA 3GN2A 5BSFA 3BTOA 3WGHA 2HMSA 4A10A 4DQUA 1FDWA 2BH9A 5TLSA 2ZQZA 1ISFA 2HMUA 2C2XA 5C7IO 1DLJA 2QYSA 1GQQA 3TZCA 3ZW9A 1ZFNA 1LLUA 2BMAA 1KIFA 4YAKA 5KJ6A 1LLQA 5CDGA 3MJSA 2VHYA 5C7LO 1PU2A 3I9KA 4DYDA 5A5EA 2YY7A 2J3KA 1FXSA 4L4SA 3WQRA 1B14A 3NDIA 4N5NA 1SBYA 2JHFA 1HT0A 4IQGA 4YJDA 4RZIA 4FPXA 4IQ0A 3AOEC 3UOGA 2B69A 3LYLA 1DHRA 4KOAA 2HLPA 1HXHA 2OZPA 1XELA 4BVAA 4JCOA 3OSUA 3PHGA 3DOJA 4WECA 4CMKA 1A5ZA 1MC5A 3ZWAA 3IIEA 4XRRA 3GGOA 3V1TC 3WGYA 3AFMA 1N2SA 5JY1A 1XYGA 3CMCO 3KO8A 4CMCA 3WR5A 1Y5RA 1SMKA 1UH5A 2DTDA 3EMKA 4RZHA 3RUEA 4LW8A 3T7CA 4BV9A 1IL0A 1MB4A 3PLNA 1YQGA 1H0KA 4JBIA 3E9NA 1N8KA 1YB5A 2X0RA 5K0ZA 1NX6A 4Z9XA 1Z75A 4GX0A 3AM5A 4ZJUA 1JAYA 4NU6A 4GGOA 4CQMD 2PH5A 1YQDA 4Z3DA 1J5PA 4IS3A 3WGTA 4EBFA 1P1RA 1NFRA 4PCVA 1PS9A 3WS7A 1N5DA 2X0NA 1OC4A 1FDVA 3CUKA 4GGPA 4MVJG 5JCXA 1U8XX 1VKNA 4L73A 1LC0A 2NU9A 3GZNA 1HE2A 1DBVO 4AJIA 1XU9A 4Z0TA 4B8WA 1U2GA 3PVZA 3ZNPA 5F1KA 1J4AA 4FS3A 2PZJA 3WGQA 1NWHA 4IQ8A 4DIOA 2X5KO 3W8EA 3M2PA 1E6WA 3LC2O 5KVCA 3FR8A 5CEFA 2XXJA 3S1LA 4TSKA 1R4MA 1IB6A 5IZCC 1UJMA 2EW8A 3SEFA 5KWEA 4B4WA 2I5PO 3JQ8A 5GMOA 3INRA 4I5GA 3T7EA 3B20A 1IZ0A 5ER9A 1ULUA 2PZLA 2QYTA 2Y93A 2VHXA 4OL9A 2DKNA 5I7EA 3JQ8B 1V6AA 4B3IA 1NPYA 3EHEA 2CVZA 4OKIA 4NNJA 4UVEA 3ZHXA 4W99A 1X13A 4S3MA 4EGFA 2VYVA 1RJWA 5I9LA 4NPCA 2GERA 3STHA 4D3DA 3PDJA 1WNTA 1E3SA 2ZKLA 3ICCA 5L3ZA 3W8FA 4WCFA 5H83A 2CDBA 3CKYA 3WICA 1Y81A 1PS0A 2EW2A 2PGJA 3GA0A 3R3JA 2X8LA 4RPHA 3C7AA 5LCXA 5JCJA 3IL2A 5A06A 3I83A 4PLPA 2JCYA 1BW9A 1M75A 5DCWA 2GUGA 3DC2A 4GVLA 1ZIDA 1N1GA 2B83A 3PHHA 3TF5A 1TB4A 1B0AA 5BNIA 3BIOA 4GX5A 2VWGA 5G4LA 2P68A 4P8RA 1YBVA 2WWRA 4RV9A 2QHXA 3PWZA 3PFWO 1CEQA 3DAFA 1A7KA 3I9NA 4CQMB 3GAZA 1BTOA 1W0CA 3PQEA 3RBVA 3H9UA 2B4QA 2O3TA 1H2HA 2W2LA 2BELA 4XR4A 3EAGA 1O6ZA 1LDEA 4WNIA 3U09A 5CDTA 1DRVA 3GVPA 4BNNA 3GHYA 4DBVO 4EW6A 3EZYA 1ZMTA 3JQGA 1BHSA 3I9JA 4FOSA 2IYPA 3GVCA 2A9FA 3JCZA 4CMEC 4D0RA 4DPLA 3PP8A 4CMEA 1LX6A 4E4YA 3H9JA 2O7SA 1BVRA 4M89A 1LLCA 3UVEA 4FR5A 3ONEA 5AXAA 3WG9A 3T4XA 4MIYA 3OJEA 1K3TA 5JNLA 4Q3NA 3NJ4A 2O3RA 2Q45A 1LDGA 5TJ9A 5DP1A 3GVXA 3NT4A 2O7QA 4CQLB 3AUAA 3CPSA 3JQBC 3QE3A 3I4CA 3GK3A 4NBRA 2QZ9A 4R1NA 5A9SB 4GPD1 4FSHA 3IMFA 4RF3A 4ZQEA 3E03A 1X15A 2XAAA 4G2NA 3INGA 3VKUA 4ALNA 2ZTLA 4MVJE 3DONA 1O0SA 2HK9A 2FP4A 1HZZA 2AG8A 3OIDA 2BI8A 4WLUA 2Q2QA 4FCCA 3ZWNA 5IF3A 1NM5A 2H1SA 2P5UA 1E6EA 1R4NB 3MOIA 4JQCA 1QR6A 2VWHA 5JDCA 2I9PA 4JP3A 5ADHA 2JFGA 3L9XA 4D44A 4D41A 1C1DB 2DPGA 2X58A 3MJ4A 1E6UA 1G0OA 5B37A 5G0WA 3RBXA 3FNHA 4GSKA 1P1KA 3LT2A 1EQ2A 1G0NA 3L4SO 3PEFA 1DLIA 1E77A 1LXCA 1R37A 3K96A 4UEKA 3BMCB 3GC6A 1IPFA 4TRNA 1HKUA 2OUIA 1CDOA 2A94A 1AN9A 3IC5A 1QLJA 2Y1FA 1CF2O 1EVYA 4FIZA 4OOEA 4XB1A 1MLDA 2D8AA 2QX7A 1R12A 2GR9A 3P2YA 3ZWBA 3U9LA 3OJLA 3S2GA 3ZWXA 1A4UA 3OMLA 3QIVA 3OF2A 3PQDA 3QRWA 3E18A 3EK2A 5C7OO 5KVSA 1LDBA 4WCDA 1WPQA 4G65A 1UXIA 3RU7A 1NWCA 2YUTA 5AXBA 4EITA 1PZEA 4Y67A 3PJFA 4XEHA 4FJ2A 1JN0A 5EESA 1EVZA 4EJ6A 1I3NA 3ANLA 4YA6A 3GLQA 1PJ4A 3W4IA 2PLAA 2TMGA 5IZCA 1E1MA 4RLHA 1WAMA 2VN8A 3OIGA 4ND3A 1ISMA 1I2CA 4JJIA 4HV4A 1DIAA 1I0ZA 2AG5A 3PIDA 4HWKA 1GUZA 3FPLA 2FRDA 2D5AA 4XIJA 4IDEA 4XYBA 2FPIA 2UVDA 3WDSA 1D3AA 4J7CA 3QWHA 3DBLA 4HFJA 1DAOA 2HCTA 1ID1A 4ZRMA 4CM9A 4W4TA 5A4DA 4O5OA 4BNHA 3JSAA 2ZIZA 5T5QA 5KVVA 5B12A 4IJWA 4WJZA 3UKOA 4BNUA 3JYOA 1U7TA 1Q2XA 5TS3A 1Q0LA 4DYVA 4FC7A 3LC7O 5GZ1A 3H9EO 2OHXA 2C54A 1DIBA 4R1SA 4CM9D 2GYYA 5JC1A 1XKQA 2J8ZA 3W6UA 1O8CA 2RH8A 5ER6A 3FN4A 3FTPA 5CG1A 2O23A 1LRLA 5A5FA 4R5MA 1LQUA 1D1SA 1HRDA 4YPOA 4R69A 4XR9A 2AE1A 3PHIA 4MKRA 3HHPA 4BO6A 3HG7A 1SEVA 1I30A 1LLDA 1I33A 3CINA 3DHYA 4JJGA 2RHRA 4TVOA 1PTJA 4OH1A 3I1JA 4CM5A 2IXBA 2WSBA 1PL6A 2NVUB 3QSGA 5F21A 1EK6A 1KVSA 4NBUA 1CYDA 1UDBA 1M2WA 1X1EA 3WTCA 4NFSA 4BB6A 2BF7A 4FFPA 2W8ZA 4BB5A 4OO3A 5JS6A 4INAA 4GH5A 2ZJ1A 4PFJA 4E6PA 3TNLA 4B7UA 2NQTA 5TNXA 4Y6SA 3AU9A 3ZV4A 1GU7A 4N7RA 2X4GA 3SBOA 4ZGWA 3K30A 1Z82A 5T57A 2YW9A 5COAA 1YL6A 1ONOA 4XZ3A 2VTDA 3DEYX 2AHRA 3ITKA 4L74A 2QRKA 3WXBA 3QWBA 4CL3A 2WD8A 2EP5A 3JD2A 3AY7A 4IJUA 1QXSA 3SC4A 2PR2A 4ALIA 4WOJA 4GKBA 2RAFA 4CM6A 4XX0A 4A73A 5K9ZA 4EDFA 3ON5A 1IZ9A 3NT5A 3RFXA 3OECA 1YO6A 3CZRA 4RVDA 4MOWA 4PZEA 3WWZA 3TRIA 4CQMA 4OIMA 3GUYA 4PVDA 1ZK2A 3TL3A 4X54A 2YHIA 4RJTA 2JCXA 4U0KA 5A1TA 3DWFA 1XGKA 1R4MB 2JCVA 3W6ZA 4L4RA 1YL7A 3ETEA
chains in the Genus database with same CATH superfamily
1QGDA 1RWOA 3QWAA 2VYVD 2G1AA 5AIBA 4BYMA 1N1EA 4H3HB 2MOKA 4TWZA 1MFPA 3C8ZA 2BJVA 2FSPA 2Q50A 1MBZA 1QS0B 4DLRA 1LA2A 3TGWA 4MV9A 1V45E 2ZUVA 4DCNA 3NHWA 4EL5A 4DR6B 4YRRA 1P2GA 4L0DA 3GJSA 3S3TA 2NVOA 4FMPA 2ZE6A 4D43A 2G6BA 1G2IA 1FP4B 4H3KB 2DC1A 3L84A 3UZUA 3FKSA 3ZE7A 4DJDC 4F4HA 1T36B 2VC2B 3NG1A 2WWIA 1QJ4A 1UP6A 1IIRA 1L9XA 1P7PA 3U7QB 4N8SA 1P7ZA 1S02A 4XH9B 2AFHB 4ITRC 2QX4A 3IEVA 3NXSA 4EEXA 2WF5A 4EYQA 4AP5A 1A8IA 4JYBA 6PFKA 4IIYA 3UICA 4XD2A 4DSNA 3RIYA 2YL2A 3GUHA 1YR8A 6ADHA 3GFTA 5B1SA 2GDZA 3LZDA 2A9JA 3BHIA 4K6OA 3UAYA 5IC4A 1B23P 3ZZNA 1UBRS 1SZJG 3EDCA 4KGVA 4UMEA 3N9IA 2FPSA 1IVYA 5F78A 2PDAA 3E7FA 1JT9A 5AK5A 3TIFA 2PLRA 2WT9A 3MT8A 3Q3CA 2E89A 3HV2A 3MMSA 2NZVG 4WZAB 2K7FA 5B53A 4AZ0A 2I1WA 3AESB 1PJ3A 1A0OA 4TYMA 5JAOA 3PGJA 3U3KA 1E3TA 1PD0A 1XR3A 2JFQA 1T10A 4Z8YA 2QPAA 2RONA 2QAGC 3BCHA 4KNVA 3AHCA 4MK4A 4A2QA 5B7GA 5JMWA 3WL4A 2ZDGA 3DFIA 1JWBB 4M0PA 4DLXA 3DBOB 5HS4A 3HC7A 3RJ5A 4ILKA 1H8HA 3JQAD 3OCZA 1U2RA 2Q0SA 2ZPUA 1DKNA 1C0KA 4KQHA 1Z26A 3FMVA 3RBZA 1IPEA 3AHHA 3EMDA 4MEAA 4QARA 4EF6A 2D0DA 5CTAA 4US1R 2ZWIA 3HB9A 2ZIUB 3W5SA 3FMPB 3TMKA 8AT1A 3W05A 5DLYA 4B6EA 4FN4A 2FW1A 4WKBA 5TQJA 2DUJA 2BEJA 2FN7A 3DMGA 3O1IC 2L0XA 5LYJB 2H51A 3OCVA 2ONJA 3ABQB 1ZOIA 3USES 2AEMA 2BGMA 3E9MA 5A4FS 1JG3A 1PZGA 3QVTA 4PQGA 4GECA 2JGDA 5FQOA 3NHRA 3A3NA 3H6KA 3A2MA 2K5UA 3NC4A 3AP2A 5FUYA 3SU8A 4HAXA 5C1OA 5T4HA 3A1SA 5A9TA 1JJBA 5FR2A 1AV7A 1RZRD 4URYR 2NV6A 4GO1A 2W8BB 4PCAA 2XMQA 4Q39A 4XQGA 3I6IA 1OAOC 2HA6A 2HJHA 5T41A 5B64A 1QH8B 5A2QA 1N6IA 3CN9A 1EDBA 1W29A 2PQMA 1ZKMA 2RGDA 3HL4A 4ZYYA 2GHIA 4LZLA 2VAMA 2XHEA 2ENUA 4EQ6A 4MPTA 4TVBA 4ZZ0A 3TNYA 3TWOA 3NYQA 3ZBQA 4M7OA 2GRAA 3IUNA 1MOPA 3UAVA 1I5RA 2EKLA 1J2UA 1H4TA 1ZISA 3OFSA 1H66A 1QYVA 5AOCA 4Q19A 3LQYA 2ZM6B 2YJGA 2YYYA 1SXPA 5CM9C 3DFUA 2H5IA 4O4HA 1M1YA 3VAYA 2Q5CA 3PEYA 3E6AA 4LUCA 5U4XA 4HUTA 4ZEWA 2C92A 4P22A 3I6MA 5DIFA 4BMCA 4EK9A 2GN6A 2UUBB 2B34A 2VJNA 3FWZA 4FZ5A 3ZGVA 4OSOA 4CMAA 3L5OA 4MGIR 4ZO7A 5AOAA 4B2YA 1DQNA 4LWQA 1ENZA 4MDFA 2ZIGA 4CEIB 3BXXA 1XAHA 4AX8A 1CJVC 1GSHA 3FDIA 4UTPA 3FZEA 4ZP1A 1L5OA 1RWBA 4R84A 3GJRA 4HEHA 3W3ZB 3ZU2A 2OWDA 1MX9A 5IAGA 2NXNA 2AOXA 3CUVA 1QSGA 3KVRA 2GJAA 2ZYSA 4O2AF 1R9NA 2OV8A 5JSZA 1XXHE 1YB2A 3REOA 3VNRA 5AI8A 5DI3A 1VB5A 2GB4A 1CUDA 2NXJA 2Q29A 2XNKA 1WHTB 1UBOS 2J4DA 1PJRA 4GX1A 4NWIA 4ZAFA 4Y1EA 5LWHA 3HJAA 2X3YA 2BP7B 1ZK4A 4BNJA 1PR5A 1Y3IA 4M83A 1M2NA 2AFVA 3PVSA 2Y0BA 1RI2A 4PGFA 3WGJA 5HQ3A 2QZZA 5CG2A 2UZ3A 1RXCA 1Y6FA 1R88A 1LW7A 3E2PA 3KC2A 3Q6IA 1AG9A 4LNAA 4YQFA 3L0DA 2R4QA 5HZHA 3D9QX 5DRTA 1SUCA 4F4CA 1E3DA 2ZI6A 1AS2A 1E9FA 5IARA 1JA9A 1UBFA 2BFCB 2CLIB 2VXBA 3OEYA 1H1DA 1RBQA 3BGDA 2D0IA 5TRTA 4IRUB 3WLEA 3IMGA 3BEDA 5DNAA 5C34B 3TH5A 3SYLA 3SJ7A 3CNHA 2J08A 1BYUA 5T4FA 5C4IA 4JB8A 5LLDA 1ESZA 4AS2A 2O2SA 4UEJA 1GTRA 2EERA 3DV2A 4AK9A 3L6EA 3EBLA 3ROMA 1CRQA 4POOA 3HN2A 1GZ7A 4PWYA 2ZRHA 1GGNA 2GWHA 5GONA 2BBTA 1ZVJA 3CNEA 4NH0A 4C7BA 4EGSA 2WWVD 4I66A 1X8XA 4OQLA 4P36A 3EA4A 2IK8A 3FXAA 3T3OA 3H75A 1WM1A 3ST7A 5T3UA 1X7GA 2O4CA 4YV0A 1DIHA 1IY9A 4H4EA 3Q0TA 4DBVO 1IHXA 1XSEA 3QFTA 4ROSA 1KO8A 4C7KA 4EG5A 3ERCA 2VT2A 3BMXA 1KO5A 4PSUA 2BGTA 4TM8A 5CK5A 4M8KA 1E0DA 2Y1WA 2NYVA 3R40A 4UEOA 4DRZA 5TPZA 2OXEA 3KD2A 2ANCA 3QMWA 4FOPA 1IRIA 3EXHA 4II3A 4QFCA 3SF0A 2XVZA 4IDAA 2NPFA 1X74A 1ISGA 3BK1A 3CPJB 3CJQA 1GV1A 4HB4A 5CB4F 3ENVA 2G88A 3PQ2A 4WKNA 3KB8A 4K6KA 4F1KA 2DFPA 2B0JA 2V6FA 3I1FA 5F2OA 2YXLA 5L3QB 1UM9B 5HRCA 5FBHA 4IJVA 4YRBA 3KL4A 4YDHB 3ZU5A 3FBGA 1L7DA 3I4FA 1UC8A 2VDKB 3SIXA 4D57A 3G2KA 2NAFA 4G01B 4D3SA 5GOZA 2NU9B 1T0PA 3EDYA 2GD0A 1JE1A 1I9CA 1VE1A 3IEXA 2VBGA 4B3RB 4CU5A 3A9WA 4UZEA 5B3LA 1AZSC 1YK1A 4ZHSA 2BRUC 5KQSA 4PYIA 1U2TA 1YFKA 4U2CA 1C9DB 5DE3A 5C31A 2X1MA 3K2QA 2PD6A 5FYDA 3TSZA 2B37A 4BQRA 2I9KA 4Q4AA 2FQYA 3HVUA 4Q01A 2H92A 4F2HA 3AHFA 4UD6A 3GQVA 2SCUA 2YY5A 1SC6A 5FLYA 5JZOA 3CZMA 1PEDA 1PNRA 1CQPA 1PT5A 2OAGA 2KQUA 4E3WA 3R5FA 1SBCA 4N4AA 5EIHA 4GRDA 1IU9A 4HP8A 3ZDYB 1BJKA 5EJFA 1VCHA 3NM5A 2ATEA 1J21A 2P8SA 3LBYA 3NLLA 3H86A 4PS1A 2V7GA 4WASA 1Q20A 1E2IA 1WU8A 3IQEA 3KU1A 4D4MA 1M74A 4QRIA 3OQNA 2FWMX 1A2OA 3PK0A 3OFND 2BGWA 3R0IA 1Z3CA 3SHOA 1AQJA 1NLZA 4AICA 2GDJA 4Q3BA 3KUUA 1ST2A 3V1MA 1RKBA 4P0PB 5JSQA 4G23A 3RVOA 2AXEA 3EXFA 1IK4A 1KERA 5EKDA 4EY8A 5DHAA 3V8QA 1M66A 3V7WA 1T0HB 3NV7A 5AJYA 1NJFA 1WD5A 2E4VA 2QOEA 5C5IA 2D8MA 1N75A 4IH9A 4U8GA 1A1SA 1JDUA 1FRZA 3D1LA 2M6LA 1DJLA 4RK5A 3RTGA 3W34A 1VSVA 4DWOA 5C8YB 4YLGA 3DTVB 3O1JC 4RAQA 1T0JB 2EZUA 1W35A 3AVQA 5K3FA 5HKBA 3UANA 1VGVA 3WNBA 3NHJA 4GEKA 2GNPA 3TPFA 3D7RA 1EFDN 1QYDA 2JAOA 3T1VA 1HTBA 5KCMA 3BWXA 3L07A 3QPAA 2H4FA 1JWLA 3FDFA 1OI2A 3GFRA 1HQCA 1VHWA 3CXRA 4M4SA 1HSZA 1GPJA 3A6JA 4GLOA 1Q2UA 1M8JA 1OBFO 1PFKA 4C07A 2W2OA 5FEUA 1NVMB 3ZG6A 1ZOLA 3CTPA 1NAIA 1HQDA 4JFRA 2G8LA 4NECA 1H0HA 3UAGA 3MFQA 1IZ7A 3TTXA 5BPFA 5EP2A 1TKCA 4F4IA 4FEYA 5A4IS 1BGWA 5EGSA 1DKRA 1C3VA 1H9AA 4Y8VA 4PZZA 3PIIA 1A8QA 4KPEC 1JDPA 2QGNA 5HM8A 1Q7RA 4C88A 1FFSA 5AW0A 3IDSA 2JCGA 4ND8B 3S2FA 3LS2A 4MV1A 4ZO4A 4H7PA 1EP9A 2DR2A 1J49A 3ED1A 1JKIA 1L7VC 2JGEA 2QTBA 2B25A 3D7MA 4IIFA 3NIWA 3MTEA 4C43A 5IBQA 5BMVA 3U4QA 3F98A 4E70A 1DZ3A 2Z83A 4NAVA 2W11A 3F6CA 3IHKA 4TWIA 1HQKA 3PQ4A 3QF4A 4Z7QB 2CNWA 4RE5A 4RF2A 1PJ2A 1E79A 5C37A 5DTIA 3P2OA 1VLHA 1QRDA 2B78A 2ISSD 2GFQA 3ILXA 4BNZA 1PJSA 1LBEA 2WVGA 3PRJA 4FC6A 4DV7B 2O3JA 3TSCA 1JQ5A 5MF6A 2DLCX 1QNLA 2XWJI 4GQAA 4MW6A 1BQ3A 4P98A 1Z7YA 4XIYA 2FEOA 2Y1GA 3SQLA 3W3AA 4TL9A 1U31A 3IP9A 4ND2A 3VSEA 2YJ4A 4ARUA 1M34B 1FDRA 2FZEA 4P4UA 1CWUA 2CL5A 1NQTA 5J5VA 3FMFA 1C4OA 3RDPA 3WADA 1KR5A 2PZ8A 5IABA 3K5PA 2IYOA 3GL9A 1XRLA 1JEEA 3H1AA 3IEIA 4LVCA 5GONB 3FVRA 1YI8A 3DXYA 1OZFA 3JQPA 4RV5A 4I55B 1XRNA 2JRLA 2G7ZA 3ABSB 4OJTA 4QGGA 2ZZKA 3SFVA 3SYMA 3R5SA 1SN7A 1SU7A 5B55A 1V26A 1GL7A 4WMLA 4G1EB 3H87A 2YNMC 5I01A 3A14A 3AUJB 4RH1A 3ZHQA 1L8LA 1SRQA 2HAEA 1UZUA 2ZCUA 3K9BA 4PX9A 3HV0A 5IM5A 1WJGA 4E5VA 3I5YA 2WZQA 2Z5FA 3NP7A 4LY9A 3NXKA 3VSCA 4QRHA 1V8OA 3IIIA 4R0NA 4WESB 3LXMA 4XASA 2HXSA 1GKLA 3J7TA 3VNQA 4BO4A 1A69A 1ZN8A 2P2SA 3A3YA 4MUMA 5GZ6A 1ZOPA 4W7IA 1HYHA 5AHOA 2XWSA 2PKQP 1CR6A 3MCZA 4Q47A 5C5DA 2GOYA 2P4EA 4NMXB 3BX1A 2P9JA 1GTVA 1QLHA 2UZAA 4M1YA 4TWBA 1VBFA 3V46A 5I6DA 1HORA 1WVIA 3QXSA 2BKVA 3V2HA 1P4AA 1TVKB 1YH3A 1ZD5A 2JH3A 5AM0A 4FNOA 1PQPA 2QN7A 3TBKA 5K3AA 5AM3A 3GJ3A 2DWPA 4NK4A 1U28A 2Q7XA 4ETIA 5ADWA 4E2FA 5IZ4A 2RGXA 1G7TA 5J23A 4MVJI 3ABIA 2XIJA 3SDBA 4GX2A 3DBRB 1Q1EA 4OGLA 1ZZEA 2BWJA 3ETLA 3IHWA 3EWNA 3LC1O 5EJ6A 4RIGA 2HCRA 3DT8A 1FBNA 4ZOLA 1TD1A 4U2FA 3W4JA 3WWDA 3CVUA 2ZDHA 2C5LA 2VRCA 4OB6A 2JCSA 1QBKC 2GI4A 2RBGA 1SA0B 4MQ6A 4TRRA 4TVKA 2P9FA 2R6AA 1JLRA 4CLOB 3Q7QA 5EIFA 1SR8A 3DZIA 4GI1A 1VI6A 4WOCA 3AUYA 4H0CA 3X1MA 4L4XA 1B2RA 3QYFA 3UV6A 2GKSA 4BLVA 2FOXA 4AYXA 4A6PA 1E2UA 1NC1A 3DKVA 4PHGA 3LT1A 4R8LA 4YXWA 4MCHA 2CL7X 3A4TA 3O26A 5LZ2A 5HP4A 2DJIA 1DKQA 3EIQA 3WLNA 5E3HA 5DNUA 1KI7A 7MHTA 3B89A 5H02A 1ZJZA 2DCUA 2XMZA 1CDZA 3N05A 1J0DA 3O4GA 2HDWA 3I0ZA 2I4LA 4QAQA 5IDVA 4GBGA 5C1BA 1AGPA 1AMUA 2FZWA 2IGTA 1YVPA 1GSAA 4PTLA 2QTWB 3GEGA 4EYOA 4M1ZA 4EA6A 1WUIS 1UPTA 5CVUA 1EXDA 1YS9A 2L18A 2QKYA 5EIAA 1LUAA 1I7LA 4RMGA 4AKSA 4JI6B 3NZEA 2PYIA 3AEQB 2GFIA 2A0FA 1UQUA 3AR3A 3QELB 4A1OA 1Z4IA 3GZTB 2IBSA 5CYOA 2PMWB 4GZ3A 3I01M 1FRFS 4UHCA 5GOTA 3KQLA 4YECA 3WLIA 1XWFA 1FJGB 1X8JA 2J6CA 1BROA 1JPVA 4NCAA 1HDEA 1RADA 4NICA 4RD0A 1TLTA 2R86A 2QN2A 3AEQA 3QPBA 5DYIA 4B7CA 5KTOA 4XRGA 1Z3IX 5E2AA 4BTVA 2A7QA 4BGVA 2N42A 2B0CA 5A4MS 2IHUA 5HCUA 5HM6A 1F2UA 3EC1A 4CT0A 4PN7A 4ALLA 3TE6A 3P2MA 5E6SB 1OH6A 2HRRA 4DLAA 1MTOA 3KSRA 2K87A 2QP9X 3WRYC 5CBPB 5JMTA 4F2PA 5C18A 2GCOB 3ORYA 2ECFA 1VCNA 3C7TA 4F2WA 5K0GA 3BICA 3G1WA 1UFOA 1IH8A 1T5LA 1C81A 3JZDA 1NXTA 3VOBA 2EJWA 1ABEA 1GVNB 4BFYA 2Z5LA 2YH2A 1PQ4A 1NVDA 2D62A 1SWWA 3NYWA 2DG2A 3RYCA 1IE3A 1EH5A 3LAWA 5K7SA 3CKKA 5EL0A 4DA9A 4Z54A 1F06A 1Z5UA 1SC1A 1ZJ6A 2WINI 2WTXA 2NNWB 2PEYA 1E1YA 1B2LA 1PW7A 4JGGA 2IA5A 3MHTA 2PN1A 3EE6A 3WHPA 4AP9A 1AH2A 2VO1A 1GV0A 3T7RA 3B2EA 5ALYA 1M2VB 1XJCA 2ZE7A 5FPPA 2XB6A 3TDMA 4Z7OB 2VOEA 1K3UB 5LDGA 2O5RA 1G55A 2VT6A 3D0QA 1Z6AA 4P4GA 1SCAA 2AFHA 3NTXA 1G1MA 5ALHA 5IFLA 2YASA 5JW6A 2O8VA 5BMVF 3W7VA 1Q44A 2XZLA 3PFKA 2WAOA 1C2TA 3PJGA 3O3CA 1RI3A 1W25A 2ACVA 4ZEOA 2W2TA 4B3BA 4CM8B 3ZGZA 2WZCA 4PQEA 1E7MA 1GTG1 2Y9YA 1S2GA 3ND6A 5AVWA 3ROZA 3UIEA 4KKXB 4IYRA 4E5YA 2W37A 3SHQA 3B5JA 3VZQA 1QQTA 1XZQA 3TQFA 3RHZA 2QZPA 1OREA 4F85A 1ZK3A 4MR7A 4FE3A 1X7HA 4BCBA 1CB0A 3N0WA 3IT3A 3MJEA 2VYNA 2Y67A 3QE0A 4K9DA 4URFA 1KE2A 1QIDA 1RM0A 4NBVA 5I8ZA 3TM4A 2I7TA 3DAHA 4PONA 4R9RA 4EHLA 1SG0A 1NLFA 1F38A 1OXXK 1A2BA 1TRKA 1V5EA 2PJDA 3IAM1 4FN5A 4IGFA 4PBRA 1AQIA 1U2DC 3LY8A 4F5WA 5JI2E 3U7FB 3IPYA 4D8VA 3ZCXA 4MWZA 2XNCA 1K7YA 5EXPA 4CLXA 4M54A 3O75A 5K2OA 2R00A 2AR7A 2O2DA 3ZOZA 4PM4A 1Y3BE 5JRZA 1SZCA 4Z9YA 1CY1A 4P5PA 4UHDA 4OIFA 1HV8A 1DJOA 1WIWA 3MWDB 4C4PA 3CTMA 4EABA 5LIRA 2ASVA 1QX3A 5IXSA 2H2DA 3F8WA 2OCLA 1R4AA 3B70A 1GCUA 5K3OA 2WKPA 4N1AA 1A97A 2X0JA 2H4HA 3D54D 4QHYA 2VQ3A 4C6SA 4D97A 1PVOA 4QUEA 5E95A 5DU2A 3AM4A 5HF9A 2YQZA 2PAAA 2H0QA 2JFNA 4K05A 3S4YA 4C0HA 3LYUA 2DUWA 1WULS 2I03A 3PIRA 5G0VA 3VYWA 1T9KA 4UTXA 4JQYA 4FDUA 1S8AA 2PSEA 4AWBA 2PJZA 5CXQA 3W2IA 2G63A 1VE3A 2EZTA 1JWAB 3HKDA 1E79D 4GHWA 2EDCA 1CW2B 2NIPA 3CM0A 4JLPA 1HDZA 3AKZA 1L9KA 2GO1A 3SXJA 5EEHA 2PLFA 1ORDA 4PO8A 4DNXA 1REQB 1FXUA 3OLWA 4RPKA 1Y9AA 1OXTA 3M1YA 2FMXA 4MUKA 2E18A 1T4BA 3RVLA 5J4HA 1Z35A 3FWKA 3MWLA 1X7XA 3LLUA 4C76A 1RRMA 1G6KA 5ESDA 1XZGA 4C04A 2QM0A 1RC1A 1DHTA 2YN0A 4ZKDA 3WK7A 1EX1A 4W82A 4LISA 2H48A 2ATXA 3F46A 4NARA 1XX6A 4HDSA 1OWNA 1USVA 3KEOA 3RTCA 5IK2D 3GY0A 3N8IA 4CYMA 4EPYA 1U1GA 4BS9A 3AY3A 4Z4HA 3ER9A 3ZI0A 2G07A 1INLA 1DOAA 5ALIA 4B46A 4N5IX 2HLHA 3U3JA 1R6VA 4E08A 3FPSA 5KJEA 3E9CA 1Y7PA 3PZRA 3K7EA 1L4NA 3MT7A 3GGCA 4CF5A 1DX9A 1IRXA 3CLTC 1NP3A 5L3RA 1WUTA 1G18A 2CJXA 4B75A 3PXBA 2DQKA 4IJ6A 4F7WA 4C9BA 2W2XA 3PUXA 4CM4A 2JI4A 2WUWE 4K86A 1Z6PA 1WF3A 1V7QA 3IH5A 4PS0A 3AI2A 4BMSA 4ZOQI 5JSZB 3DE4X 3HKBB 3CLSC 4WXMA 3U1VA 3UT5A 4CN8A 3MUEA 4FZ3A 1GTZA 4AN4A 2B9VA 1C8BA 2E3JA 1V37A 3DVAB 3QJGA 2BE7A 1PCXA 3MQFA 2BN4A 1EZZA 2ZU6A 4K9RA 1UWKA 5G4KB 4U2EA 1AS3A 5TMBA 1T35A 3V3KA 4BQSA 4WN9A 4FCTA 4DAEA 3AJEA 3AVWA 3NTQA 2XRYA 4IDHA 2C5FA 1TYDE 3OETA 2E0IA 3Q87B 1RAAA 1FU7A 4WA8A 2WBLC 4IDGA 4RPCA 1RDFA 4MHOA 2PR7A 4P84A 1FVFA 1LBSA 1XMXA 2PTHA 4QXPA 4L57A 4B6JA 3BWVA 5CW2A 4IUYA 5AWFC 1SXGA 2XF8A 2CF6A 4HYYA 2Z8XA 5HMLA 1PAUA 2EC5A 4BB0A 1OFUA 2PKEA 5JCPA 1T6BY 2VDWA 4DZRA 3ISVA 1BXGB 4E88A 3QNMA 2EQAA 2R2AA 4NE2A 2PFGA 5DTQA 1HX7A 3UMRA 2WHRA 4OMUA 1N7JA 2YFHA 4KWHA 4LVNA 4A03A 4WGGA 3IUJA 2WM9B 3GFBA 4ZT3A 3GLHE 1PGPA 5HEKA 4BX2A 4Z53A 4ZI3A 1YRAA 4ENRA 4ZHQB 3CVXA 4GDMA 1ZICA 4C4OA 3HB5X 1MJHA 3D4PA 4YMWA 1PX0A 1ZSVA 2QJOA 3AI1A 4KIJA 5F3RA 2VT3A 5CURA 4PIMA 2YICA 3KM0A 3H6HA 4IEFB 1IB0A 1R8JA 1GZHB 2Q99A 3S5JA 3UB4A 3ZUGA 4HWOA 1JTFA 5K0BA 2FPWA 3QX9A 4TL7A 2OXFA 2QQ5A 2QRMA 1PR3A 3NAGA 4QQRA 4L27A 5KOHA 3FJ1A 4JXJA 2ZZNA 2WTBA 4P4TA 3V34A 1ADGA 1E1NA 4CI9A 5JJBA 3Q3JB 1D2HA 5SZIA 4YT5A 3NBFA 5EC8A 2IYRA 3F5SA 4OHXA 1T25A 2HQOA 2VPXA 1UKZA 1DB3A 1OA0A 2GN9A 5IBPA 5C8ZA 1JJFA 5E7QA 5JJKA 2WD7A 3L92A 4BVFA 5CFPA 9GPBA 2PGXA 1ESMA 3LLMA 4URZR 5IAOA 1NJ6A 1SUFA 3DDNA 2BF4A 4HDMA 1KSGA 1QPZA 1QF7A 2BTQB 4ZYLA 5ICSA 1H6BA 4IXWA 2I3AA 1VPLA 2WIFA 3HCFA 3NHPA 4OB8A 2NPOA 2RGCA 4MVJA 1C1XB 1EK5A 1MQSA 3TTTA 4CIVA 4TQAA 2VTEA 3WX0A 4HG2A 1ZN9A 8MHTA 2JFVA 4GMDA 1EB9A 4J94A 5LIPA 3TX6A 1T15A 3UFXB 2V65A 3Q98A 3DPUA 1EX6A 3SZGA 3W5JA 5C8VA 3GFSA 3K72B 4X3OA 1BWSA 5ES3A 5KNBD 2J3EA 5GINE 1J00A 1M2HA 1L7EA 4KK3A 4J1NA 3CR8A 4DTCA 1FLNA 3RS0A 2E49A 3MTJA 3P4XA 3M1IA 3V3TA 2CV0A 4AL4A 3NEAA 4YLYA 2FZCA 4RSMA 4CTMA 1K98A 3ESBA 3WWCA 1GUDA 1KA9H 4LYJA 5DXFA 2QUIA 3I5AA 1NHGA 4DYHA 3RSGA 3EOBI 2WMOB 3IJ5A 5G40A 5CM2Z 3TLGB 2Q1TA 4RXMA 1G42A 5KC9A 3L01A 5HRUA 2VP9A 4TYPA 1SCIA 1GZDA 1JBKA 5GM1A 1UKVY 4LFAB 1ZC4A 4Y2XA 3AFOA 3HBMA 1X1DA 2RBEA 2RKBA 4JUBA 1XMIA 3O31A 4OKNA 1G8AA 1JQBA 4WAUA 5AUPB 3CLHA 3B8HA 4YAGA 2Y0DA 5LP6F 2JARA 4JVOA 4MHTA 3CH5A 3PXEA 1QOZA 4URXR 3A3PA 4XX0B 3AV0B 2AQ8A 3A2NA 3B51X 1MKYA 3CG0A 1SOAA 3IDOA 4KACA 4J0GA 3NIFB 2XTZA 2EHDA 5I7WA 2ISQA 3S1SA 2RHLA 5FBRB 4ZTZB 1L8AA 1Z6TA 4Q4CA 3BQNB 1M0WA 4NHOA 4UATA 2ZT5A 3UJBA 3D2CA 3UKJA 3X1XA 5KYWA 1HNWB 5MN6A 2XR1A 3LWNA 1DVRA 3R3UA 1IEQA 4LXGA 5FOQA 4M21A 4MP8A 2R1VB 5I4BA 2XUDA 5JD5A 3CRNA 2LCIA 3QVUA 4HDSB 2FZKA 5D3KA 4DRXB 2Q8PA 4TQUS 2XUQA 1E3WA 2WAYA 4RHTA 3COJA 1H2YA 3PF9A 3U4IA 2XB2A 4F3YA 1T5OA 5AK3A 3ROGA 5FADA 2EV9A 1QC5B 3GFGA 2OL4A 2P9HA 2SBTA 2XA2A 2FEXA 1D6JA 1JG6A 2YTZA 5K8VA 3ULKA 3G2OA 1OI4A 2Z57A 4MAMA 4B5LA 5CFNA 2D5CA 2N0SA 2Q2NA 2QZSA 4V03A 4AO8A 1B8UA 3THXA 4Q4LA 1CF9A 1HURA 3MIIA 5HRAA 3KT6A 4OQPA 5B1EA 3J81A 3MXOA 1EBFA 2B4RO 1KP9A 3ICVA 3DDZX 3PUZA 3VR0A 3IE0A 5C35A 3LO5A 1T4GA 2NZWA 2DHCA 4RGVA 1JEAA 1SKYE 5FWAA 3WQQA 1JIIA 1Y4SA 1T26A 3I1IA 2UYOA 3PX7A 5TVKA 3EBOA 2Z43A 5LD2C 2ZBEA 2QE7D 1P29A 1QRAA 1ZD1A 1ZI6A 2IGBA 2ZBDA 3KIPA 3OU6A 4OHPA 1OB2A 4X8OA 2OK7A 2YHBA 4PAQA 5ED4A 2ZYUX 2HDHA 1J1ZA 2NW6A 3SF8A 2KB0A 4I50A 1I4OA 4CT5A 4G56A 3MVEA 1NZFA 1WCIA 2OBYA 4KPGA 4ZO6A 5JANA 1JAIA 3L6DA 1YACA 3PITA 4EUEA 3WRXC 1P61B 4GI5A 4MPJA 7AT1A 4B3FX 5LQUA 1DCTA 4E7PA 1PL8A 3KHTA 3WRWA 2CBXA 4DA6A 2QIOA 3DWGA 1GRNA 5IS2A 1VXRA 3Q2IA 4XKJA 2A7XA 3CUSA 3DM5A 1YBAA 2JA2A 4YXFA 1VKZA 4LY3A 4FGWA 2QM8A 4H27A 4LX0A 3TN7A 4I9UA 3VQTA 2H08A 1NASA 2OPHA 3V00A 4YAEA 1TA4A 2IEZA 1IY8A 2WFMA 4WZAE 5HCNA 5TF4A 3SR3A 2NADA 2R8BA 5JXWA 3V1YA 5A3VA 1HDXA 4OATA 3C1TA 5AKIA 3ESYA 4L5YA 4EMTA 3PD7A 1KYWA 4GM4A 2PUAA 4X1YA 1C3LA 1FFGA 4COOA 4FFOA 4F4DA 4Z4QA 3Q7PA 1H5NA 1OFTA 3JYNA 1XBTA 2HXYA 3MJCA 3NHBA 4MQ5A 5EJIA 4KKVA 4HNUA 3GLFB 4CKCB 2F1RA 4GI2A 2HWUA 3ET4A 3M1AA 4G97A 2DGDA 3JWJA 2J09A 3P1JA 3VU9A 1CDDA 4YN3A 5BWLA 3UH1A 4GYYA 3MWJA 1QKKA 1B8NA 3QXHA 5BYJA 3S81A 1P4SA 2YRXA 1EVJA 1SB8A 4ER0A 4BIMA 1U63A 1QH9A 4YQYA 1QH1B 2O0LA 3VU9B 1DIGA 1DIOB 2I62A 2X9NA 5AJUA 4U8HA 3B5EA 3NHUA 3ZX4A 4Y6OA 3K9HA 5DM4A 2IXGA 4IW3B 2ZRCA 1UUFA 4IILA 4UVHA 2BE9A 3QTLA 4BKUA 3ASZA 3RUHA 1IJFA 1FRQA 4DV4B 2DBZA 4DR2B 1FFHA 3N39C 4X1IA 3HTXA 2A14A 1U5AA 2O8BB 5ALDA 4U7DA 4I1UA 3U3DA 4QNNA 3LVFO 1S2IA 2NG1A 3EZ6A 3FMGA 4EEZA 4Q1BA 1B8VA 2JATA 2ZWVA 4AJPA 4YHHB 2QRUA 1ZI8A 2KJQA 3I2GA 3WFZA 4A82A 3HR4A 3KOMA 2HU5A 4FINA 1JALA 4LYYA 3RTDA 3CSUA 3UPDA 3WMGA 1PJQA 1RBYA 1GZ6A 2A0KA 4AZ3A 5PGMA 4Z9FA 1ZEJA 4M9QA 1OLOA 3PD0A 3WB9A 2Q5JA 1YVEI 1U3TA 4PC3A 4TMTA 4R1LA 4TTAA 3CVWA 4D98A 4KDEA 3L93A 2NSDA 3I45A 5F76A 4LDPA 1QHYA 1ZXBA 5JAZA 2QROA 4GYWA 4F60A 1DS6A 4FS8A 4NC9A 4QM7A 3C39A 2COEA 4R3WA 8LDHA 4R2MA 2ZPTX 4AJJA 4RENA 3KAJA 3DD1A 3N2KB 2CV1A 5HQTA 3TKAA 3LA6A 4NZ9A 1D2GA 4KW7A 1IMOA 1GG8A 4XPIB 2J7PA 1OAKA 1UMKA 4ER3A 1UJNA 2FN9A 4MGYR 2GBLA 4BNYA 2I1LA 4XEUA 3ORFA 3PYLA 1Y63A 1JI0A 5F9HA 1XLUA 4KEAA 3DZBA 1EDOA 4L16A 2B4KA 2XX3A 3TLZA 1ABFA 3H9QA 1CPYA 3DL7A 2H9YA 1J8MF 2FPUA 2PX3A 1U94A 3DVSX 4RM2A 1LK7A 2TMYA 4TSRA 3H4IA 4GKAA 2HF2A 3DEJA 5AK4A 4D46A 4EUSA 2JG3A 4EKGA 2EJBA 2W2QA 4G41A 1T8PA 3BIXA 3EZNA 1Z28A 3BYZA 5FCDA 5FL3A 2A5FA 3PPXA 3HA3A 5D86A 1XZ8A 1E9DA 3HXOA 3PFBA 4GI7A 2G9ZA 2Q6OA 3E7DA 4NYIQ 3JZIA 2O1SA 4O4JB 1DRUA 4P08A 4BWGA 4BCDA 4KDFA 5KNBA 4P81A 1IC6A 5B2EA 1RI1A 4G8CA 2KLBA 4CM7A 1CUXA 3KZMA 4YT8A 4P2GA 5JJ5A 1VDZA 1HDRA 4E11A 2JFUA 3F3SA 3UTCA 3ZCVA 2XCIA 3X2FA 1O57A 1RJGA 3BA6A 4DY6A 4INJA 3SHTA 2C1EA 1WTAA 3A9SA 3CISA 1MW9X 5JQGF 1KZ9A 2YN2A 5KYKA 1H2RS 1TCAA 4UCWA 3FCXA 1YHZA 3MLBA 4GM1A 1BMDA 4BLPA 1QE0A 3N86A 1JLSA 2PT6A 2FW7A 2UAGA 3FVVA 3OTWA 3N8HA 2DBQA 1MG5A 1PTKA 1PIWA 4LBWA 3CZ9A 3O1LA 1U9CA 1JQDA 1TQ2A 3RLIA 3WYBA 5TX7A 4HPWA 3E3LA 4MR8B 5EGNA 1U7XA 3LGXA 2OFXA 3HZOA 4AWAA 2YVAA 3D3EA 4CMHA 1ZOOA 1BEEA 2P4SA 2CUZA 3DFFA 4JBHA 4OHUA 5LQAA 2QU8A 1SHKA 2RHTA 3B1JA 4LRSB 1I24A 1P1HA 1U5BB 2V6GA 4M1OA 4WFKA 1RE0A 1P33A 4YNBA 2W4QA 3S7TA 3SQMA 1PRYA 3B9RA 3UHOA 2OXTA 4ENWA 4D9BA 1IMJA 2XE8A 2MCFA 2ZB4A 4JBLA 1NY5A 4WACA 4UBIA 2Q5QA 2VZLA 1VIMA 2YDXA 4QUKA 5T4EA 1ZITA 1ZQ9A 5D7NA 4CETA 4RD3A 2WHPA 3HA5A 3N75A 4I5FA 4ENVA 3FD8A 5C80A 4QQKA 4KFUA 4Q1DA 4RMHA 5BV2P 3TDKA 1ZMXA 3DNPA 3DZ8A 2YIJA 2WABA 2XADA 3EVAA 3W5BA 4RF4A 3CEAA 2V4MA 1B8PA 2VHJA 4MX8A 3ESZA 1D2RA 2FMKA 3ZTTA 2XNDA 4DIKA 2ORWA 3LPNA 3ADCA 2MYUA 3CZPA 3O8NA 4U9HS 1SIUA 4Q3DA 2WY2D 2BEVB 3HLKA 1QONA 2X4IA 3H4VA 3IUSA 1RWKA 3MJVA 4U4AA 4S04A 1D2AA 1LV7A 1Q1ZA 1QF9A 1ULTA 2LCFA 2ZSUA 2FRVA 3AO0B 4R3UC 1G20E 4URHA 5FB3A 1KOLA 8ABPA 4RTPA 4PLZA 4AZWA 4OA5A 5B6IA 4QYIB 3K71B 2O0HA 5JJIA 4KIWA 5HA5A 1NBMD 4JI7B 1YHYA 3EEOA 3AI3A 4IOMA 5AJVB 4B83A 3GBVA 4CU2A 4Y0AA 3S70A 1GFIA 1H9CA 2XOKD 2XMDA 1I1HA 3F6YA 3L7IA 4M2LA 2F1KA 4CI0B 3PL5A 3H84A 3EH1A 9LDTA 5F3WB 4FOLA 2CJYA 5HUJA 4C3OB 1BE0A 4EHFA 4IY1A 5CVEA 1X3SA 2UDPA 5LZ5A 3V1KA 2B6NA 2UXCB 2B4YA 4GLFA 2XTMA 3BKXA 2OD2A 2C04A 2ZVPX 1F51E 4HXFB 5CDFE 3ZGLA 4FFMA 2OQVA 2PGLA 5JVDA 3FZYA 2DUUA 1SD5A 4JIGA 2A1UA 2AGVA 2Y8EA 3UT0A 1H6CA 3GPIA 3CVYA 4DV5B 5IDQA 9ABPA 1HDGO 5GV8A 2W6ZA 4LF9B 1M73E 4TXMA 5KKNB 1O97D 4PGGA 2WZDA 3IVAA 3KJEA 2XKJE 1PK9A 1T3GA 1UOOA 5E6UA 1L1FA 2OYRA 5CFQA 5IWAB 2UYCA 2QRZA 1YJ5A 1D8TA 2ZJ0A 3L06A 3QKWA 5EQTA 4F8JA 5FAKA 3LGSA 4XJSA 3H2GA 5HIMA 4N18A 4GFDA 3BIWA 2JAXA 2CB9A 1FVHA 1TCVA 3O7WA 1DKOA 2RARA 3MS2A 1XL1A 3CKLA 3LQFA 3QA9A 4PYKA 1T3LA 4A2PA 4C29A 4YRSA 2EX4A 2K2WA 1L5WA 3AM3A 2ZSJA 4JDUA 3P9QA 3ZY5A 1MQ9A 2NYUA 1P9WA 3AKEA 3GPDG 3EUEA 3VU0A 4QTXA 2YV4A 3ONFA 4ND6A 5A3RA 4DJTA 5ITWA 1E6MA 5LWQA 1QG4A 5E9WA 1T1JA 2JJYA 2VXOA 3MMPA 1K06A 1WRBA 3DWEX 1OI7A 2ZYVX 3I05A 5GVRA 3S1AA 3PYXA 4BNXA 1LQTA 1NOKA 1LRKA 2O1EA 4AVYA 1R10A 3MG9A 2GCPA 1U6KA 5THXA 3A0UA 4NCIA 5EMNA 1Y8AA 4L8YA 5JQGB 3EGCA 2QRPA 1PS8A 3H1TA 3VYSB 2PY6A 1UBUS 3BJMA 3O74A 1Z74A 2XKBA 3WYGA 1P80A 3MBIA 5A6SB 3KOOA 4X8LA 5JO9A 1KI4A 2VQEB 2CFTA 2WHXA 1X7XB 4LOLA 2BFMA 1EINA 4B6PA 2ZJOA 2ZUBA 2HPAA 1GQFA 2C4HA 5ITVA 4OP2A 1UFVA 1PZFA 2ADMA 1ORVA 2EF1A 3RVMA 2PBLA 3MCUA 2QNBA 4LHSA 1O54A 3P9IA 4F92B 2I1QA 1UMCA 2W43A 1GXSB 4QOGA 3HSSA 2QTLA 4JEHA 3V4OA 2H2GA 4CR7A 3DCYA 1QX4A 3ADPA 1LBHA 3MINA 4XVUA 4DV3B 4M0EA 2N9UA 3AEXA 2Q0HA 1ZUWA 3A6DA 1EJ6A 1YAJA 1KJZA 2X14A 4RKYA 2G1UA 2YC4C 3A10A 5G2OA 5HOQA 4INPA 3LUHA 3IEMA 3EGXB 3P52A 4D9FA 3RS3A 3N8GA 2BFPA 3TYXA 4DADA 5KKCA 1NKSA 1SRRA 2JJ2D 4HDNA 3OJFA 1I4EB 5KNDA 2OO5C 3GW8A 1KU6A 2OEPA 2ZS7A 4A8PA 1GL9B 1JAZA 1JFFB 1E20A 2R48A 3JRWA 4WK4B 1U2PA 1O7JA 3IMKA 1GTMA 4RF5A 3IEUA 2YWJA 5HIJA 5K3CA 4N9QA 2Z08A 4PPYA 3J7AC 1F8XA 1OX4A 3MUOA 4RCZA 1DTEA 3OY2A 3R41A 1MR3F 5EHNA 3SZMA 4F3RA 2J6HA 1UR5A 5JS7A 3WWYA 3UN1A 3RT1A 2BMEA 4TYYA 1YE8A 4I5IA 1GVHA 2HQRA 3R0JA 3HJGA 2YWXA 3QFFA 2FW6A 3HDQA 4GOOD 4RABA 1OX4B 1V35A 2ZSKA 3EYWA 4HLUC 5AK0A 5FUMA 2TRSB 3TNDA 4ESHA 5KYYA 2W2VA 4E5NA 4MW9A 4CKXA 1IWPB 3HI6A 4CDGA 3T7JA 3OWXA 5JBQA 5K0FA 5L40A 5DNYB 3USZA 2C2GA 4KGXA 1YS4A 4F3NA 3TG8A 1NUPA 4WGFA 2HFJA 4I4TB 5INTA 1J8DA 1TOAA 2QRJA 4FOOA 1U9ZA 2ID7A 3UJ7A 2BI4A 4ETNA 2H9AA 1DE0A 2DSTA 2NO1A 3ZDAA 2ADFA 2J45A 2NP6A 5KQLA 1UZNA 2H63A 2MINA 3WIEA 1FEZA 4M76B 3RYHA 1V7PC 3IJRA 2OAEA 1CQJB