2I76A

Crystal structure of protein tm1727 from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
256
structure length
247
Chain Sequence
b'VLNFVGTGTLTRFFLECLKIGYILSRSIDRARNLAEVYGGKAATLEKHPEVVFVIVPDRYIKTVANHLNLGDAVLVHCSGFLSSEIFKKSGRASIHPNFSFLEKALEMKDQIVFGLEGDERGLPIVKKIAEEISGKYFVIPSEKKKAYHLAAVIASNFPVALAYLSKRIYTLLGLDEPELLIHTLMKGVADNIKKMRVECSLTGPVKRGDWQVVEEERREYEKIFGNTVLYDEIVKLLREVAESERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein TM1727 from Thermatoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 62
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10728 DUF2520 Domain of unknown function (DUF2520)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.20 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 ProC-like, C-terminal domain 2i76A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i76A01
1D4FA 4J9VA 4A73A 3GEMA 3NDIA 5CPBA 4A26A 4XIYA 2CDBA 2FR0A 1IZ0A 5I7FA 1K5HA 2XF8A 2WM3A 5EQFA 4D3FA 3WXBA 1NPYA 4M55A 2X86A 4YRDA 1U5AA 4BNVA 2VHZA 4DRYA 3QVXA 3ST7A 3JYOA 2EV9A 5T8KA 2G5CA 3JQCA 2X7HA 3OIDA 1KEUA 5F1OA 4DC0A 4WKGA 3AW9A 3UICA 1TLTA 2YV1A 1LTHR 1XKQA 4L4SA 2PZLA 4JGBA 4O6VA 3L9XA 2H5LA 2HDHA 2JJYA 1UXIA 4XYEA 1D3AA 3WGOA 4DQUA 3JQ6A 4Z3KA 1YBMA 2VWGA 2Y0EA 3PJFA 3C8MA 3K8ZA 3VZPA 4A7PA 2EG9A 3WQQA 1E3WB 1NXQA 3RUHA 3ZZNA 1ISJA 3NJ8A 1PL7A 4GAEA 3RI3A 1N8KA 2RIRA 2YDXA 1UAYA 1GCOA 5L40A 2AA3A 1PS8A 3GVXA 2NTJA 1U2GA 5TIIA 4CLXA 1JKIA 3I9MA 3HQ4O 4Z0PA 4CMIA 1JWAB 3E18A 3GAZA 4YJGB 3RQSA 1YO6A 5THQA 3DR3A 1DJQA 2HMVA 4BGUA 3PFFA 1OC4A 3AUAA 1R0LA 1WLYA 3JCZA 3WQSB 4YR9A 1T25A 3PRJA 4CMKA 1RM5A 2WD7A 3D4NA 1DHRA 3DZHA 3JD3A 4H3VA 1EE9A 4HNGA 3ZCXA 5DDIP 5LCXA 5DCYA 2XXJA 3SJUA 1E3LA 3WGZA 2JD1A 4IDEA 2NWQA 3MTGA 2B36A 3O03A 3DBLB 3Q1LA 4CM4B 3A1NA 4TRMA 2IEDA 1I24A 4DIOA 3KUXA 5DULA 2XPCA 1Q7CA 4OOFA 3JQAA 4LMRA 3AM3A 3SEFA 2BGLA 4BKPA 4ZA2A 1E7QA 5TX7A 1XIVA 2GNAA 3D5TA 3AUUA 3SXPA 4NFHA 5ENVA 3TWOA 3K2BA 2C2YA 5HA5A 3GK3A 4W4TA 2W8ZA 3WNQA 1BVRA 3ON5A 1PJ4A 4HADA 4DPMA 2IODA 4DYDA 2W2KA 4WLVA 3W6ZA 1C1XA 3BIOA 3W8EA 2X9NA 5I9NA 1VM6A 1PJQA 3W8FA 2NV6A 1E92A 3ABIA 1N7GA 4ZQBA 4MVJA 3WJAA 4M86A 1P45A 5K9ZA 1VJ0A 3V5NA 1ZXBA 1MFPA 3DBHB 5FEUA 2CZCA 3U3XA 1AXGA 3L4BC 1U7HA 4MDHA 5A9SB 4HV4A 1RJWA 1NPTO 3D4OA 3L9WA 4RVHA 3O9ZA 4WCFB 1KY5A 3C7DB 3JYLA 3ETGA 3CPSA 3GLQA 4L75A 4EEXA 1ZK0A 3JQEA 3WWYA 1Z75A 4F45A 4XYMA 4O5OA 4IZHA 1NQTA 3L6EA 3A9WA 3F9IA 1KIFA 1MV8A 3HADA 2JFHA 1KOLA 3O38A 3RC2A 1Y81A 4KOAA 2GDZA 1ULUA 2Y1EA 4DQXA 2BFMA 1NQOA 4P4GA 1GPJA 4FFNA 5DT9A 3QA9A 3OETA 1SOWA 3WGQA 3U4IA 5A04A 3Q2KA 2Q2QA 3L77A 2DBVO 4JN6B 3K2EA 1PGOA 3E9NA 5KVVA 3RUDA 3ZU5A 3AY7A 4BO8A 3RFXA 4JP2A 2IZ0A 1SNYA 2WE8A 1UDBA 2C59A 3UKOA 3ZHXA 3TL2A 1EUDA 1K6XA 3TZQA 4FW8A 1GZ4A 3GH3A 4YWJA 4K9DA 3IDSA 1G1AA 2CDCA 4ZHSA 3AFNA 1H2BA 1LSOA 1QLHA 2R2GA 3PYXA 4KUHA 4RVGA 4DWVA 2FSVA 4P4LA 3GNSA 1ISFA 3ROMA 1UZMA 3L0DA 1LEHA 1PS9A 4A27A 5JW6A 3P5SA 1YE3A 4HBGA 4YAJA 4Y6PA 1F8GA 3QVSA 3CE6A 1GTMA 2ZCUA 5LC1A 3R6DA 4BNNA 3QWIA 3GN1A 5IJZA 1MGOA 3PDJA 3AY6A 2LDBA 1IULA 2JCYA 2GLXA 3HSKA 3JTMA 1ZVMA 3QV1A 2JHFA 2Y0DA 3GDFA 1A9ZA 2G17A 4YA6A 2QW8A 4ROSA 4XYBA 1Q7BA 1ENOA 4BL5A 4BOYA 1E5LA 3P7MA 1I32A 4WNIA 4BNZA 4PZCA 1VLLA 4R5MA 3HN2A 1ZIDA 2Q2VA 4YDRA 4KTTE 4KP7A 4MP3A 4AG3A 4BGEA 1PX0A 3C7AA 3T7EA 5HTOA 1EFKA 2EP7A 4CMAA 4UUOA 1U9JA 1QV6A 2PK3A 2DBRA 2POQX 2UVDA 4RPJA 3JD1A 2Q4BA 3WGTA 4GLOA 2NVWA 1LLDA 2UYYA 5T5QA 2ZJ0A 1I3MA 1XA0A 4PLYA 4WPGA 5KJCA 1QV7A 4OXNA 4IDAA 2E4AA 3OJEA 3DO5A 1XELA 4IDCA 4RPGA 5EL0A 3IMFA 5I7SA 2AQKA 4BNIA 3U9LA 3PIIA 4J4HA 4INAA 4JROA 1UDCA 4PFJA 3ZWWA 3DL2A 3GUYA 4MKXA 1W4ZA 4F6CA 2JHGA 4AJIA 4CLRB 1J6UA 3QWFA 4YAKA 4MVJG 5BSGA 1KVSA 3QWHA 4XYLA 2RH4A 1H0KA 4FFMA 1BTOA 2RH8A 4XD2A 3QLJA 2O7QA 2Q1SA 4IS3A 1H9AA 3ZNNA 4CLRA 3LT2A 1ISGA 1MG5A 4X54A 4W99A 4EZBA 3L4SO 5B4UA 3NGXA 2VT2A 3PWKA 1LJ8A 4NJOA 2V65A 3FNGA 3WLFA 2CY0A 5C3MA 2GGSA 4DQVA 3AI1A 4YXFA 1DHTA 1E7WA 3PJEA 1B14A 6ADHA 1RKXA 2OBNA 1D7OA 2BGMA 1D1TA 3IIEA 1HDXA 1V35A 4GWKA 1JQBA 3ZV3A 2CVQA 3WIDA 2FSSA 3NTRA 2Y68A 4EUFA 1P31A 1U4OA 1O95A 4YRBA 4I1IA 3D5QA 3H8VA 5TT0A 1IPEA 1R15A 3GC6A 5KVQA 5CFZA 1KERA 3OJ0A 5JC1A 4JJGA 1ISHA 1MX3A 1T2AA 1Y8QA 1SPXA 1FDSA 3HB5X 4EEZA 1AN9A 4JBHA 5L45A 1R6DA 4J4TA 3JQ8A 1LI4A 4TQGA 2Y1GA 3KEOA 4YT2A 1CJCA 4FR5A 2VWQA 4RO0A 4RPLA 3V2UA 3DBRA 1CRWG 1PL8A 2Z1MA 1GEGA 4BQPA 2I3GA 3U49A 1NFRA 2QX7A 3CIFA 2OGUA 3CKYA 5KCZA 4E5KA 2PKQO 3IUPA 4OIMA 2GSDA 3FHLA 3DXFA 4PRLA 3K30A 3PPIA 3WICA 4A0SA 1MP0A 3H6KA 3I83A 4IQGA 5HS4A 4I08A 3F46A 1R4MA 4XWYA 1YL7A 5IZCC 3W1VA 5K6AC 2UAGA 4TROA 1E1MA 2Q1UA 3PYMA 4R01A 1GFSA 4N54A 1ULSA 4D3DA 2ZYGA 4DLLA 1ZBQA 4IUYA 1CERA 3DZKA 3H9QA 1DLIA 1PR3A 3PHJA 3EHEA 4RVUA 1LSJA 2YW9A 4EYEA 1WDKA 2NTVA 2Q1TA 3PQEA 2A9FA 5G0TA 3KYDB 1YWGO 2GYYA 3MWDB 1WDLA 4MO2A 1SZJG 1HLDA 1QP8A 3U4CA 1GUYA 2Q50A 4HY3A 5HM8A 4L74A 2QQ5A 1ISIA 4FPXA 1H5QA 2XAAA 3RAJA 2DTEA 1I36A 4KTVE 2VWPA 3VOSA 5JC8A 4ZGWA 1XSEA 4IPTA 3DAFA 2QRKA 4XQEA 3VPHA 4MKZA 3GMSA 1E3JA 2AEJA 5COBA 2GO1A 4TRNA 4ZD6A 4KUEA 1RWBA 3VZSA 4QUKA 3MWEB 5EMHA 4CMCA 2DKNA 2DQ4A 1ZMTA 4RVDA 5TJHA 5JLAA 3TQHA 4E2ZA 4HFNA 3JQBC 1X15A 1DLJA 4U6SA 3W4JA 2WYUA 2HMUA 4CMBA 4NZ9A 3PLRA 3PZBA 3GVHA 1HE5A 1WP4A 1QKIA 1ADBA 3ZV5A 4EI2A 3OMLA 4BO2A 1GPDG 2YJZA 5I9LA 3PIDA 2H1SA 3M2PA 5ILOA 3FD8A 2YQ5A 1NR1A 3LZ6A 4D43A 1NWHA 3FCOA 3I23A 5A03A 1Y5RA 4G2NA 5A9TA 1V8BA 4BV8A 1FDUA 1JVSA 4GLLA 5F5LA 3GZNA 3H9UA 4MVJH 3KOUA 1VPDA 3EY4A 4I9UA 1VI2A 2IXAA 1A4IA 2O3JA 1N2SA 2FHSA 4F3YA 4J9UE 3VPGA 2VCYA 1QYVA 1WAMA 3GNTA 1BXGA 1ZEJA 2IRWA 2VHYA 4BNGA 3GF4A 3IS3A 5L4NA 4EJMA 1XDWA 4TWRA 4N5MA 1G6KA 4CJXA 3QE3A 4BMSA 4Z6KA 3INTA 1I2CA 4Y9DA 3JQ9A 3BAZA 3W6UA 3IUSA 3GGGA 1GQYA 1P9LA 4DPLA 1D1SA 2HK9A 2W2LD 3AM4A 3AOGA 5AVOA 4D46A 4E32A 1EK6A 2A92A 4KQXA 4PLZA 5AYVA 4Y67A 2Y67A 3DAPA 1K89A 2CD9A 1I2ZA 3DMTA 4CR7A 5A1TA 3RCBA 2E48A 3E6AA 2O4CA 4B3JA 4H15A 1T1RA 1NVGA 4MVJE 4D7AA 1LA2A 5H83A 1V9LA 3ZH2A 5DBFA 4EDFA 2PWZA 1GZ3A 2C82A 4AJKA 1HE2A 4MINA 4U0KA 3RJ9A 5JO0A 4RF4A 1EE2A 4XGIA 4C7KA 4UUMA 4R16A 3H5NA 4MKRA 5JAIA 1T2EA 1GYPA 1WZIA 2EIHA 5G0VA 3ZWVA 5F3RA 4E0BA 5JO9A 3UN1A 3AK4A 2DT5A 3BTVA 3AWDA 3O4RA 3P2YA 1VJ1A 5IDXA 2Y99A 5JCJD 5JAMA 2BF7A 3GN2A 1U7TA 3WNVA 1AUPA 4QTZA 4J43A 1DOHA 1E0DA 1DJNA 5EN4A 4CMHA 4KWIA 4DIBA 4TRRA 3LK7A 3G3EA 2NM0A 3OEYA 3WB9A 3D3WA 1LSSA 2IXBA 2YHIA 3BHMA 2EHDA 1TVEA 1F06A 1ISMA 1DXYA 4PG7A 5I8WA 3F5SA 1ORRA 1NQ5A 3S55A 1GD1O 1IE3A 3DZIA 4OGWA 1NASA 1NR7A 2QZZA 3DZGA 4UVEA 4E5YA 2WYWA 3KSDO 1RPNA 1PQUA 2PZJA 3KYCB 4OAQA 5TQVA 4ZU3A 4J16A 2I66A 5F21A 3VTFA 3SLKA 5ENDA 2QHXA 1HDOA 4Z0HO 4D3SA 1GU7A 3G17A 5EIOA 1J0XO 4YRAA 5G0SA 4BMVA 1C0LA 1GV0A 5BSEA 3C1OA 3AFMA 3PGJA 3H9JA 3WYBA 4LSMA 3ANMA 4YJDA 4ZRNA 5DBGA 1WMAA 3GEGA 3OQBA 2BHLA 2Z1NA 1YQDA 3RUCA 3GUCA 3IP1A 4IINA 4ALNA 1OFGA 1IZ9A 4RORA 1A27A 4BO6A 3HHPA 1BMDA 1TT5A 3KB6A 3GEDA 3VH4A 3QHAA 4FGWA 4E2YA 4UAGA 3CTMA 4Y6RA 1GUZA 2D59A 4OYRA 1P3DA 1H6AA 5JMWA 4RQTA 2J5RA 1H6BA 4N18A 3NV9A 2HLPA 1LBEA 4BNYA 4WUVA 4B7CA 4NFYA 3I9OA 5KIAA 2BKAA 4DC1A 2UUOA 1N9GA 5JPIA 1PJ3A 4JJIA 2NACA 3RBXA 2FR1A 5CDYA 4E5MA 4NNJA 3VZRA 4AJPA 1U1IA 1F8FA 1V3UA 1GR0A 3RSHA 3ZHYA 2RBEA 3BTOA 1ID1A 4GQAA 2CMDA 9LDTA 5DCWA 1Y8RB 5A3VA 3I3OA 4BV9A 5C7LO 3BMNB 4YPOA 2NLOA 3D64A 4JBGA 5JDIA 4BO1A 1HSZA 1UH5A 4CPDA 1Y5MA 3COSA 2AQ8A 3ZU3A 1HZJA 2YQ4A 4CL3A 1E5QA 2X58A 2C2XA 4BMNA 1GYRA 2C7VA 3F4BA 3ZWBA 1TEHA 3NTQA 4WASA 5C7IO 4B7UA 3JQ7A 1NP3A 2DPGA 3MJSA 1LDNA 2VHXA 4JLWA 1ZZEA 4OOEA 4K26A 5JNLA 1I3NA 2H9IA 1J5PA 2XXBA 3PTZA 3GPIA 3GG2A 4OSPA 1LDBA 1B8UA 1UDAA 3JQGA 4PG4A 2NVUB 2BRUA 4CMEC 4PN3A 4MP6A 2QZ9A 3M6IA 4CM8B 1LNQA 1SBYA 4XB2A 5IAAA 1TT7A 4WLEA 4ZQFA 1IHXA 3BMOA 4NDNE 2NQ8A 3KRTA 5DOZA 2J3JA 1LU9A 5T8KC 2DLDA 3FPLA 4EJ0A 4M89A 3Q3CA 1KEVA 2B0JA 1Z45A 4CMJA 3ULKA 4R41A 1WW8A 3ZV4A 3WFJA 1EFLA 2BH9A 3GRPA 3GNQA 2C20A 1I5RA 4YQZA 1W8DA 1FMCA 2D5AA 1R0KA 5G2OA 1FDTA 3OIGA 4II2A 1Q7GA 1H2HA 3FSRA 2FPGA 4BO4A 2VYND 3L6OO 2G82A 3E48A 4XGKA 2P91A 2XOXA 4FIZA 1I33A 5IDQA 1OC2A 2CUKA 2O48X 3BMCB 1WPQA 1ZSYA 4BNJA 4JBIA 3A28A 5TSDA 4WEOA 5CDGA 3ASUA 2X0NA 5IG2A 5EESA 5FI3A 1FDVA 2VHWA 4CM6A 3WYCA 4A5OA 5KTKA 1SEPA 2NSDA 4GH5A 4LSWA 4LVCA 4BHTA 1N92A 4Y8VA 2J5KA 4GX0A 3E9QA 3VC7A 4CQMD 3NJ4A 4BNLA 4J1NA 3S2IA 3NT2A 1T2CA 4IQ0A 4PLPA 4W7IA 1O94A 2GZ1A 1DAOA 3BHIA 3H65A 2O7SA 4XCVA 5CP8A 1X1TA 2VZ8A 3ZWPA 3JQFA 1B8PA 1W0CA 4RZHA 1KVTA 2ZB7A 3UF0A 3BZUA 4B8ZA 4BO0A 2H63A 3HFSA 3ZI0A 2J3HA 3S2GA 1YB5A 1M66A 2OMEA 4NBWA 1LLUA 4R3WA 1ZMOA 3WG9A 1E6WA 1IPFA 1E3WA 4WK6A 4TSKA 1NFFA 1E1KA 1CWUA 3MOIA 2E82A 5K0ZA 5GZ3A 3ZDFA 1PSDA 1CIVA 3GVIA 1H94A 1S7CA 2VRCA 3EUWA 4XQCA 4A10A 5B1YA 1T4BA 1M75A 4P22A 2HSDA 3K31A 4A03A 3OF2A 2EWMA 2UDPA 3SX2A 5DZSA 3CMCO 4IDGA 4PGFA 1Q0QA 4U6QA 1OAAA 3GA0A 4L0QA 4Q3AA 4YJGA 3TZ6A 2P5UA 4PZEA 3KYBA 3TOXA 1NNUA 2JCVA 1KEWA 4IY1A 1HZZA 4OJNA 2C7GA 1G0NA 3RJ5A 4ZN6A 5L53A 1BDBA 1MXHA 3ZWMA 1VJTA 2E49A 1NX6A 1I3KA 1ZJZA 4ILKA 2WMDA 4JNKA 1ZW1A 4CM1A 4YCAA 5A02A 4XQ9A 4CM4A 2CVZA 3ASVA 3DBLA 3U5TA 3X2EA 4TZTA 5L7YA 2JFFA 4BNTA 2FP4A 4PVDA 1VE9A 2BELA 2YY7A 1I3LA 3WBFA 1E3EA 1B3RA 3IQDB 4YTEA 4E6PA 3NEPX 2VYVD 4QXMA 4R68A 1PGNA 2DAPA 2R6JA 3HFGA 3ADPA 3QW2A 1GCUA 4NBUA 4J2HA 4ZQEA 4H16A 1RM4A 1MUUA 1ZK1A 4FOOA 1K6IA 4KZPA 1Y9EA 3GVPA 5IXYA 3HN7A 4FB5A 3X2FA 1WWKA 1X7HA 2D2IA 2PLAA 3T4EA 3I9JA 2P9GA 3PEFA 3CXRA 1GAEO 4GMGA 5AXBA 4CM7A 5DP1A 1MLDA 3DBHA 3KBOA 4JP3A 2GCGA 3DC2A 1YRLA 4PIVA 4E5NA 5JYEA 3V2HA 5A9SA 3M1AA 5MDHA 3DB2A 1JAYA 3GPDG 4WCFA 1UXKA 2A4KA 2AQHA 1WZEA 2GN8A 1ADCA 1XU7A 3NYWA 4FFLA 3OFSA 4MVJF 4YEDA 2VRBA 3LT4A 1VKNA 1P1FA 3B20A 4J7XA 4RL6A 4E2WA 4OQYA 4R1SA 2VUSA 1UJMA 1QXSA 1C3VA 4RF5A 4UEKA 1E7RA 3Q11A 4NJMB 2VNAA 1LDYA 5KVCA 3FNEA 4WOKA 4BO3A 3EAGA 3V1UA 1LDEA 3ZHZA 5HWSA 4R1NA 1MA0A 2Q49A 1B8VA 1LDGA 4LISA 4XR9A 2GN6A 4Q3BA 3LC2O 3C1AA 5TS3A 4IIVA 3B1FA 4XIJA 2PH5A 2CNBA 4LVUA 4GVXA 4WGGA 4ZQHA 1GL3A 4CLEA 2GUGA 4DMLA 2Z95A 3JQAD 1YOVB 3ZGYA 4GWGA 6LDHA 1P74A 1BWSA 2X0IA 4QT0A 3WFIA 5B37A 1A7AA 4AICA 4W6ZA 2B4TO 4CUJA 2W98A 2IZ1A 1H9BA 2I76A 4Q3CA 3MZ0A 2HJSA 1F0YA 4GMFA 2OHXA 4DIFA 1V6AA 2NU6A 1HWYA 5T6BA 5TF4A 3BYZA 4DBVO 5IXSA 3DAGA 2HK8A 1Z6ZA 3PQFA 3TZKA 1VRWA 4Z3DA 4N5NA 1EVZA 4OM8A 2BI8A 4B79A 1OOEA 1UXJA 3GZ4A 5U4QA 3CINA 5JMPA 3CUKA 5JCXA 3MJ4A 2JAHA 1PZHA 2P9CA 1G0OA 4AJHA 3K9QO 1UP4A 3WBBA 3SBOA 3AOEA 3WGHA 4BB6A 4RF3A 2PZMA 1EVJA 1HKUA 2QYSA 3Q9NA 2I5PO 2BLLA 2IYPA 3AUTA 4PLGA 4L8VA 2ILTA 1NTOA 1W6UA 2RHCA 3I6IA 4FJ1A 1VSUA 1DAPA 2HRZA 1YB1A 4JQCA 1T24A 2AEMA 2EKLA 5AQ1A 2IDZA 4D41A 4UVIA 4PLCA 3H4VA 5EERA 4E4YA 3UAGA 1SEVA 2AE1A 3WDSA 3HNPA 2X4GA 3FF4A 5JFOA 3GR6A 4PLWA 5HRUA 4QEDA 3LT0A 1R37A 2PD3A 4D44A 4RGBA 5GZ1A 3PJGA 1UXGA 2O2YA 3G49A 1XU9A 4XB1A 5JDCA 4Y98A 4L73A 1P1JA 1YQGA 4WOJA 4DPKA 4CODB 3U62A 4YJFB 1RYEA 1DFHA 3O8QB 3RBVA 4NI5A 3DHEA 4XRRA 2IE0A 3CMMA 4OO3A 5DF1A 4HWKA 4WLOA 2JAPA 3S2FA 4YJHB 4WLNA 3VHRA 1ADFA 1K3TA 5IDWA 4K6FA 3KVOA 3UFXA 4AFNA 2Y0CA 3GG9A 3JD2A 5CHEA 1ZEMA 3UCEA 4ZRMA 1T26A 1XYGA 2R00A 4UUNA 3WYEA 4KDFA 3VPSA 1HT0A 1MXFA 2YV2A 2VOJA 3N7UA 5DCUA 7ADHA 3DZFA 3ETEA 7MDHA 3NTOA 3ZWXA 3HG7A 1SB8A 3IC5A 3AI2A 3K73O 3Q6IA 1H93A 5AXAA 4E13A 5A9RA 5L7WA 4ALLA 5C37A 1K2WA 4B4OA 4CM9D 1Z7BA 2JFGA 1N5DA 2IYOA 1SMKA 1M6WA 3FWZA 4KMSA 4AL4A 1E7YA 2X9VA 1W73A 2AW5A 2AG5A 2IEBA 1ZKMA 3F3SA 3I9KA 3RU9A 3BMQB 5T57A 3F4LA 1KYQA 3GRKA 2X22A 3TDKA 1ENPA 1GQ2A 3TZHA 3I6QA 3F47A 2Q4EA 1A9YA 4UEJA 2BD0A 4ITUA 2FPPA 1VL6A 4Z0TA 2PKRA 3ZWAA 4EJ6A 1QLJA 3ZHBA 4IDFA 4CV3A 3OHSX 4CUZA 3LF1A 3D1LA 4IDBA 3UHAA 4LRSB 5L3ZA 4U7WA 3VTZA 2OUIA 4LRTB 1LRJA 2AEFA 4NG5A 5TNXA 1YQXA 5BSFA 2CF5A 2A35A 5HBRA 1HYGA 4DLBA 4I8XA 1Q2XA 5AOVA 2Y1CA 4E30A 5JYDA 1BRMA 3GQVA 3F5QA 4RQUA 1Q0HA 3PP8A 1DEHA 3W4KA 4QX6A 3TFOA 2O23A 5IN4A 3A14A 4M8SA 4Q3NA 2ZCVA 3B6ZA 3DOCA 2ZB4A 3JV7A 4B4WA 2A94A 3OJLA 3E1KA 2HAEA 3V1TC 4Q39A 3DQPA 3U4HA 1CYDA 4J49A 5JAZA 2CVOA 5CAEA 5U9CA 2CDAA 5DN9A 5T67A 1E3SA 1U28A 3ANLA 4GBJA 4CR6A 5B12A 1FJHA 2Y1FA 1DC3A 2C5AA 3EZLA 3GGPA 1DIGA 4O0LA 4ND4A 3WIEA 4M87A 2NU9A 4ZVVA 4CLHA 4XA8A 3VDQA 3KYDA 1I01A 5F1KA 1HRDA 1KC1A 1C0PA 1Q0LA 4NHEA 2I65A 4WEQA 3ZNOA 4WE3A 5F5NA 3DFZA 3I1JA 4IDDA 5KKCA 4DXHA 4DL9A 2C29D 1PZEA 1EZ4A 1QYXA 1FF9A 3RKRA 2YDYA 2ZQYA 4CQLB 4MVJM 5A5EA 1X0VA 2W2LA 4PLTA 4TVOA 1N7HA 4WLUA 1LC3A 4OH1A 2YV3A 1YJQA 1JU9A 3NX4A 2FZWA 2GRAA 1JN0A 3PI7A 4UUPA 4GKVA 4W7HA 4MIYA 4I9NA 1P44A 4ALKA 4MVJI 9LDBA 3FR7A 4GGOA 2ZTMA 4L76A 4OSOA 2HK7A 2D1YA 3GDOA 3PXXA 3WQRA 5KVSA 3OQ6A 4O59O 3L6DA 4IS2A 4NBVA 1EK5A 2DU8A 2PNFA 2UV8A 5H81A 3JQ9C 3OBBA 1EBFA 4W82A 3RUFA 1A71A 4P4NA 2EJWA 4CV0A 5G0UA 3SVTA 1B16A 4TKLA 5JCJA 4HFRA 1YBAA 1NHGA 4YAEA 2Q2WA 1VL0A 4Q3DA 4J1TA 1EDZA 1U3VA 2ZK7A 3EYWA 1NQAO 3DMTC 3AU9A 3IP3A 1E77A 4E2XA 4MP8A 4FQ8A 2VN8A 4FFRA 4K6CA 3UOGA 3DBVO 2OL4A 5L95A 4IM7A 4QSMA 3OECA 4ND5A 2W90A 1P0CA 2VOEA 3P19A 3OQ1A 2PH3A 2OBYA 2OP1A 1JKJA 1Y1PA 1QRRA 3W8DA 1NAIA 2O3SA 1HE4A 3HZZA 3ROPA 1HEUA 2VQ3A 3QJ5A 4W9NA 2AQIA 2EKPA 2G0TA 4QQRA 3H9EO 3PVZA 4YT4A 4BKUA 3HB4X 4XQGA 2GERA 1X1EA 5DP2A 1YVEI 1L7EA 2ZJ1A 4QO7A 3NKLA 3SLGA 1TI7A 3DTTA 4LGVA 5IDYA 3RKUA 4CLOB 2EKQA 4RZIA 4BNHA 1BW9B 4I5DA 1OMOA 4DVJA 1L1FA 5F1PA 5H82A 5MGBA 2OZPA 2DTDA 2YFQA 1XGKA 2DFVA 1M2WA 2QG4A 5BSHA 1HDZA 3A06A 3H7AA 3RD5A 3TF5A 2Q45A 4WLFA 5JAQA 4ND2A 1WDMA 1UR5A 4OKNA 3CEAA 5AXCA 3OSUA 5CG2A 3G0OA 3BXXA 1CF2O 3INRA 2JL1A 4R5HA 1PJTA 1TXGA 1BVUA 1Y7TA 1U2DA 4FJ2A 4ZJUA 1QSGA 2RAFA 1XR3A 5I9MA 2J5QA 1JAXA 2WEKA 4H7PA 1R0SA 2WTBA 2YYYA 3D7LA 2DBZA 3LLSA 1IOLA 1WVGA 1XLTA 5B4VA 1H6DA 3AM5A 3MJEA 1ZSVA 3PWSA 3LC1O 4U0JA 4D42A 1FDWA 4OXKA 4E3ZA 1VKOA 3AUSA 3KYCA 4E21A 2O3RA 4FDAA 2ZQZA 4ONEA 2VNSA 2PFGA 4J1QA 3ZWYA 1V0JA 3I52A 3KSZO 2NQTA 5GY7A 4BNWA 3Q9UA 2V6BA 1GUFA 1HTBA 4I9HA 4R51A 3EVNA 3PYLA 4BO7A 4R54A 4YAIA 4BB5A 4WCDA 5CEEA 4XRGA 1DC6A 3FRJA 1R4NB 3LSYA 4BNXA 1P1RA 1XEAA 5JDIC 4CMGA 4QFCA 4J1SA 2J6IA 5ICSA 4LK3A 3PGXA 3VKVA 3A4VA 3FN4A 2PA3A 5G4LA 3FI9A 3UCFA 3NT5A 1OZAA 4ALJA 3ITDA 3F1KA 2PGJA 1L7DA 3FTPA 4B4VA 1R66A 3F6YA 2X0JA 2X5KO 5EPOA 1XQ6A 4FGSA 1LUAA 2BFPA 2E6UX 3ONEA 2TMGA 2B37A 4HUJA 3T7CA 1BHSA 2HKIA 1PWZA 1C0KA 4IJKA 4BNUA 1HDCA 4BVAA 1UAGA 1C14A 3PHGA 3CZRA 4P38A 3LQFA 3DOJA 3VPFA 4NK4A 4JCOA 5TT1A 5FF9A 1MG0A 1YH3A 2NADA 2WWRA 3NUGA 2FWMX 4PZDA 4CQMB 4GKBA 3KZVA 2V6FA 5TRTA 4AVYA 4PCVA 1FK8A 1JDJA 1Y8RA 3UCXA 3OM9A 3HDJA 3BMNA 3JYPA 4BNFA 4L4XA 4ESOA 3NDRA 3H5AA 1F12A 2ZATA 4BO5A 1CQIA 3IAHA 1LLCA 1Q1NA 1MC5A 2VTDA 1WXDA 3I5MA 2V6MA 3N74A 2Q1WA 1RYDA 4XKJA 4NU5A 2WE7A 1O5IA 1UXHA 2CF6A 3WMXA 2Y1DA 1OBFO 1F14A 4YT5A 4N5LA 1VL8A 2NVUA 4PRKA 3INGA 5DNAA 1BDMA 1U3UA 4CM8A 4BKQA 2X6TA 1S6YA 1ZXLA 4FC7A 1U3WA 1IHYA 2JKVA 3R0IA 3MCVA 1DRVA 4CV2A 2HUNA 2EERA 2NVBA 2Y1OA 5TLSA 5A4DA 1LSUA 1EUCA 5A5FA 4LW8A 1UP6A 4I5GA 3OA2A 2NNLD 5EQDA 3LT1A 5KJ1A 3RVDA 4IQ8A 1DRUA 2GF2A 4DTIA 5IZ4A 2ZTVA 4RVSA 4BO9A 4BNKA 2ZYDA 3G79A 3VH2A 1LX6A 1PQWA 3VAZA 2ZB3A 3NT4A 5JSFA 3DHNA 4AJLA 1PJSA 3VDRA 3EC7A 1DC4A 3JQFC 1E7MA 4B3HA 3FR8A 1NVMB 5ITWA 1BXKA 1PGPA 1NYTA 3ICCA 4MVJP 2JD0A 2SCUA 3Q2IA 2VWHA 4XJSA 3WS7A 4OMUA 2X1HA 3VPXA 4R9RA 2JD2A 3BMCA 3VH3A 4Z9XA 4R4JA 5L51A 4DA9A 1LQUA 5EINA 2J8ZA 1KVUA 4QECA 3H5RA 4OQZA 4GSKA 3ANNA 4EUHA 3RFVA 4F6LA 1NM5A 5TGDA 4K28A 1DIHA 3BTUA 3CH6A 1B2LA 2IZZA 4JJFA 5KWEA 2VYVA 5G0WA 2NU8A 3TL3A 3DMYA 2NTNA 4UEOA 3UUWA 4JK3A 3PK0A 5BNIA 4NK5A 1NAHA 1V3VA 3FNFA 3H3FA 3PHHA 3ZW9A 5FFFA 3DWFA 1DPGA 2HU2A 4CMIB 1MC4A 3AJRA 3TPCA 2BMAA 2BFAA 2F1KA 4DYVA 5T64A 1T2DA 4ND1A 3TZCA 3WOHA 2YUTA 4R1TA 1YS4A 1E1NA 3ZV6A 3V1YA 1PS0A 4BKRA 1GY8A 3PFWO 2I99A 2WD7B 4RV9A 1AXEA 1PIWA 4IMPA 4U5QA 4LCEA 5ADHA 3UVEA 5CPFA 1Z7EA 3MJTA 5COQA 1ADGA 2DC1A 1IB6A 5EJ2A 1YJ8A 4JX8A 3RU7A 5IF3A 2B5VA 3DZJA 2Y66A 1KETA 2Z5LA 3RIHA 2I9PA 2X8LA 3JQAB 1E1LA 3OJFA 4GPD1 2P4QA 4HP8A 4AJNA 2E37A 3VH1A 1JLLA 2QIOA 2EGHA 1PEDA 1PZFA 3GHHA 5BNTA 3WGIA 1O9BA 1O0SA 3Q0EA 3KV3O 4S1VA 8LDHA 2C54A 1SB9A 2QYTA 1GDHA 4AJOA 2O3TA 3QSGA 4C7JA 3IKTA 4L9RA 2ZKLA 1U5CA 2FMUA 4IIUA 2FOIA 4FFOA 2W2KB 4WCFC 1C1XB 4ALIA 4ZQGA 3WWZA 2RCYA 2WJPA 2X23A 4OXYA 3C7CB 4K1LA 2ET6A 3RFTA 3I9NA 2DPHA 3KXDA 3JSAA 3S8MA 1PGQA 2CFCA 2WYVA 1Y9AA 1CDOA 4YT8A 1ML3A 1T1SA 2PV7A 3U09A 1UUFA 3FNHA 1JWBB 3AY3A 2DM6A 1GYQA 1ZJYA 3RC7A 2EEZA 3QVOA 2O3UA 4JIGA 3QP9A 1QR6A 4LN1A 4P8RA 2GD1O 1Z73A 4FFPA 1NBOA 2Q46A 3C24A 4XEHA 2P2SA 4UVHA 3IKVA 2VZ0A 1ARZA 3B1JA 4EW6A 2VRCD 1HL3A 4DBZA 2GPTA 5I8ZA 1N1EA 1EMDA 3GMDA 3RUEA 4DLAA 3GY0A 4HXYA 3JQDA 4RDIA 4R1UA 2P68A 3AI3A 3HDQA 4RLHA 5JE8A 3PWZA 1DIBA 2TMDA 3R3JA 4NPCA 4URFA 1PJLA 3H9GA 3KETA 5G4KB 4M1QA 1EVIA 1V3TA 2X5JO 5B4TA 1LRKA 3L4BA 4G65A 4OHUA 4EITA 1K6JA 4BIIA 1B0AA 5KOIA 2HRBA 3JYNA 3KTDA 4NJMA 1X13A 1U4SA 1EDOA 4ALMA 1ZUD1 2PTGA 5BNFA 4KWHA 4J6FA 4FJ0A 4NBRA 4GX2A 4TZKA 5G4KA 5A05A 1P1IA 1JTVA 2YFHA 4AJ2A 4MJLA 1OI7A 3NAQA 3DDNA 2AMFA 3SC4A 3RC1A 3PJDA 4J7CA 3AOEC 4BGIA 3GT0A 1KC3A 5J23A 1XQ1A 1HETA 1B7GO 4IBOA 3VZQA 2OXIA 1NHWA 1FXSA 1YOVA 2DVMA 1JVBA 4QFDA 3H2SA 2W4QA 4MVJD 4Q9NA 4C4OA 5KJ6A 4B8WA 3MJVA 3RBZA 3WX0A 3GFGA 2OP0A 4D79A 4CUKA 4ND3A 1XG5A 2NUAA 3WGGA 2B4RO 1PL6A 4HNHA 4R69A 3KO8A 3FWNA 5ITVA 1O89A 1ZK2A 1XHLA 1JW9B 2HMTA 2O2SA 3GAFA 5JDCC 4CR8A 3ENKA 3TOZA 3SJ7A 1PR9A 3QWBA 4AJ1A 1A4UA 3I4CA 1BSVA 1EQ2A 3M2TA 2GN4A 3NGLA 1E3IA 4GX1A 3P2OA 1DRWA 4PG6A 1P1HA 3LF2A 3TNLA 3KSUA 3TRIA 1UP7A 4CM9A 2EF1A 1LC0A 5CDUA 1QYWA 4YQYA 5LDGA 3MTJA 5BQFA 4OL9A 4RCVA 1ZFNA 2PD6A 3RUIA 3N58A 3ZNPA 2GASA 5CDTA 4HKTA 1B26A 3TFQA 4RVFA 1MFZA 2HJRA 3ZN2A 3UW3A 3K5PA 2AHRA 1X7GA 1M67A 4IXWA 4B7XA 2R00C 1Y6JA 3U0BA 1X14A 2NU7A 1EEHA 2G76A 3LYLA 4NBTA 4II3A 1GADO 3OP4A 2DUWA 2AE2A 2GZ3A 1I8TA 3GOHA 3FBGA 3H2ZA 4FS3A 4E12A 3VKUA 2VT3A 3DZBA 2V6GA 3GFBA 4J0EA 1SOVA 1DC5A 1SC6A 2GR9A 2X0RA 4FBGA 4KQWA 2YHUA 1LDMA 2GN9A 3KLMX 3DFUA 4I5EA 4R9SA 3RASA 4RPKA 1KVQA 4YJFA 4CM3A 4MPDA 2B4QA 3O8QA 4DMMA 1KY4A 5ES3A 4GSLA 5CG1A 1JKFA 3QVTA 3G1TA 3ZWCA 1M76A 1RM3A 3K92A 2B35A 4FC6A 1N1GA 3W4IA 4YJHA 4BGVA 2EW8A 3QIVA 5JS6A 3WMWA 5C7OO 3DOOA 3LVFO 5L4SA 5LDHA 1YB4A 8ADHA 3O26A 3PLNA 3R3SA 4D45A 4E5PA 3CSDA 1CEQA 3BTSA 4RF2A 1RM0A 2FPIA 2PGLA 2VHVA 4BKOA 4I5FA 3WLEA 3ZWOA 5JXWA 3SC6A 4NIMA 1KS9A 3E8XA 3ONFA 4R3NA 1EVYA 1Y8QB 3EDMA 4O1MA 1XWFA 4PLFA 1YXMA 1DIAA 3GHYA 3OIFA 1ZH8A 1IYZA 3JQ8B 3QY9A 4IGEA 1HDYA 4G81A 3B70A 4XYGA 3D0OA 4F46A 3UGKA 4NH4A 2ZTUA 3BMQA 5L9AA 3RROA 3OJOA 5U1PA 2JCXA 3DBRB 5AXDA 4LMPA 4J7UA 2HMWA 4YVFA 1QG6A 4TRJA 3NRCA 4NR0A 2OFPA 1PJBA 2Y93A 2J3KA 2DUUA 1ZK3A 3FBTA 4XR4A 2X9GA 2Q99A 5TJ9A 3HJAA 2FRDA 3PZRA 2EJVA 2B83A 2HQ1A 1B3BA 4XJTA 1R4MB 1R16A 3WGYA 2D5CA 3WSVA 5CEJA 5DOVA 2C07A 4PLHA 1ZSNA 1P33A 4N7RA 4FOSA 4ID9A 4E33A 1ONPA 2BI7A 3QQPA 3ZU4A 3KM0A 2VUUA 1A72A 4AJ4A 1ZK4A 5ER9A 3ONDA 3G1UA 3HWRA 3RC9A 2ZIZA 4Q3EA 1E6UA 1YBVA 2YZ7A 3MEQA 3PHIA 4YAGA 1IUKA 4CM5A 1IY8A 1HSOA 1BG6A 1ENYA 2I67A 2WD8A 2OOSA 1HE3A 2VUTA 4XGNA 1AGNA 5TC4A 1GEEA 2EP5A 3EVTA 2FR8A 3CZMA 1KVRA 1HYEA 1X0XA 2P5YA 2I3AA 2EXXA 4KUGA 5L7TA 3EMKA 3OA0A 3WJ7A 1AHHA 3TSCA 1A7KA 1DB3A 3F1LA 3ORFA 3KLPX 4CV1A 5IZCA 1NFQA 5K6AA 2J3IA 3DONA 3K96A 3LLVA 2Y05A 2FY8A 2O3QA 4DREA 4OKIA 4D0SA 4GI2A 4YACA 2G1UA 5KJFA 2PY6A 1BXZA 1M6HA 4YBZA 1I10A 1VSVA 2UUPA 1YL5A 4CQLA 1EUZA 3HE3A 2BGKA 3C85A 2P9EA 2DBQA 1BGVA 1PJ2A 3R1IA 4NU6A 4RDHA 4M54A 4XZ3A 4HFMA 4WNCA 3WTBA 1QORA 3ETDA 3IL2A 3ZNQA 3QRWA 4U8GA 2AG8A 4G5HA 3ROKA 5C5IA 1E7SA 1SAYA 3PQDA 5JY1A 3GZNB 4Y6SA 5I7EA 1PQPA 1LLQA 1WMBA 3BA1A 4FSHA 1XCBA 4HX5A 3MOGA 5IN5A 4J3FA 2OO5A 3D3EA 3WTCA 4GX5A 4XDZA 3DEYX 3E82A 1Z82A 3I9LA 3JQBA 3ADOA 2RHRA 4W9NC 2H6EA 2D8AA 1BXGB 3M1LA 2AXQA 4Z9YA 3ROQA 1TB4A 4J4BA 1PJCA 4GVLA 1GQQA 5FWNA 1P1KA 4XX0A 4PG5A 1ZO8A 3H3JA 2B5WA 1U8XX 1VC2A 3OICA 1EBUA 5A3JA 1PWXA 1B15A 1GZ6A 1YDWA 3KEQA 4GL4A 1R12A 2ZYAA 1ZCJA 3BHJA 5BT9A 3RUAA 2DTXA 5ILGA 2I6TA 4TKMA 1H6CA 3IJPA 4Z9FA 5FYDA 1DBVO 2GZ2A 2QRJA 3V2GA 2EW2A 3E5MA 1CETA 4DUPA 1X7DA 1CQJA 3TJRA 3LDHA 3EK2A 3HDHA 3ZW8A 4B3IA 2HMSA 5IFLA 1J49A 2CSUA 4UVDA 5DBIA 5L4LA 3NDJA 4FD3A 1HF3A 4LCJA 3JYQA 4IGFA 1D8AA 4CLOA 1BW9A 4MOWA 4FN4A 2PKQP 5ICMA 1EQUA 5A06A 1E6EA 1PGJA 1QMGA 3EZYA 3GGOA 4B4UA 2PD4A 3S2EA 3RWBA 3UXYA 3QVWA 4D0RA 1NVTA 2OORA 3D3WB 2YHIB 1YDEA 3PDUA 4ZICA 4AJJA 4HFJA 5KJEA 4BQRA 2HCTA 2V7PA 4AJEA 4BUCA 4J91A 2D3TA 3C1TA 2B69A 3FPCA 1LXCA 1C0IA 2ZTLA 4IJVA 4TMFA 5KKAA 2PR2A 4RJTA 1U8FO 2P4HX 2HO5A 3D4PA 2PGDA 3PHLA 2QRLA 4GGPA 1ZNQO 1P77A 4S3MA 1I0ZA 1SCUA 4YB8A 4UVGA 3I4FA 4JXKA 1O6ZA 4A2CA 5JY6A 4WECA 3V8BA 5FI5A 1J4AA 5CDSA 2Q3EA 1HLPA 3AU8A 3E9MA 5THKA 2VZ9A 3VVBA 3K6JA 1K0UA 1DDOA 4KDEA 1KEPA 1T4DA 3GVCA 1AE1A 3WSWA 4NFSA 3E03A 5CEFA 1PTJA 1ENZA 4RLSA 4YYZA 4E31A 3STHA 1JA9A 1YGYA 3WR5A 5GZ6A 4O63O 1TT5B 4IZIA 1DSSG 1HYHA 2VTEA 3ICPA 1AHIA 4TVBA 2FN7A 4EBFA 1PU2A 5HS6A 1HXHA 3LC7O 3HDYA 4CLDA 1T2FA 2D4AA 4IXTA 4PLVA 4MIOA 4J90A 3LU1A 2C0CA 3KHUA 1N9GB 1PZGA 2O4UX 1R4NA 1I2BA 2WDZA 3IOYA 4QO8A 4EGFA 1DFGA 2DFDA 4DGSA 1Z74A 1MB4A 3QWAA 3JD0A 4FCCA 3JD4A 4BNMA 1YKFA 3EW7A 2VYNA 4EUEA 3ITKA 1HDRA 4BS9A 1P0FA 3ZWNA 4WJZA 2F00A 1C1DB 1NPDA 2D0IA 4XDYA 5COAA 1SO8A 2O50A 1F17A 2X5OA 2EGGA 4MIEA 4PVCA 4CL8A 1ONNA 1U3TA 3JQ7B 1A5ZA 5ER6A 4CQMA 1QYCA 1ONOA 3OEWA 1YL6A 1C1DA 2C5EA 3TN7A 3U4DA 4IJWA 1QYDA 3JQGB 2FZEA 3DHYA 2PZKA 4L4RA 5I7VA 2LDXA 3VVCA 2ZB8A 1HDGO 1UZLA 3DTYA 4UREA 3BMOB 1DIRA 4IMRA 4NMHA 1LQTA 3GDGA 4NQZA 3ENNA 1WNTA 3IJRA 1I30A 1UZNA 1GV1A 4M49A 1DO8A 1LRLA 5KNLA 3C3XA 3L07A 3B1KA 1YONA 1TA4A 3OH8A 3FTNA 2WSBA 1IL0A 3MJCA 4IJUA 4PG8A 1O8CA 5BR7A 1KBZA 4UULA 3ZU2A 3EGOA 1NWCA 4J0FA 3HUDA 5GMOA 3S1LA 3E5RA 4J2OA 4RPHA 3UH1A 5JBIA 3T4XA 4CMEA 2BFOA 1DFIA
chains in the Genus database with same CATH superfamily
1WCXA 4J9VA 2I87A 2ZZNA 1YTLA 5CPBA 2OD2A 5A4JA 2CDBA 1IZ0A 5D5QA 5I7FA 1K5HA 2XF8A 2XWSA 3TR5A 2Q9UA 2CWDA 4G8BA 3WXBA 3FPAA 3L0ZA 1NPYA 3FE2A 3G82C 4RPIA 4UKDA 1U5AA 1MW9X 2X5XA 4Z53A 1NDUA 4P9NA 1JU3A 1NUPA 1ZJ4A 1EXMA 3KHTA 1NF3A 2WG1A 4QYTA 5T8KA 3ST7A 1D07A 1G20B 3PUZA 3AL0C 1MAAA 4ZYXA 4AZVA 3A70A 2KBFA 4IFIA 3IKJA 1DQSA 2I8CA 3WNBA 2L19A 2XMPA 2ZSIA 3QHQA 3WLHA 4DS3A 4G9GA 5J4VA 5KQRA 1ZZGA 2X41A 4ASUD 2HJGA 2XB6A 3WLKX 2JFUA 2PAAA 3V8NA 4ZDIA 3ROEA 1OFUA 1TF5A 3MWGA 1M1NB 1RRKA 4FKBA 3CM0A 3IUMA 2HDHA 1BYUA 2JJYA 2ZKIA 1OUMA 1D3AA 3LUPA 2IF2A 3JQ6A 3KQVA 3PXAA 4XYEA 3PLAE 4PYKA 2UXBB 2P9HA 1YBMA 3LAWA 5DLDA 2Z43A 3PUXA 3KSRA 1MD9A 1JR3A 4MGZR 1JZQA 2I4IA 3M89A 1E3WB 1NXQA 3RUHA 1JQJC 3L8YA 5ES4B 2VSYA 2AUNA 4M8IA 1SQSA 2VDMB 5JTTA 4HDRB 2MR5A 4C0KA 1MJNA 5INTA 3G5MA 4BFLA 4G5YA 1S02A 1PS8A 3LT5A 1U2GA 3C8HA 4L4YA 1CHNA 5CX1B 4CNQA 4YCLA 2ZUEA 3I9MA 3PD1A 1JALA 1V2HE 1WPXA 4CMIA 3BXHA 1RQ7A 2PS0A 3COYA 1G4AE 3RQSA 1SHUX 1YO6A 3EGDB 3Q2OA 1JSCA 1ZAKA 4O2AA 5B2FA 4II7A 1H4VB 1AF4A 5IF9A 2HMVA 3HUFA 2P2GA 3PJRA 1PT6A 1OC4A 2DQSA 5BWNA 1GVNB 1OBOA 1AKWA 4YR9A 1VZ2A 1T25A 2ZYWX 1OXMA 2OK7A 3JZMA 5KMGA 4UTNA 5A0VA 1J8YF 2WD7A 3O4FA 2ZM6B 1M2VB 4ML3A 3SXUB 4C78A 1Q84A 2VJAA 4MZDA 3SJUA 2RHJA 1KY3A 4G67A 3ZCTA 2JD1A 4BMCA 2I4RA 2B36A 2XF2A 5DM1A 1DO0A 4DA7A 3A1NA 2PQ2A 3DP9A 3GJYA 3FGOA 2IEDA 2WQZA 3JPWA 3ZDZB 3H17A 4RSGA 1CIJA 1J0EA 2PM8A 1T6ZA 3IODA 3JQAA 4NF2A 5JD5A 5DBOA 5A5DA 3SEFA 2BGLA 4Z1MD 4ZA2A 5CDFA 2P78A 4MV9A 4D9FA 4L4ZA 1JA1A 4B9AA 4LEIA 1XIVA 1QE5A 4K9RA 4NFHA 4BDSA 2PUAA 4U6NA 4RY0A 1N0UA 4A15A 1PJ4A 1LF5A 2P5SA 2Q9CA 3UO8B 2IODA 4DYDA 2W2KA 3V32A 3W6ZA 5I9NA 3W8EA 1QWOA 4MUJA 5J1SB 5JSQA 3ABIA 3F78A 4MGEA 5AVTA 2E4YA 1P45A 4H9GA 3W9BA 4D98A 3K0AA 1RBZA 2J33A 5ALMA 1VI5A 2HHAA 2RCNA 1V2GA 2CZCA 1LW6E 3KLOA 3U3XA 4A0QA 5KYWA 1AXGA 3IJ5A 4MDHA 1J0AA 3D7SA 2QR2A 4DLKA 4JELA 1RJWA 4HV4A 1NZDA 4RVHA 5CVUA 3O9ZA 2XTAA 1FPMA 5KYXB 3HXOA 1TL7C 3N3AC 3M34A 3G2IA 3JYLA 4CYMA 4L75A 1QE0A 2O2EA 4ZO8A 4W5NA 4XYMA 4LTDA 4O5OA 3OTOB 3G0GA 4D9JA 1NQTA 3L6EA 5H70A 1B6RA 3EXG2 5FT9A 2PUEA 2Q6TA 2W0MA 4MRVA 1J24A 2DFTA 4JVNA 2HA7A 2Q6IA 3TTYA 2QBYA 1Y81A 1PEAA 4KOAA 1W44A 2NTYC 2OV8A 3AFOA 1NQOA 2H4YA 1GPJA 1KAEA 3HKBB 2WM8A 3EEFA 1MGPA 1N0WA 4WMLA 4GKKB 3VBCA 3WGQA 4Q1VA 3PUKA 2ZYVX 5EE0A 2DBVO 2XLCA 2XUKA 2QROA 1PGOA 4EQ6A 2FQQA 2X7JA 3E9NA 3OSZA 4O2LA 3RT7A 3IALA 4HB4A 1KJWA 2XCQA 4MQEB 1OBVA 3CG0A 3VSBA 1NUQA 1P7ZA 3OZXA 3HEMA 3SKVA 2NSJA 2IZ0A 2GXQA 3D1JA 3GV0A 1W5AA 4D6XA 1KRWA 2C59A 3UKOA 4JDPA 3OOJA 1K6XA 2QKYA 3WLJA 2Z8YA 4HN9A 1NE7A 3BIXA 1GZ4A 4YIKA 4F8JA 1E9AA 1JX6A 5I48A 1YZNA 4YWJA 5HM6A 1E9RA 2J45A 4IZOA 5KNBA 3UA4A 3F73A 4P3OA 4Y2XA 4JKYA 2FWRA 4OJMX 1LSOA 2QL5A 4X1YB 4U7JA 2FSVA 2PCLA 4DZTA 3KYJB 5DEIA 3PF9A 2AC4A 2XOEA 3CZAA 2NU6B 3FYUC 1P61B 3QKSA 4R8KA 4RPCA 3GPCA 1J70A 2POCA 1OLSA 3CURA 3P5SA 4R1LA 4BDTA 3ABSB 3H42B 2WJVA 2QJRA 1OPRA 3IVRA 5EA2A 2IT1A 2WJ6A 1GKIA 1V45E 1RHJA 2ZCUA 3CE6A 4I4IA 4PPQA 5C1DA 4BNNA 2O8EB 1UOQA 4KIWA 3AY6A 1ISPA 2A30A 2EGUA 2JAUA 2LDBA 4JJ7A 4QIHA 3T1NA 4HEA6 4X92A 2GWHA 1T8UA 4WN9B 3QV1A 1XNGA 3T9CA 2V55B 4AZ3B 2JHFA 2Y0DA 4UHFA 4DWOA 5A3QA 2G17A 3IELA 5M29A 2HD4A 2CMHA 4ZIRB 2C95A 4BL5A 1GGKA 5EJMA 4DMGA 2R5NA 2IDKA 1O77A 2VJNA 3IV7A 4OU4A 2OXTA 4BC0A 1I32A 5AH0A 4CN8A 2EKZA 1MAWA 5AWFC 3ENQA 3PC2A 2J1LA 3A2NA 4KP7A 3AHFA 3DLCA 2JFQA 4MP3A 4P36A 4F91B 1RABA 1VKZA 1WTAA 2FPSA 1EFKA 2EP7A 1KJQA 1TIPA 2VL7A 5FYQA 3SFTA 4BECA 1WIWA 2POQX 2B98A 1MA3A 3WJAA 3CR7A 1TJ4A 3GOQA 1CFJA 3VPCA 4GLOA 2NVWA 4NMMA 1LLDA 2ASVA 2OBXA 4EKEA 2DCUA 3AYXB 1TADA 4WPGA 5JT1A 4JA0A 4G5OA 3NHUA 3OCXA 4XUDA 2FPLA 4OXNA 2IW1A 3QLTA 3OJEA 3DO5A 4YNBA 5B6IA 3PDWA 3MPUA 2AQKA 1U0JA 3IBSA 3QLVA 4IEIA 3IRVA 3RV3A 4J4HA 4INAA 4LA4A 4TV8F 3HK2A 3NNDA 3H2HA 3IR5A 5HGXA 1UDCA 4PFJA 5JVDB 3ZWWA 4LC9A 2AMJA 2EG5A 4F6CA 2AUTA 1A97A 2XUOA 4AJIA 2G40A 1M34B 1J6UA 1VE6A 2XYVA 3QWFA 4IP0A 4NU8X 2ZBDA 3LCCA 3DMHA 3HRHA 3MK31 1I5EA 1Q5PA 3A05A 4ACBA 4EPTA 1A2BA 1NZFA 1F8UA 2GFQA 1ORVA 3UFXB 2PSFA 4M99A 3FRHA 5J5CA 4B46A 2Z6UA 1KTVA 4GL2A 4ZCPA 2Q1SA 3USES 1VHDA 3ANYB 4RTKA 2GXAA 1Y7HA 3D0QA 1J07A 2PT5A 3H3XA 3ZNNA 1PUJA 4CLRA 1MG5A 3LYUA 4FMPA 4W99A 2HY7A 4EFKA 2CNNA 4H7KA 3EVEA 4A0RA 1LJ8A 5IT9A 2R84A 3EW9A 1AHNA 1E2IA 2Q21A 4NBSA 4W5HA 4I6EA 3T99A 2WHPA 2E4WA 3KUUA 1DHTA 3PJEA 2XCRB 4F2PA 5LD2C 1D1TA 3ESRA 2IUSA 1R4ZA 1AS0A 3GCZA 3TQSA 4C4TA 3ZJTA 1V35A 1JIJA 1DOZA 1YAHA 4Z0TA 5JADA 5BY2A 1AKYA 5AK6A 3KJXA 2WT8A 3KELA 3WIDA 2P35A 2C2BA 1O95A 3L3BA 4BP3A 4ZQCB 6REQA 3W9YA 5HPYB 4MGKR 4IQ4A 3UMGA 2Q3DA 3KR9A 2FPPB 1W76A 2QAGB 3GC6A 4BU0A 1NUUA 2W58A 1CR2A 1MB9A 2AEEA 1MX3A 1T2AA 1CUYA 1QS0B 1FDSA 2FYTA 3P2EA 2V1UA 3LPDA 3QMWA 1AN9A 1NG1A 1SBCA 1V1JA 4JBHA 4EEZA 2I3DA 1R6DA 4MA0A 2FZKA 4EUSA 4WL0A 1LI4A 1XC7A 3L6RA 3DB1A 5HG0A 2G4CA 1OLXB 3NH6A 1CJCA 5DGDA 3O93A 3S29A 5JALA 3DOUA 2NOAA 4RPLA 4PINA 5DYGA 4HDNB 3C6XA 1PFYA 1PL8A 2X6QA 1ECFA 1G4UR 2QX7A 2OGUA 3KJZA 2BFEA 4CIXA 5TPWA 3IUPA 4YRNA 3VSDA 1MOPA 4C14A 3FHLA 4MS3B 2JI9A 3ORHA 1T9AA 1XZAA 2FLWA 5EYPB 4UTOA 4OL0A 2YMMA 2Y9ZA 5DWDA 2OXCA 4KFSA 1BEZA 2V7UA 5BRAA 1AH2A 1PFUA 4AY2A 2D1QA 4QPNA 3S28A 4Z4IA 3W1VA 2GSWA 2WI8A 4OX9B 4TROA 2VCEA 5K45A 1LB1B 2Q1UA 4B1FA 1ULSA 3NTVA 1LFAA 1Q15A 2ISSD 4NRDA 2ZYGA 3OX2A 5BV2P 4ZYLA 5FBZA 1TDJA 2R6AA 1KFJB 1DLIA 4YRPA 3BB4A 1YK1A 3EHEA 5JATA 1GKLA 2YCLA 4IHQA 2A0FA 2CKDA 2YW9A 3PPWA 2R4UA 1IFXA 1IZYA 2AOVA 2CLCX 2XVZA 2A9FA 3GW8A 1F2DA 4ECAA 5FUMA 4D3YA 1ZKDA 3ENZA 4FD2A 2GCPA 2Z08A 3U0VA 3UGTA 3GLFA 2PVSA 1SZJG 1QP8A 2QT1A 2BSAA 1NBMD 3DJFA 3TVTA 5H68A 4JENA 5HM8A 2AH5A 4L74A 1WCIA 4BAGA 1T34A 1XL0A 4FPXA 5E2IA 4BFZA 1UCFA 2DTEA 4KTVE 1RRMA 2VWPA 3VOSA 4FFSA 5E1BA 3HRKA 2VQDA 4XSGA 4UM9B 5JEEA 2GEJA 4XQEA 4PNEA 2C78A 4MA4A 1USWA 1L4BA 1E1RD 2IYQA 3OPYB 4ZD6A 2GO1A 3P96A 2C7QA 1J1UA 1E3QA 5CB4B 2ASEA 4KITB 1K92A 3NW9A 3REFA 1DS6A 4EHLA 3IQHX 3FCYA 3TQHA 3CLHA 5K3OA 4M0UA 2PBZA 1X15A 5C8XA 2HT1A 4UHHA 4YP9A 1DLJA 3A9UA 4ERNA 4BTVA 5A71A 5MFPA 4UDNA 3AVYA 4KAFA 3V4PB 4X1KB 5BW8A 1F9AA 2A0KA 2VK1A 2FSHA 1CUAA 5CRIA 3ABQB 1W52X 3FPGA 2Z09A 1V5FA 4C08A 3ZQUA 2N46A 4NAUA 3VX4A 2QMHA 2H1SA 5K8LA 4KQ2A 3WB0A 1GPLA 2RK3A 1T9GR 2XIJA 2IYUA 3L46A 1NVWQ 1U2SA 1NR1A 4RD3A 4UASA 5E1OA 5HGJA 3TD2A 4D43A 1QO9A 3FX2A 4U3JA 4G01B 3I23A 4AZTA 2O8DA 1LPOA 2R87A 5A9TA 2D54A 3L06A 3DPUA 4GSYA 3C7KA 3COWA 4R1OA 4IHJF 3TQCA 3W6PA 2JGKA 3EXFA 2GLUA 1VPDA 5DMXA 4QQFA 4YFYA 2BEUA 1Z4OA 2OPHA 2BF4A 3PXUA 1Z4NA 2EW1A 1NVBA 1N2SA 3G5LA 4M8LA 4D9CA 5ICGA 5JCOC 3LFUA 4J9UE 1W85B 2O1WA 2R5FA 2WPDD 1KL7A 1N0VC 1HE8B 1QYVA 2V7WA 3VPGA 4EG0A 1OB2A 2ORWA 2VHYA 1U63A 4F97A 3OZEA 4BNGA 3UT5B 1D04A 5L4NA 3CWQA 4BQEA 2QD1A 4CJXA 2XQVA 4TYWA 4US1R 1CR6A 1KXZA 2M6KA 3WKEA 3WFZA 1FTSA 1ZVQA 1DMSA 3INTA 3WMRA 2EAUA 1Z2AA 4Z6KA 3JU3A 3O8DA 3C39A 2H4ZA 2IYSA 3ELWA 5LB2A 1UODA 2NYUA 2ZJAA 3W6UA 2A4MA 7REQA 1MBZA 1P9LA 3L0PA 2CXUA 3FYCA 2I8LA 2BMVA 2PX3A 4BVHA 2HK9A 3KR1A 2B3DA 4G9BA 4HNAA 4I55F 4O2BF 5K3SA 2A92A 4CIAA 4GZ3A 3CC8A 3F74A 4PLZA 5AYVA 4JLAA 2I33A 4IIGA 3LW8A 1U7OA 1OIWA 1UINA 1BC5A 3ZHVA 1QH1A 1P9OA 5CLGA 4MHTA 4UM7A 1UZAA 5DI9A 3M4YA 1U1FA 4DLRA 3B9PA 4B3JA 4XPZA 1M2EA 4H15A 4D4KA 4W5RA 1NSTA 1T9KA 2WBLC 3R76A 3VOBA 2Q41A 5HEKA 1I4OA 3SBXA 3CLSC 3IUQA 5H83A 3JSXA 3TW0A 4LYFA 4GQIA 3CCBA 1EFDN 4G5SA 5BV1A 3AHIA 4AJKA 1OXSC 3QE0A 4U0KA 4EF4A 1RE1A 5JO0A 2YJTD 3HA3A 4RF4A 4XGIA 4C7KA 5KNBH 4WBNF 4UUMA 3AIKA 2D1FA 2HREA 5J2UB 3MJHA 3SC2A 3ILVA 4BVGA 1T2EA 5I51A 4UHEA 1HBJA 2EIHA 4CEJB 3DXZA 4IXDA 5F3RA 1AS2A 1NC3A 3M8KA 5IVPA 3BTVA 3O4RA 3DUFB 4PF1A 4C5BA 4JVOA 2FV8A 1CE8A 3MTBA 3H75A 4GW3A 2CSXA 1OX4A 4EKDA 2J4DA 4K9SA 2R60A 4XX1A 3W7AA 3WNVA 1N32B 2C57A 4WZZA 4HQKA 2DPLA 1JJVA 4ZGGA 2KSQA 4I1SA 3T35A 4TRRA 3LK7A 4DSUA 4PY2A 4RTRA 3WB9A 4B84A 4UU8A 1LSSA 1F9EA 3BHMA 3ZHUA 1FP7A 1R0CA 3DDOA 3SYMA 4MUEA 3TRFA 4Y18A 2EP8A 4D9GA 1FNCA 2R6HA 2BBSA 4PG7A 2QENA 4PO9A 2JGDA 3KT0A 1ORRA 2CL6X 2NZJA 3G0IA 1E2MA 3LKBA 3O3NB 4MWDA 3MIZA 4OGWA 3C3DA 3HV2A 1QIIA 3C5EA 3N2EA 4E5YA 4EJFA 1ECPA 1RPNA 2PZJA 4OAQA 2QRVB 3KQPA 2IU0A 1G8PA 5TPZD 1Y9DA 4DSZA 2I66A 2IQ5A 2P9BA 2XB4A 5F21A 1L7PA 2GYWA 1YA4A 2IDJA 2QHXA 4XTCS 2C5HA 1S3GA 1XQ9A 4TYQA 1ZCZA 1Y4SA 1ZESA 1XROA 4ZEMA 1P6UA 1P5FA 2WF5A 4JC4A 2JLUA 4BMVA 2JATA 4G0XA 4CE6A 3SLRA 3EUEA 3DWGA 3ETNA 1OGJA 1T6XA 3T4PA 1QOQB 2C9MA 3DMNA 5H59A 3PNBA 2ECFA 4ZRNA 1JWLA 5DBGA 1ORHA 2H31A 1K8QA 3GEGA 3OQBA 5D1HA 3D4IA 4ZVLA 3HBFA 2BI4A 2V96A 1QHFA 4ALNA 3W9UA 3AVVA 3T3PB 4J0CA 3IE2A 1IZ9A 1OFCX 3AR7A 4GKAA 4RORA 4RJIA 3G7NA 4WFJA 4B83A 1IXKA 1TT5A 4XJVA 3DKVA 1S3IA 3JPYA 3Q8MA 4Y6RA 3R7WA 5KYKA 1XQVA 1Q7TA 4F11A 4OYRA 2LBPA 1P3DA 1K8YB 2PJRA 2JFVA 3EVZA 2AF4C 2J5RA 1H6BA 4N18A 1DEXA 1NVVR 2HLPA 4QE3A 1FTGA 1LBEA 3FWYA 5K8VA 4B7CA 1PF7E 2ZSKA 2XQJA 4HSEA 5FQNA 2C4WA 1H5UA 5HHTA 1DKPA 5JPIA 1QRAA 3IO5A 4C0JA 2NACA 4PGHA 1QDEA 2R65A 2DB3A 4KAXA 3E0QA 4KZKA 1DWOA 4NNJA 4MUMA 3VZRA 1PRYA 4F8EA 1U9IA 4WT7A 4UOQA 3RSHA 4P7FA 4UPVA 4V24A 3TTUA 4MMZB 2E85A 2QU7A 2OC4A 1L8AA 3BS4A 3N75A 1V5GA 3FMIA 4GXQA 4EMBA 2NLOA 3D64A 4JBGA 4ON9A 4FEEA 4BO1A 2W6ZA 1UH5A 4ZMBA 2XYHA 1Y6FA 3A6PC 1Y5MA 1FFYA 4HSGA 2AQ8A 2J3QA 1HZJA 2CCJA 4M83A 3DGEC 3JAKA 4QYIA 4GE0A 1BMQA 1GITA 3H2BA 4LF7B 2GPAA 2CCKA 2FEXA 1E2DA 1GUBA 2IIQA 4QUJA 3GLHA 3WV5A 2GJ9A 1E20A 2DULA 2XSZA 1NJFA 3CX6A 3L7OA 2GEFA 2D3WA 5ANRB 1Z3CA 4ZZ3A 2XT0A 4OSPA 1B8UA 3JQGA 4PG4A 5EUBA 4BQOA 3L18A 4C29A 5B1HA 1BA3A 1DQYA 1I1NA 3B2EA 1PK7A 3L8MA 2BOVA 4MP6A 2YVKA 5DBEX 5F7JA 4ZCTA 4F4FA 3VYSB 2VDWB 1NKTA 3RV4A 1KO1A 1LNQA 2AYZA 3FYDA 1YMQA 4IIBA 1PR2A 1M6NA 2A1UB 1YB2A 1IHXA 1XYYA 3BMOA 1G9TA 3O2SB 2VUHB 2XUAA 4WBXC 4X8LA 1OU0A 3KRTA 2V6IA 3GGDA 1YQQA 3GCGA 1UWKA 1LU9A 4YJ2F 3KZ1E 5CLHA 3PPYA 1WX1A 2VHQA 4PZYA 5H02A 3Q3CA 2Q29A 4DQKA 1F2TB 3SXJA 1DV1A 1ODKA 3Q7TA 3HH8A 4IHAA 2D7JA 3CYFA 1M8FA 3OTIA 2BH9A 4LHYA 3GRPA 4LMBA 3V34A 5H4GA 1ODLA 1YS1X 1IVYA 1CDDA 3MGKA 4JC5A 3L8DA 5JHHB 2CD7A 1F3LA 4KQJA 2D5AA 5DMHA 1R0KA 3QKIA 3OIGA 4N39A 1U6IA 5SYAA 1H2HA 5EC8A 3FSRA 2SCUB 1GXSB 4BO4A 3L6OO 3E48A 3IYLW 1VPLA 1J21A 1CQPA 4L07A 3SZRA 2NZ8A 5K0GA 4FIZA 3OF5A 4K6OA 5CITA 2C4MA 2GCOB 1JDTA 3L7BA 3V80A 1L6IA 5KQGA 2XODA 1DJLA 2P65A 4JBIA 3FMVA 2G63A 4WEOA 5CDGA 1QPGA 4IXMA 4NOJA 4RKQA 2A57A 4V0LA 5EESA 5FI3A 4KV9A 1Z4MA 1N5OX 3D81A 4DGQA 1TFRA 4DSOA 4WXRA 5KTKA 1F2UB 2GH1A 4KMOA 1SEPA 2NSDA 4GH5A 4LSWA 3RUPA 1QO0D 4UBOA 1G20A 4CT5A 4D5EA 5IMSA 1XO1A 3IAM1 4GX0A 3E9QA 4MV7A 4CQMD 2BMWA 3LRTA 1WDTA 5F7ZA 3NT2A 3C6QA 2WWVD 4C03A 3K5WA 2VQFB 1Z29A 1WUKS 3BHIA 3H65A 3K1TA 2XE8A 4LXTA 1JPVA 4MJ7A 3SEZA 1L5OA 3AEQB 1M1NA 1B8PA 2QLBA 4RZHA 2RI1A 1GT91 4K9MA 4W7SA 2WUEA 3UF0A 5JNTA 3TTWA 5IANA 1SQ0A 4RLQA 3S2GA 1R3UA 3UMRA 1HX7A 1M66A 2OMEA 1ML4A 4NCHA 2FK8A 5JMTA 2CLMB 2K2WA 1EP3B 3C8UA 4WK6A 1E3WA 3GB9A 4Q4HB 1S7GA 1IBKB 5BN4B 2DX7A 5JD6A 3X1ZA 2ORED 4GKJB 2WNIA 1CWUA 3FWKA 4V1CB 2ZIUB 4HDRA 3RVBA 1ATIA 2V7EA 1SXGA 3VNQA 1H94A 4RTQA 2UXDB 2NOGA 1JAHA 2YH2A 3W04A 2IXDA 5CX1A 3ZXXA 4A03A 3OF2A 4G4SP 2P9YA 2EWMA 1VOTA 1W5FA 3LGXA 3O91A 1W48A 4TTAA 1VPEA 1PBTA 3EGVA 3L1HA 3OZ7A 3EGDA 4NS1A 4PGFA 4CL0A 2OV6A 3AM1A 3TZ6A 3VA7A 3FMGA 2PX8A 4PZEA 2GBFA 2PUJA 3KJFA 1NNUA 1D0SA 4CG3A 1OI2A 3C41J 1HZZA 2FPOA 4RTLA 1JLLB 3PGA1 1G0NA 5JI2E 2J9FA 5CCBA 4HUQB 3W2HA 4R2HA 3U7QB 1L7XA 1MXHA 4UHKA 3E3NA 4ZP1A 1N6OA 3ZS8A 2UZ3A 4NOMA 3VR5D 4JEHA 1M2VA 1NJGA 1F60A 4O4JF 1ZM2A 1YFKA 3SXUA 1SHTX 1D2GA 4NPAA 4TWAA 3D43A 4CM1A 3HDTA 1AKTA 2VP2A 1JQAA 2C2HA 2OGTA 3OZRA 2CVZA 3QVVA 2K6GA 4QICA 2GAOA 2Z2ZA 2ZXFA 3EH1A 5L7YA 1AQJA 1BNCA 2D5BA 3JZAA 1C8VB 3L7AA 2BELA 2FFBA 5EXSA 1I3LA 1V47A 2FUNB 1IXSB 1G21E 4YTEA 3WBFA 2XGJA 4LDJA 4DN6A 4L51A 3SQDA 2VPYA 2WJJA 3W6NA 5HP4A 1ZJJA 5DN6A 1FUUA 1LJUA 2JAQA 3K9WA 3HFGA 4MQ5A 3UJPA 1ORIA 5ESDA 2AFHB 4NBUA 3O8LA 4MQFB 4RIGA 3CEMA 1RQXA 4R98A 3QM1A 5DRYA 4G89A 4FB5A 1X7HA 3J7TA 4OQDA 3K6SB 4DBLE 2PU7A 5JZBA 3T4EA 4FWTA 2VHEA 1X2EA 2IYZA 1HYBA 4PYOA 1H4QA 1QRUA 5K0BA 4CM7A 5AW1A 4RDXA 1XUOA 5DP1A 2ERYA 4JT9A 3NDBB 4NDAA 1GGFA 3TMYA 1SC4A 2YXLA 3WLQA 4PIVA 5CXSA 1NRJB 1NW3A 2V74B 2O2HA 2ZDQA 3V2HA 1XAGA 4U9UA 1Z6QA 3WDKA 2DR3A 4JBWA 4UDXX 4X84A 4ZVUA 1C29B 3PA6A 4Y9TA 5KYXA 1ILEA 1BHJA 4IX1A 1UXKA 4R81A 5CR9A 2GN8A 3PQCA 3W79A 4FFLA 3QYJA 4CT4B 4KYTA 2VRBA 4HAZA 3AKYA 2CLLB 3LT4A 1M54A 4PAGA 2ZOSA 4OQYA 1QXSA 3GRAA 4BVJA 5I7RA 4U9HS 1G7CA 5BUCA 2XBMA 1RI1A 5CCDA 3HU2A 1E7RA 3H5TA 3W2TA 4KQFA 1GTSA 2A3NA 1H8EA 4JLVA 1LDYA 1QFYA 4E15A 3EAGA 1J7KA 1LDEA 1NJ5A 1U8CB 3Q7PA 2I6XA 5G1NA 4QT4A 2IWHA 1DJMA 2P0EA 1FVOA 4KQHA 1OVMA 5F4BA 4Q1AA 3HZHA 3B1FA 3AIIA 5FORA 3DCIA 3TMAA 2GUGA 2QI9F 4MQEA 1N5RA 2Z95A 3B3GA 4OJTA 5CM8B 3ZKWB 3L01A 4RHTA 3NC4A 1JPJA 5T4FA 4CKYA 2I4LA 4HWGA 4KDCA 1P9NA 3RYCB 3ZGYA 2C3YA 2F90A 4I5IA 1JHRA 1UEJA 4XD7D 4EP1A 6LDHA 1BWSA 1QNFA 3IXLA 1OXKB 3L4EA 2Q8QA 3B8EA 3BXEA 1TQ4A 1QCZA 1UBSB 4G3XA 3I28A 1VHTA 2W98A 2ODAA 4TS3A 3BIJA 4XWTA 1BRTA 1H9BA 3LPMA 4Q3CA 3ZJVA 2P27A 4FYJA 4X1YA 4RFSB 4JQSA 4TLCA 3N5CA 3OM0A 4QU9A 3UQYS 2NU6A 1HWYA 3LQRA 4LY6A 5TF4A 3TXYA 2IP1A 5DNWA 4UXJA 4A0FA 2CMKA 4JJEA 5D7NA 4Z3DA 3SX0A 3T0GA 3X1YA 4OM8A 1EVZA 3GLGA 1W94A 2YWRA 2O8EA 3M6LA 5IRCD 5U4QA 2NN3C 4BAZA 1NUHA 5CGZA 1ZMBA 2KQUA 5CYFA 5JCXA 2WWYA 4TL9A 2BBOA 4WN9A 3BF8A 4UQPA 4RMJA 3WGHA 4BB6A 4OEHA 2PGXA 4QYWA 2PZMA 4N5HX 2EQAA 4TV8B 5J9FA 4AZ3A 3AZOA 3IAXA 1HKUA 1EXNA 5JYBA 2H1RA 1Z0FA 4LDQA 2BLLA 4ZIRA 3TM5A 5HKBA 2IQIA 4L8VA 2JGLA 1NTOA 2W5UA 3WL4A 1VSUA 1TA9A 2F3UA 4QODA 1EK2A 5H3CA 3G5TA 3IP7A 4TQ9A 2IDZA 3UG6A 4D41A 2FU5C 1K9SA 1QIFA 5AQ1A 4UVIA 4H3KB 4O5AA 2FVXA 5EERA 2P1RA 3WDSA 3OE5A 1K3UB 3HNPA 3TEJA 3PQ4A 5D1NA 2WJIA 3KZOA 3GR6A 3BXOA 3LP8A 3W06A 1V11B 2NUTB 4PPYA 2NU7B 1Y82A 2G28A 1HG1A 3MTQA 2P7IA 1ZH6A 5ALXA 3KALA 2WTAA 1UF9A 3TQQA 4YECA 1JLHA 3PJGA 5EVCA 3SOZA 3TE7A 4YRIA 5L3SB 1JZSA 2DUMA 3MCWA 1T4GA 4XB1A 1TYDE 1QZXA 2W83A 5CXUA 1X8XA 5B2EA 4DCCA 1GTG1 2XUDA 4LTNA 3U3JA 4YJFB 2HA6A 1MB2A 3BD6A 1MVLA 3URKA 5HKOA 2VA9A 2I91A 2VPXA 2JVJA 4A6XA 4BFCA 4JZYA 2H2AA 4D25A 3ZX4A 1ZINA 2C8JA 3TZEA 2F64A 1ADYA 1QO7A 3CMMA 5DF1A 5JVDA 5CYPA 2FFJA 2QUIA 3WLPA 3S2FA 1M34A 3RGWS 3TLGA 4ZYWA 1V95A 3BCUA 4JJZA 1ADFA 4Z9BA 5IDWA 2OXFA 2DKOA 4G37A 3T41A 1YZFA 3A25A 3C5VA 4U2GA 1LWOA 3KVOA 3K94A 3GWZA 3FUTA 5FTJA 4KOEC 3UFXA 5LKRA 3JD2A 2ZE7A 1RDFA 1VJRA 3TBHA 4RABA 3UCEA 4R05A 4ZRMA 5TB5A 2CXHA 1LPSA 4KDFA 1KI6B 1SCNE 2H06A 1EJ0A 5IU6A 5DCUA 4H3HB 1GGNA 5F2EA 1A4XA 3QBTA 1BAPA 3ETEA 2FPIB 3VZDA 7MDHA 3V8PA 4X6YA 1YBHA 2J0SA 4NESA 5L7WA 3PEVA 5C37A 2WFLB 4C21A 1Z7BA 2JFGA 2OZKA 2YN4A 4Y2YA 2HWXA 5H4HA 3T0IA 3BE6A 3V4LA 2XNDA 1E9CA 3PU6A 4E5DA 5BSVA 5K4GA 1BXRB 3FWZA 3LPCA 4OA8A 4KMSA 1WA5A 2XDAA 1RWMA 4KLNA 5EP3A 1E3TA 3IILA 3QOWA 1C2YA 3F3SA 2YVQA 3RE1A 3I9KA 3RU9A 4M0LA 4CN9A 1XEFA 3BMQB 5L6LB 1R3DA 3GRKA 3NWEA 3TDKA 4Q4DA 2ZBEA 1EBBA 5CJ2A 5IWAB 1L7BA 2RHTA 1UJ5A 1NW4A 3KDSE 1G98A 1VXRA 1H2RS 1M5TA 1W0JD 2GZSA 3AUYA 4ITUA 1Y3CE 2AS0A 2FPPA 2RAUA 1VL6A 2QAGA 4NZZA 3ZE2B 1P5JA 3D2AA 3TR6A 2YWXA 2VTBB 3IA2A 2HL6A 4LKRA 2DQYA 2VNJA 3RVPA 1QS0A 2C9OA 2J7PA 4NARA 1AU9A 4UXHA 2BFDB 4JR0A 3DEJA 5L3ZA 3VTZA 1IUOA 4BJ1A 5IULC 1OLXA 3BWYA 5KU1A 1QWSA 4TSFA 5ALUA 6PFKA 5EIEA 3LHKA 1XDDA 4OP2A 5AOAA 4MRPA 5EHQA 2A35A 2ZT8A 1HYGA 2PSSA 4UZFA 1L9XA 4HDNA 1Q2XA 2FRXA 5HBRA 4DLBA 2ZRMA 3PRKE 5JYDA 1BRMA 2ATXA 1E2BA 4FU0A 3ZCRA 4BZPA 4WKBA 3FCCA 1SCDA 3KU1A 3IMGA 1DEHA 4MS3A 2VHTA 4DDUA 1JT9A 1OFUX 1OYWA 3A14A 5EYPA 4ZT6A 1L5LA 4MROA 4JH0A 2A5YB 5JNRA 2WSSD 3B5JA 1LPNA 1MEEA 1Y4AE 3MRXA 2VPQA 2ZB4A 5KYVA 3UK1A 3ZBQA 5J47A 2YIMA 1MH1A 4KIGA 2QNRA 1E32A 3G2PA 3JV7A 1P9WA 3ITNA 3K9HA 2VG8A 2ZEJA 4G0VA 1TK2A 1E62A 2C9DA 2CFRA 3LOQA 5GV7A 1XK6A 3A1UA 2CVOA 3EODA 2CDAA 3TR0A 5DN9A 1E3SA 1U28A 1UJ4A 1VHLA 2AMLA 4UNQA 3V55A 5ITZB 4E88A 1DC3A 2C5AA 1E0KA 3GGPA 3QE2A 2PRKA 4ND4A 3WIEA 1SUAA 2XGMA 3B1ZA 3E61A 3VDQA 2H3HA 5T4HA 3UXHA 5F1KA 1Q0LA 2C42A 1C0PA 3AJAA 4NHEA 3WSTA 4WEQA 3ZNOA 1KQOA 2VEDA 3L93A 4WE3A 1XTZA 4DL9A 2C29D 3NHKA 3KC2A 1EZ4A 4CCYB 1R74A 2CDNA 3D8NA 2VJQA 3DYVA 3F6CA 3JRWA 4IHJB 1D5WA 1FF9A 4L02A 5HF6A 2QTRA 4X62B 3CLTD 2XE6A 5HKLA 2W2LA 4PLTA 5AVSA 1MJGA 4YI5A 1RMQA 1KDTA 3G8AA 1LC3A 4OH1A 5C9ZA 3OPYA 3DQQA 2WNHA 2CYCA 3NX4A 2FZWA 1Y9JA 5CB4A 4UUPA 3FLEA 4DUGD 4HGNA 4EG6A 4I9NA 4J07A 3MHTA 4ALKA 1G3QA 1U5BB 2P79A 4FEGA 3P4UA 3FR7A 1BQEA 2VDLB 4TLMB 4B2YA 1XTQA 4BYMA 3LX4A 3KQNA 2ZLBA 3OZDA 2I6FA 4BCCA 2ZTMA 1F6BA 2FN9A 3CZ4A 4PX3A 1PD0A 4X1KA 1DTWB 2W2TA 5ALVA 3LCVB 2HK7A 2ZDHA 1VL1A 3WQRA 1XJCA 4JB0A 2VDUE 3FJ1A 3B8HA 4DIDA 5LOVB 3RS2A 3WWDA 4F4CA 4IS2A 2HHHB 1VIMA 2X3YA 4NBVA 2Q6KA 1RLUA 2EFEB 2PNFA 4LBYA 1WU7A 2OQ2A 3OBBA 3QTBA 3O73A 1KDRA 2BFNA 3QPBA 4HGYA 2OBBA 1XNHA 4OBWA 4KDRA 5E6UB 3M81A 3VO2A 2IEGA 1J39A 4KMRA 4O2BB 5DSXA 1E3DA 1SG6A 4FMDF 2ZYSA 4RKEA 5EWMB 2G77B 1VL0A 1RADA 4Q3DA 4CI0B 5HQJA 4EELA 3NEAA 1W88B 3E4CA 4I50F 3V7YA 4JI8B 5FBQB 2HR1A 3EDRA 3IULA 4RMNA 4MP8A 3FOFC 4FFRA 13PKA 4ESVA 2ZIWB 3MCUA 1RS0A 4DV3B 3VR4A 2PWBA 3KR0A 2JFNA 4IM7A 2W6NA 3ABOB 3I30X 1PVVA 1M1XB 4WBSA 4ZI7A 3GO4A 2JCBA 2YJ4A 1DAFA 2XJ4A 1YE8A 3UT5A 4UHBA 1P0CA 1XI2A 2NT3A 4WBNB 1WBBA 3FGNA 2YJNA 2V3CC 1RPZA 1BZYA 3K6KA 2FSPA 4O25A 2OBYA 1H1DA 1Y1PA 3LQ1A 3W8DA 3ABRB 3BE4A 5BWOA 3OPQA 2O3SA 3ROPA 1HEUA 3EAQA 4S0ZA 2VK2A 4RIEA 3AHCA 4YT4A 5C3UA 4B5KA 1RC1A 4XCXA 4ZVTA 3GJ0A 2R8XA 4W63A 3L4KA 1A8SA 1K5PA 2GCNA 3BC1A 2ZJ1A 4IDPA 2VF5X 1P2GA 1A5SB 5F7OA 3NHAA 1TI7A 3DTTA 4TTTS 2I1WA 5IDYA 5BNZA 1KI3A 5KEIA 2EKQA 2QTFA 4RZIA 5HIMA 1BW9B 3JRNA 3U3ZA 4BNHA 1SBTA 5JHGB 3EQ2A 3HVHA 5IJXA 3RS3A 4TS9A 2DTDA 5DHTA 4DLZA 3WLOA 2DFVA 2DWCA 3D2LA 3BQNB 5PGMA 1HDZA 2OHFA 1XLWA 3A06A 3F71A 3ZI7A 4B44A 1M1YE 1R9GA 3H7AA 2AR0A 2HWKA 5CUQA 5EIAA 5CBPB 3RC3A 221PA 2FW1A 3PNSA 4H17A 2GBLC 5J2UA 5IASA 1WDMA 1P19A 4JODA 4CW7A 2EJBA 2P5TB 3FDFA 5KTPA 4JI2B 4CEJA 3LBHA 5AXCA 4UU7A 3BORA 5CG2A 5KVAA 2R751 3D0KA 1VCOA 1XZMA 1O58A 1CF2O 2GXUA 1N5LA 1C3XA 3DUFA 3E2PA 4GMKA 4YRFA 1TXGA 2YNMA 3GA7A 3R8FA 1Z2EA 4YUAA 2ISCA 6GPBA 2C4UA 2MJLA 2R79A 1C5KA 2RAFA 3QXSA 3SS8A 1SCUB 2JIZA 3CNQS 2DXIA 1JAXA 4JUDX 4YMVA 1VL2A 3SZLA 2YYYA 5C8YF 1CLEA 5KSZA 2PUDA 3LLSA 2DBZA 2GBLA 1XLTA 3ZE7A 1H6DA 2JAWA 4W9MC 2NZWA 4L2IA 3OHMA 2Q5QA 2C7RA 3IT1A 1FP1D 3CLKA 3YASA 1J9ZA 3LKZA 4D42A 2D1RA 4DMFA 2G1JA 4NE9A 4MTCA 3F8WA 2X1MA 3BFXA 1VBFA 3GARA 1AGPA 1Q92A 3OQHA 2QRVA 3LCJA 3HCBA 2Q7OE 2EFDB 4G0NA 4TXHA 1JHYA 4F2WA 4FDAA 2I2CA 3ZLVA 3NGMA 4HYYA 2ZQZA 2QJTA 4K8RB 2PFGA 5K8UA 5GOZA 2Y1LA 4JFRA 3KSZO 4AURA 4C3UA 4HH4A 4KWEA 5E4FA 3Q9UA 3VO1A 1OFTA 1W93A 4BNWA 2UYCA 2F3QA 3E15A 1YV9A 3PQ3A 1GCGA 1TCCA 1HTBA 4EI8A 4I9HA 3EVNA 2PE5A 1UIMA 1UM8A 2BKEA 1NVEA 3R40A 2I80A 4FYYA 5CEEA 1ODFA 5H0IA 1R6AA 3W5BA 2XBUA 3RIYA 2CNWD 3N8NA 1R4NB 4LF4B 1IIBA 1XEAA 4QFCA 4PANA 4EKYA 3G9QA 4LNUB 3NEJA 1CUFA 2G88A 3SDSA 3BD8A 5SY6A 3NT5A 2ZJ5A 1OYYA 4X71A 1SU7A 2YQZA 4RD2A 4F3RA 4B4VA 5IBPA 2H1HA 4OUDB 4UBMA 4AS3A 4IO0A 5IEBA 3BD9A 4FGSA 4QGAA 1BE6A 4UFOA 1XNQB 3O74A 2I3BA 4NEQA 2B37A 1VDZA 1YHYA 2G6BA 1YU6A 1HDCA 1UBFA 1X38A 3AF5A 2B6NA 7MHTA 3CZRA 4M1KA 4YXWD 1KGSA 3ERCA 1IU9A 4NK4A 1YULA 4LGYA 1E60A 1IOVA 2JCSA 4PZDA 3HA2A 4TTPA 4EFDA 5F5XA 4AVYA 3IUNA 1OH8A