2I7BA

Structure of the naturally occuring mutant of human abo(h) blood group b glycosyltransferase: gtb/a268t
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
262
Chain Sequence
VSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGTFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha 1-3-galactosyltransferase
publication title Structural basis for red cell phenotypic changes in newly identified, naturally occurring subgroup mutants of the human blood group B glycosyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 262
sequence length 282
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2006-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2i7bA00
1W77A 4D0ZA 1H5TB 2VXLA 4BQHA 2BO8A 4ZDQA 3RMWA 4HO4A 1G2VA 3I0CA 5EIYA 3NGWA 4G87A 5C48A 4B5BA 1ZHJA 2WE9A 1ZI3A 2PGVA 4EEMA 1GX4A 4FCEA 3K8EA 1FWYA 2Z86A 2FFUA 2V0JA 4C2SA 3JUJA 4Y7VA 4MYBA 3R2WA 4KPZA 2AM3A 3ZGGA 5C4DA 3OAMA 2RIYA 1H7TA 1ZJ3A 3ZGFA 4M2AA 1H7LA 5CQOA 2JCJA 4HO0A 1KWSA 1TW1A 4Y7TA 4G3QA 1NF5B 4B4GA 4EE3A 1INIA 4ASYA 1HM0A 1ZIZA 1HM8A 1MP5A 2I7BA 2AESA 4IRPA 4YS8A 4LW3A 3ST8A 2WGZA 3I0FA 4FROA 4EVWA 2GGQA 2FYAA 4Y6NA 5CQNX 3K8DA 1VZTA 2UX8A 3I0LA 1LZ0A 1E5KA 1G23A 4NAIA 4JISA 2RITA 4B42A 1FGXA 4DE7A 1FXOA 4EEOA 1V84A 4Y63A 5C47A 1FRWA 1FR9A 3D5NA 4FRQA 4HCQA 3D98A 3DJ4A 1YP4A 1H4CA 3I0JA 1H4DA 3SXAA 3V0NA 1R82A 3LW6A 4AYLA 1FO8A 3CU0A 2AE7A 4FREA 5C3BA 1GX0A 2GGOA 2PGYA 1ZDGA 3HL3A 1WSZA 3I0HA 1VPAA 3Q7UA 5DDVA 1R7VA 3SX8A 1ZCTA 2X5SA 1IINA 2X65A 2Y4LA 1XZ6A 2FYCB 1WT1A 1OQMB 2P73A 3FWWA 4BMAA 3IOIA 5C3DA 1NKHB 4Y7GA 4HO8A 5FV9A 4Y62A 4AYJA 3I0DA 1R7XA 3EE5A 1YP3A 2A8WA 3V91A 2VSIA 2ZU7A 1EYRA 2RJ1A 4CJ8A 2Y4MA 2Y4KA 3TZTA 2VS5A 2X60A 4Y64A 1I52A 4HO2A 1HJJA 1NQIB 4DECA 1OMZA 2YQJA 1W57A 1ZDFA 2Z87A 1LZIA 4NALA 1H7HA 1NHEB 1SS9A 3PNNA 5CMFX 2AM4A 2E8BA 3ZLLA 2ICXA 4JD0A 1VM8A 5FTSA 2O1HA 2D7RA 3CKVA 5AJPA 2P6WA 1H5TA 1VGZA 5DDTA 3V0QA 1FG5N 2FYDB 1TW5A 1EZIA 1JVGA 1LZJA 4HO6A 3U2WA 1LL0A 1VZUA 2V0IA 3U2XA 3CKJA 5AJNA 1WT2A 3PKQA 1O0RA 2WVMA 1O7OA 2WVKA 4K6RA 1ZJPA 3U2UA 2VXMA 1VZXA 3OKRA 1VGWA 3TQDA 1YROB 2RJ5A 2FYBA 2OEGA 4Y7FA 1W55A 1G3LA 1H5SD 3DUVA 1H5RB 4R7PA 1ZI5A 2OI7A 3V0MA 2V0HA 5FU0A 1GWVA 1GQ9A 2ICYA 3IOJA 3CKOA 1H7EA 1INJA 4D11A 2Y6PA 2NXVA 3T7NA 3OC9A 4HO3A 1H5SA 1H7FA 4B3UA 5C4EA 2RJ9A 1ZCYA 4FRBA 4KC2A 3U0XA 4KT7A 5C1LA 4B4MA 4P00A 3V8YA 2BO6A 1MP3A 3I0KA 2CU2A 3SX3A 4EE4A 5EJZA 2I5KA 2RIZA 2BO7A 4FQWA 2YQSA 3IOHA 1G9RA 2O1GA 1FOAA 2PX7A 2JCOA 5AJOA 2AECA 1FO9A 1JV3A 5J49A 1LL2A 2AH9A 1R7UA 3U2TA 1FR8A 3E25A 4FRPA 5CMIA 2RJ4A 4P02A 4HO5A 1K4VA 1VGTA 4D48A 5L6VA 4M2BA 2YQHA 4EE5A 2WEEA 1Z90A 4G3PA 2YC3A 1NMMB 3F1CA 2VS3A 5CQLX 1G97A 1QGQA 3N9WA 1O23B 5IDTA 2QKXA 3I0GA 2O1FA 2OI5A 4EEGA 2I5EA 3SXGA 2X5ZA 5BXCA 3CKNA 4AAWA 1S4PA 2VSHA 1ZCUA 3SXEA 1H7GA 3V8ZA 1HJLA 4KXOA 4Y6UA 4XWIA 2RIXA 1PZTA 4E1KA 2Q4JA 4J18A 5C4FA 5C36A 3PKPA 3JTJA 4HG6A 1LZ7A 4KPXA 5CQMX 3RMVA 1O7QA 2XWMA 3I0IX 1G93A 2RJ8A 3ZLKA 5IDSA 3KIAA 3SX5A 4HOCA 3SXCA 2RJ0A 1MC3A 1G8OA 2D7IA 1WVCA 2Y7AA 5C38A 2QGIA 5C8RA 3SX7A 3U0YA 1FZWA 3ZF8A 3GUEA 4IRQA 5FU8A 4DDZA 4ECMA 4M28A 2YCMA 4G3SA 2FFVA 1VICA 4EEAA 3OH0A 2XWNA 5L6SA 2WAWA 3U2VA 3CKQA 1H3MA 1ZJ1A 3OH1A 3T7OA 3V0LA 1H5RA 1QWJA 5CMHA 3USRA 1JYKA 4B2XA 4CJCA 2W0VA 1ZJ0A 1HM9A 3O3PA 1OMXA 3OH2A 2XMEA 1V83A 2P72A 1S4NA 2RJ7A 2W0WA 4FRLA 1FXJA 1ZJOA 1LVWA 2VS4A 3POLA 1R80A 4FRMA 4KC1A 1H7QA 5JQQA 1GA8A 1ZI4A 4FCUA 5C3AA 1JVDA 1TVYA 1WT3A 1ZCVA 1G0RA 2APCA 3CGXA 5C1GA 1VGUA 2YC5A 1HV9A 1JV1A 3Q4SA 1VH1A 4KC4A 1IIMA 1G95A 4NANA 1H4EA 5I1FA 4LW6A 2FY7A 2ZU8A 3BRKX 3USQA 1VH3A 4CJBA 1H5SB 2V0LA 2VFZA 5CMGX 1S4OA 3OH4A 4HO9A 4L41C 2A8UA 2AGDA 3R3IA 4FRDA 1G1LA 2MZBA 1JYLA 3Q80A 4D11C 2YESA 2D0JA 1TZFA 4KNRA 3OH3A 1ON6A 4B4BA 1GWWA 2DPWA 1H5SC 1V82A 2JCLA 4CVHA 1ZI1A 1GQCA 2BO4A 5HS2A 5CMJA 2E3DA 3F1YA 1ON8A 1ZJ2A 5FYEA 5EJ1A 5IFYA 2RJ6A 1YP2A 2XMHA 3SXDA 4KNXA 3JUKA 4KRVA 3OGZA 5C1HA 3BCVA 2YQCA 4KQLA 5FTVA 2XWLA 3DK5A 4FRAA 3SPTA 1R7TA 2AM5A 3V90A 3T7MA 5FUHA 4Y7UA 4B2WA 4ASJA 2OI6A 5CQPA 1QG8A 4FRHA 3D8VA 1R81A 2QH5A 3QVBA 3E26A 3I0EA 3FOQA 2VD4A 4NAKA 1FGGA 2ZU9A 2OEFA 1R7YA 5C4BA 3V0OA 4AC3A 2WVLA 5C4CA 2Y4JA 1MP4A 1WT0A 4D0TA 4ARWA 3V0PA 1NWGB 2PA4A 4M4KA 4UEGA 1PZYB 4MNDA 1LL3A 4GBPA 3SXBA 3RSBA 1XHBA 4Y9XA 2JCKA 2V0KA 5C49A 1QGSA
chains in the Genus database with same CATH superfamily
1W77A 4D0ZA 1H5TB 2VXLA 4BQHA 2BO8A 4ZDQA 3RMWA 4HO4A 1G2VA 3I0CA 5EIYA 3NGWA 4G87A 5C48A 4B5BA 1ZHJA 2WE9A 1ZI3A 2PGVA 4EEMA 1GX4A 4FCEA 3K8EA 1FWYA 2Z86A 2FFUA 2V0JA 4C2SA 3JUJA 4Y7VA 4MYBA 3R2WA 4KPZA 2AM3A 3ZGGA 5C4DA 3OAMA 2RIYA 1H7TA 1ZJ3A 3ZGFA 4M2AA 1H7LA 5CQOA 2JCJA 4HO0A 1KWSA 1TW1A 4Y7TA 4G3QA 1NF5B 4B4GA 4EE3A 1INIA 4ASYA 1HM0A 2VK9A 1ZIZA 1HM8A 1MP5A 2I7BA 2AESA 4IRPA 4YS8A 4LW3A 3ST8A 2WGZA 3I0FA 4FROA 4EVWA 2GGQA 2FYAA 4Y6NA 5CQNX 3K8DA 1VZTA 2UX8A 3I0LA 1LZ0A 1E5KA 1G23A 4NAIA 4JISA 2RITA 4B42A 1FGXA 4DE7A 1FXOA 4EEOA 1V84A 4Y63A 5C47A 1FRWA 1FR9A 3D5NA 4FRQA 4HCQA 3D98A 3DJ4A 1YP4A 1H4CA 3I0JA 1H4DA 3SXAA 3V0NA 1R82A 3LW6A 4AYLA 1FO8A 3CU0A 2AE7A 4FREA 5C3BA 1GX0A 2GGOA 2PGYA 1ZDGA 3HL3A 1WSZA 3I0HA 1VPAA 3Q7UA 5DDVA 1R7VA 3SX8A 1ZCTA 2X5SA 1IINA 2X65A 2Y4LA 1XZ6A 2FYCB 1WT1A 1OQMB 2P73A 3FWWA 4BMAA 3IOIA 5C3DA 1NKHB 4Y7GA 4HO8A 2J0AA 5FV9A 4Y62A 4AYJA 3I0DA 1R7XA 3EE5A 1YP3A 2A8WA 3V91A 2VSIA 2ZU7A 1EYRA 2RJ1A 4CJ8A 2Y4MA 2Y4KA 3TZTA 2VS5A 2X60A 4Y64A 1I52A 4HO2A 1HJJA 1NQIB 4DECA 1OMZA 2YQJA 1W57A 1ZDFA 2Z87A 1LZIA 4NALA 1H7HA 1NHEB 1SS9A 3PNNA 5CMFX 2AM4A 2E8BA 3ZLLA 2ICXA 4JD0A 1VM8A 5FTSA 2O1HA 2D7RA 3CKVA 5AJPA 2P6WA 1H5TA 1VGZA 5DDTA 3V0QA 1FG5N 2FYDB 4O6MA 1TW5A 1EZIA 1JVGA 1LZJA 4HO6A 3U2WA 1LL0A 1VZUA 2V0IA 3U2XA 3CKJA 5AJNA 1WT2A 3PKQA 4MIXA 1O0RA 2WVMA 1O7OA 2WVKA 4K6RA 1ZJPA 3U2UA 2VXMA 1VZXA 3OKRA 1VGWA 4FIYA 3TQDA 1YROB 2RJ5A 2FYBA 2OEGA 4Y7FA 1W55A 1G3LA 1H5SD 3DUVA 1H5RB 4R7PA 1ZI5A 2OI7A 3V0MA 2V0HA 5FU0A 1GWVA 1GQ9A 2ICYA 3IOJA 3CKOA 1H7EA 1INJA 4D11A 2Y6PA 2NXVA 3T7NA 3OC9A 4HO3A 1H5SA 1H7FA 4B3UA 5C4EA 2RJ9A 1ZCYA 4FRBA 4KC2A 3U0XA 4KT7A 5C1LA 4B4MA 4P00A 3V8YA 2BO6A 1MP3A 5D92A 3I0KA 2CU2A 3SX3A 4EE4A 5EJZA 2I5KA 2RIZA 2BO7A 4FQWA 2YQSA 3IOHA 1G9RA 2O1GA 1FOAA 2PX7A 2JCOA 5AJOA 2AECA 1FO9A 1JV3A 5J49A 1LL2A 2AH9A 1R7UA 3U2TA 1FR8A 3E25A 4FRPA 5CMIA 2RJ4A 4P02A 4HO5A 1K4VA 1VGTA 4D48A 5L6VA 4M2BA 2YQHA 4EE5A 2WEEA 1Z90A 4G3PA 2YC3A 1NMMB 3F1CA 2VS3A 5CQLX 1G97A 1QGQA 3N9WA 1O23B 5IDTA 2QKXA 3I0GA 2O1FA 2OI5A 4EEGA 2I5EA 3SXGA 2X5ZA 5BXCA 3CKNA 4AAWA 1S4PA 2VSHA 1ZCUA 3SXEA 1H7GA 3V8ZA 1HJLA 2C0NA 4KXOA 4Y6UA 4XWIA 2RIXA 1PZTA 4E1KA 2Q4JA 4J18A 5C4FA 5C36A 3PKPA 3JTJA 4HG6A 1LZ7A 4KPXA 5CQMX 3RMVA 1O7QA 2XWMA 3I0IX 1G93A 2RJ8A 3ZLKA 5IDSA 3KIAA 3SX5A 4HOCA 3SXCA 2RJ0A 1MC3A 1G8OA 2D7IA 1WVCA 2Y7AA 5C38A 2QGIA 5C8RA 3SX7A 3U0YA 1FZWA 3ZF8A 3GUEA 4IRQA 5FU8A 4DDZA 4ECMA 4M28A 2YCMA 4G3SA 2FFVA 1VICA 4EEAA 3OH0A 2XWNA 5L6SA 2WAWA 3U2VA 3CKQA 1H3MA 4Q7CA 1ZJ1A 3OH1A 3T7OA 3V0LA 1H5RA 1QWJA 5CMHA 3USRA 1JYKA 4B2XA 4CJCA 2W0VA 1ZJ0A 1HM9A 3O3PA 1OMXA 3OH2A 2XMEA 1V83A 2P72A 1S4NA 2RJ7A 2W0WA 4FRLA 1FXJA 1ZJOA 1LVWA 2VS4A 3POLA 1R80A 4FRMA 4KC1A 1H7QA 5JQQA 1GA8A 1ZI4A 4FCUA 5C3AA 1JVDA 1TVYA 1WT3A 1ZCVA 1G0RA 2APCA 3CGXA 5C1GA 1VGUA 2YC5A 1HV9A 1JV1A 3Q4SA 1VH1A 4KC4A 1IIMA 1G95A 4NANA 1H4EA 5I1FA 4LW6A 2FY7A 2ZU8A 3BRKX 3USQA 1VH3A 4CJBA 2J0BA 1H5SB 2V0LA 2VFZA 5CMGX 1S4OA 3OH4A 4HO9A 4FIXA 4L41C 2A8UA 2AGDA 3R3IA 4FRDA 1G1LA 2MZBA 1JYLA 3Q80A 4D11C 2YESA 2D0JA 1TZFA 4KNRA 3OH3A 1ON6A 4B4BA 1GWWA 2DPWA 1H5SC 1V82A 2JCLA 4CVHA 1ZI1A 1GQCA 2BO4A 5HS2A 5CMJA 2E3DA 3F1YA 1ON8A 1ZJ2A 5FYEA 5EJ1A 5IFYA 2RJ6A 1YP2A 2XMHA 3SXDA 4KNXA 3JUKA 4KRVA 3OGZA 5C1HA 3BCVA 2YQCA 4KQLA 5FTVA 2XWLA 3DK5A 4FRAA 3SPTA 1R7TA 2AM5A 3V90A 3T7MA 5FUHA 4Y7UA 4B2WA 4ASJA 2OI6A 5CQPA 1QG8A 4FRHA 3D8VA 1R81A 2QH5A 4O6NA 3QVBA 3E26A 5D91A 3I0EA 3FOQA 2VD4A 4NAKA 1FGGA 2ZU9A 2OEFA 1R7YA 5C4BA 3V0OA 4AC3A 2WVLA 5C4CA 2Y4JA 1MP4A 1WT0A 4D0TA 4ARWA 3V0PA 1NWGB 2PA4A 4M4KA 4UEGA 1PZYB 4MNDA 1LL3A 4GBPA 3SXBA 3RSBA 1XHBA 4Y9XA 2JCKA 2V0KA 5C49A 1QGSA
chains in the Genus database with same CATH topology
1W77A 4D0ZA 1H5TB 2VXLA 4BQHA 2BO8A 4ZDQA 3RMWA 4HO4A 1G2VA 3I0CA 5EIYA 3NGWA 4G87A 5C48A 4B5BA 1ZHJA 2WE9A 1ZI3A 2PGVA 4EEMA 1GX4A 4FCEA 3K8EA 1FWYA 2Z86A 2FFUA 2V0JA 4C2SA 3JUJA 4Y7VA 4MYBA 3R2WA 4KPZA 2AM3A 3ZGGA 5C4DA 3OAMA 2RIYA 1H7TA 1ZJ3A 3ZGFA 4M2AA 1H7LA 5CQOA 2JCJA 4HO0A 1KWSA 1TW1A 4Y7TA 4G3QA 1NF5B 4B4GA 4EE3A 1INIA 4ASYA 1HM0A 2VK9A 1ZIZA 1HM8A 1MP5A 2I7BA 2AESA 4IRPA 4YS8A 4LW3A 3ST8A 2WGZA 3I0FA 4FROA 4EVWA 2GGQA 2FYAA 4Y6NA 5CQNX 3K8DA 1VZTA 2UX8A 3I0LA 1LZ0A 1E5KA 1G23A 4NAIA 4JISA 2RITA 4B42A 1FGXA 4DE7A 1FXOA 4EEOA 1V84A 4Y63A 5C47A 1FRWA 1FR9A 3D5NA 4FRQA 4HCQA 3D98A 3DJ4A 1YP4A 1H4CA 3I0JA 1H4DA 3SXAA 3V0NA 1R82A 3LW6A 4AYLA 1FO8A 3CU0A 2AE7A 4FREA 5C3BA 1GX0A 2GGOA 2PGYA 1ZDGA 3HL3A 1WSZA 3I0HA 1VPAA 3Q7UA 5DDVA 1R7VA 3SX8A 1ZCTA 2X5SA 1IINA 2X65A 2Y4LA 1XZ6A 2FYCB 1WT1A 1OQMB 2P73A 3FWWA 4BMAA 3IOIA 5C3DA 1NKHB 4Y7GA 4HO8A 2J0AA 5FV9A 4Y62A 4AYJA 3I0DA 1R7XA 3EE5A 1YP3A 2A8WA 3V91A 2VSIA 2ZU7A 1EYRA 2RJ1A 4CJ8A 2Y4MA 2Y4KA 3TZTA 2VS5A 2X60A 4Y64A 1I52A 4HO2A 1HJJA 1NQIB 4DECA 1OMZA 2YQJA 1W57A 1ZDFA 2Z87A 1LZIA 4NALA 1H7HA 1NHEB 1SS9A 3PNNA 5CMFX 2AM4A 2E8BA 3ZLLA 2ICXA 4JD0A 1VM8A 5FTSA 2O1HA 2D7RA 3CKVA 5AJPA 2P6WA 1H5TA 1VGZA 5DDTA 3V0QA 1FG5N 2FYDB 4O6MA 1TW5A 1EZIA 1JVGA 1LZJA 4HO6A 3U2WA 1LL0A 1VZUA 2V0IA 3U2XA 3CKJA 5AJNA 1WT2A 3PKQA 4MIXA 1O0RA 2WVMA 1O7OA 2WVKA 4K6RA 1ZJPA 3U2UA 2VXMA 1VZXA 3OKRA 1VGWA 4FIYA 3TQDA 1YROB 2RJ5A 2FYBA 2OEGA 4Y7FA 1W55A 1G3LA 1H5SD 3DUVA 1H5RB 4R7PA 1ZI5A 2OI7A 3V0MA 2V0HA 5FU0A 1GWVA 1GQ9A 2ICYA 3IOJA 3CKOA 1H7EA 1INJA 4D11A 2Y6PA 2NXVA 3T7NA 3OC9A 4HO3A 1H5SA 1H7FA 4B3UA 5C4EA 2RJ9A 1ZCYA 4FRBA 4KC2A 3U0XA 4KT7A 5C1LA 4B4MA 4P00A 3V8YA 2BO6A 1MP3A 5D92A 3I0KA 2CU2A 3SX3A 4EE4A 5EJZA 2I5KA 2RIZA 2BO7A 4FQWA 2YQSA 3IOHA 1G9RA 2O1GA 1FOAA 2PX7A 2JCOA 5AJOA 2AECA 1FO9A 1JV3A 5J49A 1LL2A 2AH9A 1R7UA 3U2TA 1FR8A 3E25A 4FRPA 5CMIA 2RJ4A 4P02A 4HO5A 1K4VA 1VGTA 4D48A 5L6VA 4M2BA 2YQHA 4EE5A 2WEEA 1Z90A 4G3PA 2YC3A 1NMMB 3F1CA 2VS3A 5CQLX 1G97A 1QGQA 3N9WA 1O23B 5IDTA 2QKXA 3I0GA 2O1FA 2OI5A 4EEGA 2I5EA 3SXGA 2X5ZA 5BXCA 3CKNA 4AAWA 1S4PA 2VSHA 1ZCUA 3SXEA 1H7GA 3V8ZA 1HJLA 2C0NA 4KXOA 4Y6UA 4XWIA 2RIXA 1PZTA 4E1KA 2Q4JA 4J18A 5C4FA 5C36A 3PKPA 3JTJA 4HG6A 1LZ7A 4KPXA 5CQMX 3RMVA 1O7QA 2XWMA 3I0IX 1G93A 2RJ8A 3ZLKA 5IDSA 3KIAA 3SX5A 4HOCA 3SXCA 2RJ0A 1MC3A 1G8OA 2D7IA 1WVCA 2Y7AA 5C38A 2QGIA 5C8RA 3SX7A 3U0YA 1FZWA 3ZF8A 3GUEA 4IRQA 5FU8A 4DDZA 4ECMA 4M28A 2YCMA 4G3SA 2FFVA 1VICA 4EEAA 3OH0A 2XWNA 5L6SA 2WAWA 3U2VA 3CKQA 1H3MA 4Q7CA 1ZJ1A 3OH1A 3T7OA 3V0LA 1H5RA 1QWJA 5CMHA 3USRA 1JYKA 4B2XA 4CJCA 2W0VA 1ZJ0A 1HM9A 3O3PA 1OMXA 3OH2A 2XMEA 1V83A 2P72A 1S4NA 2RJ7A 2W0WA 4FRLA 1FXJA 1ZJOA 1LVWA 2VS4A 3POLA 1R80A 4FRMA 4KC1A 1H7QA 5JQQA 1GA8A 1ZI4A 4FCUA 5C3AA 1JVDA 1TVYA 1WT3A 1ZCVA 1G0RA 2APCA 3CGXA 5C1GA 1VGUA 2YC5A 1HV9A 1JV1A 3Q4SA 1VH1A 4KC4A 1IIMA 1G95A 4NANA 1H4EA 5I1FA 4LW6A 2FY7A 2ZU8A 3BRKX 3USQA 1VH3A 4CJBA 2J0BA 1H5SB 2V0LA 2VFZA 5CMGX 1S4OA 3OH4A 4HO9A 4FIXA 4L41C 2A8UA 2AGDA 3R3IA 4FRDA 1G1LA 2MZBA 1JYLA 3Q80A 4D11C 2YESA 2D0JA 1TZFA 4KNRA 3OH3A 1ON6A 4B4BA 1GWWA 2DPWA 1H5SC 1V82A 2JCLA 4CVHA 1ZI1A 1GQCA 2BO4A 5HS2A 5CMJA 2E3DA 3F1YA 1ON8A 1ZJ2A 5FYEA 5EJ1A 5IFYA 2RJ6A 1YP2A 2XMHA 3SXDA 4KNXA 3JUKA 4KRVA 3OGZA 5C1HA 3BCVA 2YQCA 4KQLA 5FTVA 2XWLA 3DK5A 4FRAA 3SPTA 1R7TA 2AM5A 3V90A 3T7MA 5FUHA 4Y7UA 4B2WA 4ASJA 2OI6A 5CQPA 1QG8A 4FRHA 3D8VA 1R81A 2QH5A 4O6NA 3QVBA 3E26A 5D91A 3I0EA 3FOQA 2VD4A 4NAKA 1FGGA 2ZU9A 2OEFA 1R7YA 5C4BA 3V0OA 4AC3A 2WVLA 5C4CA 2Y4JA 1MP4A 1WT0A 4D0TA 4ARWA 3V0PA 1NWGB 2PA4A 4M4KA 4UEGA 1PZYB 4MNDA 1LL3A 4GBPA 3SXBA 3RSBA 1XHBA 4Y9XA 2JCKA 2V0KA 5C49A 1QGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W77 A;  4D0Z A;  1H5T B;  2VXL A;  4BQH A;  2BO8 A;  4ZDQ A;  3RMW A;  4HO4 A;  1G2V A;  3I0C A;  5EIY A;  3NGW A;  4G87 A;  5C48 A;  4B5B A;  1ZHJ A;  2WE9 A;  1ZI3 A;  2PGV A;  4EEM A;  1GX4 A;  4FCE A;  3K8E A;  1FWY A;  2Z86 A;  2FFU A;  2V0J A;  4C2S A;  3JUJ A;  4Y7V A;  4MYB A;  3R2W A;  4KPZ A;  2AM3 A;  3ZGG A;  5C4D A;  3OAM A;  2RIY A;  1H7T A;  1ZJ3 A;  3ZGF A;  4M2A A;  1H7L A;  5CQO A;  2JCJ A;  4HO0 A;  1KWS A;  1TW1 A;  4Y7T A;  4G3Q A;  1NF5 B;  4B4G A;  4EE3 A;  1INI A;  4ASY A;  1HM0 A;  1ZIZ A;  1HM8 A;  1MP5 A;  2I7B A;  2AES A;  4IRP A;  4YS8 A;  4LW3 A;  3ST8 A;  2WGZ A;  3I0F A;  4FRO A;  4EVW A;  2GGQ A;  2FYA A;  4Y6N A;  5CQN X;  3K8D A;  1VZT A;  2UX8 A;  3I0L A;  1LZ0 A;  1E5K A;  1G23 A;  4NAI A;  4JIS A;  2RIT A;  4B42 A;  1FGX A;  4DE7 A;  1FXO A;  4EEO A;  1V84 A;  4Y63 A;  5C47 A;  1FRW A;  1FR9 A;  3D5N A;  4FRQ A;  4HCQ A;  3D98 A;  3DJ4 A;  1YP4 A;  1H4C A;  3I0J A;  1H4D A;  3SXA A;  3V0N A;  1R82 A;  3LW6 A;  4AYL A;  1FO8 A;  3CU0 A;  2AE7 A;  4FRE A;  5C3B A;  1GX0 A;  2GGO A;  2PGY A;  1ZDG A;  3HL3 A;  1WSZ A;  3I0H A;  1VPA A;  3Q7U A;  5DDV A;  1R7V A;  3SX8 A;  1ZCT A;  2X5S A;  1IIN A;  2X65 A;  2Y4L A;  1XZ6 A;  2FYC B;  1WT1 A;  1OQM B;  2P73 A;  3FWW A;  4BMA A;  3IOI A;  5C3D A;  1NKH B;  4Y7G A;  4HO8 A;  5FV9 A;  4Y62 A;  4AYJ A;  3I0D A;  1R7X A;  3EE5 A;  1YP3 A;  2A8W A;  3V91 A;  2VSI A;  2ZU7 A;  1EYR A;  2RJ1 A;  4CJ8 A;  2Y4M A;  2Y4K A;  3TZT A;  2VS5 A;  2X60 A;  4Y64 A;  1I52 A;  4HO2 A;  1HJJ A;  1NQI B;  4DEC A;  1OMZ A;  2YQJ A;  1W57 A;  1ZDF A;  2Z87 A;  1LZI A;  4NAL A;  1H7H A;  1NHE B;  1SS9 A;  3PNN A;  5CMF X;  2AM4 A;  2E8B A;  3ZLL A;  2ICX A;  4JD0 A;  1VM8 A;  5FTS A;  2O1H A;  2D7R A;  3CKV A;  5AJP A;  2P6W A;  1H5T A;  1VGZ A;  5DDT A;  3V0Q A;  1FG5 N;  2FYD B;  1TW5 A;  1EZI A;  1JVG A;  1LZJ A;  4HO6 A;  3U2W A;  1LL0 A;  1VZU A;  2V0I A;  3U2X A;  3CKJ A;  5AJN A;  1WT2 A;  3PKQ A;  1O0R A;  2WVM A;  1O7O A;  2WVK A;  4K6R A;  1ZJP A;  3U2U A;  2VXM A;  1VZX A;  3OKR A;  1VGW A;  3TQD A;  1YRO B;  2RJ5 A;  2FYB A;  2OEG A;  4Y7F A;  1W55 A;  1G3L A;  1H5S D;  3DUV A;  1H5R B;  4R7P A;  1ZI5 A;  2OI7 A;  3V0M A;  2V0H A;  5FU0 A;  1GWV A;  1GQ9 A;  2ICY A;  3IOJ A;  3CKO A;  1H7E A;  1INJ A;  4D11 A;  2Y6P A;  2NXV A;  3T7N A;  3OC9 A;  4HO3 A;  1H5S A;  1H7F A;  4B3U A;  5C4E A;  2RJ9 A;  1ZCY A;  4FRB A;  4KC2 A;  3U0X A;  4KT7 A;  5C1L A;  4B4M A;  4P00 A;  3V8Y A;  2BO6 A;  1MP3 A;  3I0K A;  2CU2 A;  3SX3 A;  4EE4 A;  5EJZ A;  2I5K A;  2RIZ A;  2BO7 A;  4FQW A;  2YQS A;  3IOH A;  1G9R A;  2O1G A;  1FOA A;  2PX7 A;  2JCO A;  5AJO A;  2AEC A;  1FO9 A;  1JV3 A;  5J49 A;  1LL2 A;  2AH9 A;  1R7U A;  3U2T A;  1FR8 A;  3E25 A;  4FRP A;  5CMI A;  2RJ4 A;  4P02 A;  4HO5 A;  1K4V A;  1VGT A;  4D48 A;  5L6V A;  4M2B A;  2YQH A;  4EE5 A;  2WEE A;  1Z90 A;  4G3P A;  2YC3 A;  1NMM B;  3F1C A;  2VS3 A;  5CQL X;  1G97 A;  1QGQ A;  3N9W A;  1O23 B;  5IDT A;  2QKX A;  3I0G A;  2O1F A;  2OI5 A;  4EEG A;  2I5E A;  3SXG A;  2X5Z A;  5BXC A;  3CKN A;  4AAW A;  1S4P A;  2VSH A;  1ZCU A;  3SXE A;  1H7G A;  3V8Z A;  1HJL A;  4KXO A;  4Y6U A;  4XWI A;  2RIX A;  1PZT A;  4E1K A;  2Q4J A;  4J18 A;  5C4F A;  5C36 A;  3PKP A;  3JTJ A;  4HG6 A;  1LZ7 A;  4KPX A;  5CQM X;  3RMV A;  1O7Q A;  2XWM A;  3I0I X;  1G93 A;  2RJ8 A;  3ZLK A;  5IDS A;  3KIA A;  3SX5 A;  4HOC A;  3SXC A;  2RJ0 A;  1MC3 A;  1G8O A;  2D7I A;  1WVC A;  2Y7A A;  5C38 A;  2QGI A;  5C8R A;  3SX7 A;  3U0Y A;  1FZW A;  3ZF8 A;  3GUE A;  4IRQ A;  5FU8 A;  4DDZ A;  4ECM A;  4M28 A;  2YCM A;  4G3S A;  2FFV A;  1VIC A;  4EEA A;  3OH0 A;  2XWN A;  5L6S A;  2WAW A;  3U2V A;  3CKQ A;  1H3M A;  1ZJ1 A;  3OH1 A;  3T7O A;  3V0L A;  1H5R A;  1QWJ A;  5CMH A;  3USR A;  1JYK A;  4B2X A;  4CJC A;  2W0V A;  1ZJ0 A;  1HM9 A;  3O3P A;  1OMX A;  3OH2 A;  2XME A;  1V83 A;  2P72 A;  1S4N A;  2RJ7 A;  2W0W A;  4FRL A;  1FXJ A;  1ZJO A;  1LVW A;  2VS4 A;  3POL A;  1R80 A;  4FRM A;  4KC1 A;  1H7Q A;  5JQQ A;  1GA8 A;  1ZI4 A;  4FCU A;  5C3A A;  1JVD A;  1TVY A;  1WT3 A;  1ZCV A;  1G0R A;  2APC A;  3CGX A;  5C1G A;  1VGU A;  2YC5 A;  1HV9 A;  1JV1 A;  3Q4S A;  1VH1 A;  4KC4 A;  1IIM A;  1G95 A;  4NAN A;  1H4E A;  5I1F A;  4LW6 A;  2FY7 A;  2ZU8 A;  3BRK X;  3USQ A;  1VH3 A;  4CJB A;  1H5S B;  2V0L A;  2VFZ A;  5CMG X;  1S4O A;  3OH4 A;  4HO9 A;  4L41 C;  2A8U A;  2AGD A;  3R3I A;  4FRD A;  1G1L A;  2MZB A;  1JYL A;  3Q80 A;  4D11 C;  2YES A;  2D0J A;  1TZF A;  4KNR A;  3OH3 A;  1ON6 A;  4B4B A;  1GWW A;  2DPW A;  1H5S C;  1V82 A;  2JCL A;  4CVH A;  1ZI1 A;  1GQC A;  2BO4 A;  5HS2 A;  5CMJ A;  2E3D A;  3F1Y A;  1ON8 A;  1ZJ2 A;  5FYE A;  5EJ1 A;  5IFY A;  2RJ6 A;  1YP2 A;  2XMH A;  3SXD A;  4KNX A;  3JUK A;  4KRV A;  3OGZ A;  5C1H A;  3BCV A;  2YQC A;  4KQL A;  5FTV A;  2XWL A;  3DK5 A;  4FRA A;  3SPT A;  1R7T A;  2AM5 A;  3V90 A;  3T7M A;  5FUH A;  4Y7U A;  4B2W A;  4ASJ A;  2OI6 A;  5CQP A;  1QG8 A;  4FRH A;  3D8V A;  1R81 A;  2QH5 A;  3QVB A;  3E26 A;  3I0E A;  3FOQ A;  2VD4 A;  4NAK A;  1FGG A;  2ZU9 A;  2OEF A;  1R7Y A;  5C4B A;  3V0O A;  4AC3 A;  2WVL A;  5C4C A;  2Y4J A;  1MP4 A;  1WT0 A;  4D0T A;  4ARW A;  3V0P A;  1NWG B;  2PA4 A;  4M4K A;  4UEG A;  1PZY B;  4MND A;  1LL3 A;  4GBP A;  3SXB A;  3RSB A;  1XHB A;  4Y9X A;  2JCK A;  2V0K A;  5C49 A;  1QGS A; 
#chains in the Genus database with same CATH topology
 1W77 A;  4D0Z A;  1H5T B;  2VXL A;  4BQH A;  2BO8 A;  4ZDQ A;  3RMW A;  4HO4 A;  1G2V A;  3I0C A;  5EIY A;  3NGW A;  4G87 A;  5C48 A;  4B5B A;  1ZHJ A;  2WE9 A;  1ZI3 A;  2PGV A;  4EEM A;  1GX4 A;  4FCE A;  3K8E A;  1FWY A;  2Z86 A;  2FFU A;  2V0J A;  4C2S A;  3JUJ A;  4Y7V A;  4MYB A;  3R2W A;  4KPZ A;  2AM3 A;  3ZGG A;  5C4D A;  3OAM A;  2RIY A;  1H7T A;  1ZJ3 A;  3ZGF A;  4M2A A;  1H7L A;  5CQO A;  2JCJ A;  4HO0 A;  1KWS A;  1TW1 A;  4Y7T A;  4G3Q A;  1NF5 B;  4B4G A;  4EE3 A;  1INI A;  4ASY A;  1HM0 A;  2VK9 A;  1ZIZ A;  1HM8 A;  1MP5 A;  2I7B A;  2AES A;  4IRP A;  4YS8 A;  4LW3 A;  3ST8 A;  2WGZ A;  3I0F A;  4FRO A;  4EVW A;  2GGQ A;  2FYA A;  4Y6N A;  5CQN X;  3K8D A;  1VZT A;  2UX8 A;  3I0L A;  1LZ0 A;  1E5K A;  1G23 A;  4NAI A;  4JIS A;  2RIT A;  4B42 A;  1FGX A;  4DE7 A;  1FXO A;  4EEO A;  1V84 A;  4Y63 A;  5C47 A;  1FRW A;  1FR9 A;  3D5N A;  4FRQ A;  4HCQ A;  3D98 A;  3DJ4 A;  1YP4 A;  1H4C A;  3I0J A;  1H4D A;  3SXA A;  3V0N A;  1R82 A;  3LW6 A;  4AYL A;  1FO8 A;  3CU0 A;  2AE7 A;  4FRE A;  5C3B A;  1GX0 A;  2GGO A;  2PGY A;  1ZDG A;  3HL3 A;  1WSZ A;  3I0H A;  1VPA A;  3Q7U A;  5DDV A;  1R7V A;  3SX8 A;  1ZCT A;  2X5S A;  1IIN A;  2X65 A;  2Y4L A;  1XZ6 A;  2FYC B;  1WT1 A;  1OQM B;  2P73 A;  3FWW A;  4BMA A;  3IOI A;  5C3D A;  1NKH B;  4Y7G A;  4HO8 A;  2J0A A;  5FV9 A;  4Y62 A;  4AYJ A;  3I0D A;  1R7X A;  3EE5 A;  1YP3 A;  2A8W A;  3V91 A;  2VSI A;  2ZU7 A;  1EYR A;  2RJ1 A;  4CJ8 A;  2Y4M A;  2Y4K A;  3TZT A;  2VS5 A;  2X60 A;  4Y64 A;  1I52 A;  4HO2 A;  1HJJ A;  1NQI B;  4DEC A;  1OMZ A;  2YQJ A;  1W57 A;  1ZDF A;  2Z87 A;  1LZI A;  4NAL A;  1H7H A;  1NHE B;  1SS9 A;  3PNN A;  5CMF X;  2AM4 A;  2E8B A;  3ZLL A;  2ICX A;  4JD0 A;  1VM8 A;  5FTS A;  2O1H A;  2D7R A;  3CKV A;  5AJP A;  2P6W A;  1H5T A;  1VGZ A;  5DDT A;  3V0Q A;  1FG5 N;  2FYD B;  4O6M A;  1TW5 A;  1EZI A;  1JVG A;  1LZJ A;  4HO6 A;  3U2W A;  1LL0 A;  1VZU A;  2V0I A;  3U2X A;  3CKJ A;  5AJN A;  1WT2 A;  3PKQ A;  4MIX A;  1O0R A;  2WVM A;  1O7O A;  2WVK A;  4K6R A;  1ZJP A;  3U2U A;  2VXM A;  1VZX A;  3OKR A;  1VGW A;  4FIY A;  3TQD A;  1YRO B;  2RJ5 A;  2FYB A;  2OEG A;  4Y7F A;  1W55 A;  1G3L A;  1H5S D;  3DUV A;  1H5R B;  4R7P A;  1ZI5 A;  2OI7 A;  3V0M A;  2V0H A;  5FU0 A;  1GWV A;  1GQ9 A;  2ICY A;  3IOJ A;  3CKO A;  1H7E A;  1INJ A;  4D11 A;  2Y6P A;  2NXV A;  3T7N A;  3OC9 A;  4HO3 A;  1H5S A;  1H7F A;  4B3U A;  5C4E A;  2RJ9 A;  1ZCY A;  4FRB A;  4KC2 A;  3U0X A;  4KT7 A;  5C1L A;  4B4M A;  4P00 A;  3V8Y A;  2BO6 A;  1MP3 A;  5D92 A;  3I0K A;  2CU2 A;  3SX3 A;  4EE4 A;  5EJZ A;  2I5K A;  2RIZ A;  2BO7 A;  4FQW A;  2YQS A;  3IOH A;  1G9R A;  2O1G A;  1FOA A;  2PX7 A;  2JCO A;  5AJO A;  2AEC A;  1FO9 A;  1JV3 A;  5J49 A;  1LL2 A;  2AH9 A;  1R7U A;  3U2T A;  1FR8 A;  3E25 A;  4FRP A;  5CMI A;  2RJ4 A;  4P02 A;  4HO5 A;  1K4V A;  1VGT A;  4D48 A;  5L6V A;  4M2B A;  2YQH A;  4EE5 A;  2WEE A;  1Z90 A;  4G3P A;  2YC3 A;  1NMM B;  3F1C A;  2VS3 A;  5CQL X;  1G97 A;  1QGQ A;  3N9W A;  1O23 B;  5IDT A;  2QKX A;  3I0G A;  2O1F A;  2OI5 A;  4EEG A;  2I5E A;  3SXG A;  2X5Z A;  5BXC A;  3CKN A;  4AAW A;  1S4P A;  2VSH A;  1ZCU A;  3SXE A;  1H7G A;  3V8Z A;  1HJL A;  2C0N A;  4KXO A;  4Y6U A;  4XWI A;  2RIX A;  1PZT A;  4E1K A;  2Q4J A;  4J18 A;  5C4F A;  5C36 A;  3PKP A;  3JTJ A;  4HG6 A;  1LZ7 A;  4KPX A;  5CQM X;  3RMV A;  1O7Q A;  2XWM A;  3I0I X;  1G93 A;  2RJ8 A;  3ZLK A;  5IDS A;  3KIA A;  3SX5 A;  4HOC A;  3SXC A;  2RJ0 A;  1MC3 A;  1G8O A;  2D7I A;  1WVC A;  2Y7A A;  5C38 A;  2QGI A;  5C8R A;  3SX7 A;  3U0Y A;  1FZW A;  3ZF8 A;  3GUE A;  4IRQ A;  5FU8 A;  4DDZ A;  4ECM A;  4M28 A;  2YCM A;  4G3S A;  2FFV A;  1VIC A;  4EEA A;  3OH0 A;  2XWN A;  5L6S A;  2WAW A;  3U2V A;  3CKQ A;  1H3M A;  4Q7C A;  1ZJ1 A;  3OH1 A;  3T7O A;  3V0L A;  1H5R A;  1QWJ A;  5CMH A;  3USR A;  1JYK A;  4B2X A;  4CJC A;  2W0V A;  1ZJ0 A;  1HM9 A;  3O3P A;  1OMX A;  3OH2 A;  2XME A;  1V83 A;  2P72 A;  1S4N A;  2RJ7 A;  2W0W A;  4FRL A;  1FXJ A;  1ZJO A;  1LVW A;  2VS4 A;  3POL A;  1R80 A;  4FRM A;  4KC1 A;  1H7Q A;  5JQQ A;  1GA8 A;  1ZI4 A;  4FCU A;  5C3A A;  1JVD A;  1TVY A;  1WT3 A;  1ZCV A;  1G0R A;  2APC A;  3CGX A;  5C1G A;  1VGU A;  2YC5 A;  1HV9 A;  1JV1 A;  3Q4S A;  1VH1 A;  4KC4 A;  1IIM A;  1G95 A;  4NAN A;  1H4E A;  5I1F A;  4LW6 A;  2FY7 A;  2ZU8 A;  3BRK X;  3USQ A;  1VH3 A;  4CJB A;  2J0B A;  1H5S B;  2V0L A;  2VFZ A;  5CMG X;  1S4O A;  3OH4 A;  4HO9 A;  4FIX A;  4L41 C;  2A8U A;  2AGD A;  3R3I A;  4FRD A;  1G1L A;  2MZB A;  1JYL A;  3Q80 A;  4D11 C;  2YES A;  2D0J A;  1TZF A;  4KNR A;  3OH3 A;  1ON6 A;  4B4B A;  1GWW A;  2DPW A;  1H5S C;  1V82 A;  2JCL A;  4CVH A;  1ZI1 A;  1GQC A;  2BO4 A;  5HS2 A;  5CMJ A;  2E3D A;  3F1Y A;  1ON8 A;  1ZJ2 A;  5FYE A;  5EJ1 A;  5IFY A;  2RJ6 A;  1YP2 A;  2XMH A;  3SXD A;  4KNX A;  3JUK A;  4KRV A;  3OGZ A;  5C1H A;  3BCV A;  2YQC A;  4KQL A;  5FTV A;  2XWL A;  3DK5 A;  4FRA A;  3SPT A;  1R7T A;  2AM5 A;  3V90 A;  3T7M A;  5FUH A;  4Y7U A;  4B2W A;  4ASJ A;  2OI6 A;  5CQP A;  1QG8 A;  4FRH A;  3D8V A;  1R81 A;  2QH5 A;  4O6N A;  3QVB A;  3E26 A;  5D91 A;  3I0E A;  3FOQ A;  2VD4 A;  4NAK A;  1FGG A;  2ZU9 A;  2OEF A;  1R7Y A;  5C4B A;  3V0O A;  4AC3 A;  2WVL A;  5C4C A;  2Y4J A;  1MP4 A;  1WT0 A;  4D0T A;  4ARW A;  3V0P A;  1NWG B;  2PA4 A;  4M4K A;  4UEG A;  1PZY B;  4MND A;  1LL3 A;  4GBP A;  3SXB A;  3RSB A;  1XHB A;  4Y9X A;  2JCK A;  2V0K A;  5C49 A;  1QGS A; 
#chains in the Genus database with same CATH homology
 1W77 A;  4D0Z A;  1H5T B;  2VXL A;  4BQH A;  2BO8 A;  4ZDQ A;  3RMW A;  4HO4 A;  1G2V A;  3I0C A;  5EIY A;  3NGW A;  4G87 A;  5C48 A;  4B5B A;  1ZHJ A;  2WE9 A;  1ZI3 A;  2PGV A;  4EEM A;  1GX4 A;  4FCE A;  3K8E A;  1FWY A;  2Z86 A;  2FFU A;  2V0J A;  4C2S A;  3JUJ A;  4Y7V A;  4MYB A;  3R2W A;  4KPZ A;  2AM3 A;  3ZGG A;  5C4D A;  3OAM A;  2RIY A;  1H7T A;  1ZJ3 A;  3ZGF A;  4M2A A;  1H7L A;  5CQO A;  2JCJ A;  4HO0 A;  1KWS A;  1TW1 A;  4Y7T A;  4G3Q A;  1NF5 B;  4B4G A;  4EE3 A;  1INI A;  4ASY A;  1HM0 A;  2VK9 A;  1ZIZ A;  1HM8 A;  1MP5 A;  2I7B A;  2AES A;  4IRP A;  4YS8 A;  4LW3 A;  3ST8 A;  2WGZ A;  3I0F A;  4FRO A;  4EVW A;  2GGQ A;  2FYA A;  4Y6N A;  5CQN X;  3K8D A;  1VZT A;  2UX8 A;  3I0L A;  1LZ0 A;  1E5K A;  1G23 A;  4NAI A;  4JIS A;  2RIT A;  4B42 A;  1FGX A;  4DE7 A;  1FXO A;  4EEO A;  1V84 A;  4Y63 A;  5C47 A;  1FRW A;  1FR9 A;  3D5N A;  4FRQ A;  4HCQ A;  3D98 A;  3DJ4 A;  1YP4 A;  1H4C A;  3I0J A;  1H4D A;  3SXA A;  3V0N A;  1R82 A;  3LW6 A;  4AYL A;  1FO8 A;  3CU0 A;  2AE7 A;  4FRE A;  5C3B A;  1GX0 A;  2GGO A;  2PGY A;  1ZDG A;  3HL3 A;  1WSZ A;  3I0H A;  1VPA A;  3Q7U A;  5DDV A;  1R7V A;  3SX8 A;  1ZCT A;  2X5S A;  1IIN A;  2X65 A;  2Y4L A;  1XZ6 A;  2FYC B;  1WT1 A;  1OQM B;  2P73 A;  3FWW A;  4BMA A;  3IOI A;  5C3D A;  1NKH B;  4Y7G A;  4HO8 A;  2J0A A;  5FV9 A;  4Y62 A;  4AYJ A;  3I0D A;  1R7X A;  3EE5 A;  1YP3 A;  2A8W A;  3V91 A;  2VSI A;  2ZU7 A;  1EYR A;  2RJ1 A;  4CJ8 A;  2Y4M A;  2Y4K A;  3TZT A;  2VS5 A;  2X60 A;  4Y64 A;  1I52 A;  4HO2 A;  1HJJ A;  1NQI B;  4DEC A;  1OMZ A;  2YQJ A;  1W57 A;  1ZDF A;  2Z87 A;  1LZI A;  4NAL A;  1H7H A;  1NHE B;  1SS9 A;  3PNN A;  5CMF X;  2AM4 A;  2E8B A;  3ZLL A;  2ICX A;  4JD0 A;  1VM8 A;  5FTS A;  2O1H A;  2D7R A;  3CKV A;  5AJP A;  2P6W A;  1H5T A;  1VGZ A;  5DDT A;  3V0Q A;  1FG5 N;  2FYD B;  4O6M A;  1TW5 A;  1EZI A;  1JVG A;  1LZJ A;  4HO6 A;  3U2W A;  1LL0 A;  1VZU A;  2V0I A;  3U2X A;  3CKJ A;  5AJN A;  1WT2 A;  3PKQ A;  4MIX A;  1O0R A;  2WVM A;  1O7O A;  2WVK A;  4K6R A;  1ZJP A;  3U2U A;  2VXM A;  1VZX A;  3OKR A;  1VGW A;  4FIY A;  3TQD A;  1YRO B;  2RJ5 A;  2FYB A;  2OEG A;  4Y7F A;  1W55 A;  1G3L A;  1H5S D;  3DUV A;  1H5R B;  4R7P A;  1ZI5 A;  2OI7 A;  3V0M A;  2V0H A;  5FU0 A;  1GWV A;  1GQ9 A;  2ICY A;  3IOJ A;  3CKO A;  1H7E A;  1INJ A;  4D11 A;  2Y6P A;  2NXV A;  3T7N A;  3OC9 A;  4HO3 A;  1H5S A;  1H7F A;  4B3U A;  5C4E A;  2RJ9 A;  1ZCY A;  4FRB A;  4KC2 A;  3U0X A;  4KT7 A;  5C1L A;  4B4M A;  4P00 A;  3V8Y A;  2BO6 A;  1MP3 A;  5D92 A;  3I0K A;  2CU2 A;  3SX3 A;  4EE4 A;  5EJZ A;  2I5K A;  2RIZ A;  2BO7 A;  4FQW A;  2YQS A;  3IOH A;  1G9R A;  2O1G A;  1FOA A;  2PX7 A;  2JCO A;  5AJO A;  2AEC A;  1FO9 A;  1JV3 A;  5J49 A;  1LL2 A;  2AH9 A;  1R7U A;  3U2T A;  1FR8 A;  3E25 A;  4FRP A;  5CMI A;  2RJ4 A;  4P02 A;  4HO5 A;  1K4V A;  1VGT A;  4D48 A;  5L6V A;  4M2B A;  2YQH A;  4EE5 A;  2WEE A;  1Z90 A;  4G3P A;  2YC3 A;  1NMM B;  3F1C A;  2VS3 A;  5CQL X;  1G97 A;  1QGQ A;  3N9W A;  1O23 B;  5IDT A;  2QKX A;  3I0G A;  2O1F A;  2OI5 A;  4EEG A;  2I5E A;  3SXG A;  2X5Z A;  5BXC A;  3CKN A;  4AAW A;  1S4P A;  2VSH A;  1ZCU A;  3SXE A;  1H7G A;  3V8Z A;  1HJL A;  2C0N A;  4KXO A;  4Y6U A;  4XWI A;  2RIX A;  1PZT A;  4E1K A;  2Q4J A;  4J18 A;  5C4F A;  5C36 A;  3PKP A;  3JTJ A;  4HG6 A;  1LZ7 A;  4KPX A;  5CQM X;  3RMV A;  1O7Q A;  2XWM A;  3I0I X;  1G93 A;  2RJ8 A;  3ZLK A;  5IDS A;  3KIA A;  3SX5 A;  4HOC A;  3SXC A;  2RJ0 A;  1MC3 A;  1G8O A;  2D7I A;  1WVC A;  2Y7A A;  5C38 A;  2QGI A;  5C8R A;  3SX7 A;  3U0Y A;  1FZW A;  3ZF8 A;  3GUE A;  4IRQ A;  5FU8 A;  4DDZ A;  4ECM A;  4M28 A;  2YCM A;  4G3S A;  2FFV A;  1VIC A;  4EEA A;  3OH0 A;  2XWN A;  5L6S A;  2WAW A;  3U2V A;  3CKQ A;  1H3M A;  4Q7C A;  1ZJ1 A;  3OH1 A;  3T7O A;  3V0L A;  1H5R A;  1QWJ A;  5CMH A;  3USR A;  1JYK A;  4B2X A;  4CJC A;  2W0V A;  1ZJ0 A;  1HM9 A;  3O3P A;  1OMX A;  3OH2 A;  2XME A;  1V83 A;  2P72 A;  1S4N A;  2RJ7 A;  2W0W A;  4FRL A;  1FXJ A;  1ZJO A;  1LVW A;  2VS4 A;  3POL A;  1R80 A;  4FRM A;  4KC1 A;  1H7Q A;  5JQQ A;  1GA8 A;  1ZI4 A;  4FCU A;  5C3A A;  1JVD A;  1TVY A;  1WT3 A;  1ZCV A;  1G0R A;  2APC A;  3CGX A;  5C1G A;  1VGU A;  2YC5 A;  1HV9 A;  1JV1 A;  3Q4S A;  1VH1 A;  4KC4 A;  1IIM A;  1G95 A;  4NAN A;  1H4E A;  5I1F A;  4LW6 A;  2FY7 A;  2ZU8 A;  3BRK X;  3USQ A;  1VH3 A;  4CJB A;  2J0B A;  1H5S B;  2V0L A;  2VFZ A;  5CMG X;  1S4O A;  3OH4 A;  4HO9 A;  4FIX A;  4L41 C;  2A8U A;  2AGD A;  3R3I A;  4FRD A;  1G1L A;  2MZB A;  1JYL A;  3Q80 A;  4D11 C;  2YES A;  2D0J A;  1TZF A;  4KNR A;  3OH3 A;  1ON6 A;  4B4B A;  1GWW A;  2DPW A;  1H5S C;  1V82 A;  2JCL A;  4CVH A;  1ZI1 A;  1GQC A;  2BO4 A;  5HS2 A;  5CMJ A;  2E3D A;  3F1Y A;  1ON8 A;  1ZJ2 A;  5FYE A;  5EJ1 A;  5IFY A;  2RJ6 A;  1YP2 A;  2XMH A;  3SXD A;  4KNX A;  3JUK A;  4KRV A;  3OGZ A;  5C1H A;  3BCV A;  2YQC A;  4KQL A;  5FTV A;  2XWL A;  3DK5 A;  4FRA A;  3SPT A;  1R7T A;  2AM5 A;  3V90 A;  3T7M A;  5FUH A;  4Y7U A;  4B2W A;  4ASJ A;  2OI6 A;  5CQP A;  1QG8 A;  4FRH A;  3D8V A;  1R81 A;  2QH5 A;  4O6N A;  3QVB A;  3E26 A;  5D91 A;  3I0E A;  3FOQ A;  2VD4 A;  4NAK A;  1FGG A;  2ZU9 A;  2OEF A;  1R7Y A;  5C4B A;  3V0O A;  4AC3 A;  2WVL A;  5C4C A;  2Y4J A;  1MP4 A;  1WT0 A;  4D0T A;  4ARW A;  3V0P A;  1NWG B;  2PA4 A;  4M4K A;  4UEG A;  1PZY B;  4MND A;  1LL3 A;  4GBP A;  3SXB A;  3RSB A;  1XHB A;  4Y9X A;  2JCK A;  2V0K A;  5C49 A;  1QGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...