2I7GA

Crystal structure of monooxygenase from agrobacterium tumefaciens
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
344
structure length
344
Chain Sequence
b'GMELGLYTFADVNPNPADGRGPEGARRLRELLEEIELADQVGLDVFGLGEHHRPDYVVSSPSTVLAAAAVKTKNIRLTSAVSVLSSDDPVRVFQQFSTVDLLSNGRAEIMAGRGSFIESYPLFGYDLEDYDVLFAEKLDLLLALREQEVVTWSGTKHPAINGRGVYPRPLQERLPVWIAVGGTPQSVARAGAMGLPVALAIIGGEYRRFAPLFDLYHEAARRAGQEKTKLRTSINVHGFIADTTDKAADQFYGPQAEVMNRIGRERGWGPTNRAHFDAARGPEGNLFLGEPELVAEKIIKAHGVFKNDRFLLQMAIGLMPHDQIMRGIELYGTKVAPLVRKELT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monooxygenase
publication title The Crystal Structure of Monooxygenase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Oxidoreductase
total genus 123
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 2i7gA00
1Z69A 3FGCB 3B9NA 3B4YA 3B9OA 1RHCA 1M41A 1F07A 3C8NA 3FGCA 1BSLA 4J2PA 1NQKA 1EZWA 4US5D 1LUCB 2B81A 5AECA 3SDOA 2I7GA 3RAOA 5LXEA 1BRLB 4UWMA 1NFPA 1YW1A 1TVLA 1LUCA 4US5A 1BRLA 5DQPA 1FVPA 1XKJA
chains in the Genus database with same CATH superfamily
3IK4A 4QJ4B 4RXGA 1EB3A 1S2UA 2Y5JA 5CPNA 2GGHA 4GIEA 1S1PA 1J2BA 2W91A 1KWGA 4QIUA 1E73M 4ZA0A 3HBLA 2X09A 2WKGA 2YKKA 3MHFA 4AWUA 4US5D 1WB0A 1BRLB 3B0PA 2VD8A 4JBRA 4KCTA 5A6JA 4FOUA 3IGSA 3UWQA 4A4AA 2O7SA 3MYPA 2FFCA 3FAXA 1A5UA 4IUGA 3BLLA 3QMRA 3NM1A 1X7FA 4RPPA 4FOJA 2GGEA 2JKPA 2RAGA 3AAMA 2V81A 4CQBA 2VUYA 3TA9A 2E40A 4EAMA 3MQTA 3NA8A 3W7GA 1HKKA 3NQDA 5FF2A 3F4WA 3MBFA 3P8IA 3DEQA 3A3HA 4F9JA 1TVNA 3ANUA 2QUTA 1X1ZA 1JZ4A 4FNUA 1FKXA 4PSRA 1XQKA 1NQ6A 1J5SA 2HV5A 3NPUA 3TJLA 3N34A 1TTIA 1OC7A 3CEPA 3C61A 4UTTC 1QI0A 2OZ3A 1P1XA 3VNZA 3UZWA 3WBEA 3IIZA 3ITYA 1PXGA 3E5BA 4RK8A 5I23A 1QO2A 1A5LC 3W1AA 4JTJA 1CXLA 3O1NA 1H1NA 4HKPA 3MTWA 3UPBA 3N4AA 1OYBA 3PG9A 1R3SA 3LLDA 3SUWA 1O66A 2X1UA 2QGYA 1ZPTA 1JZ3A 4OIFA 5AHEA 4XO7A 3ZWSA 1KNWA 2DSWA 1X1OA 1Z7AA 4DZHA 2ZXQA 5A6BA 2OX1A 4PBGA 1PPIA 3M5YA 2YXXA 1TWWA 2PE4A 3TNBA 2UWFA 3AQUA 1UG6A 3QHMA 2R6OA 1S46A 4OZOA 2V67A 4ENLA 3AHYA 2FQIA 3GXMA 2TYSA 1W1B1 1E9YB 1JXKA 2BY3A 3MCMA 3MV01 3FA4A 2VDGA 3R8HA 4AZGA 3HGJA 3RR1A 2XU2A 2PRHA 3NQEA 1WYIA 3OQEA 2QNEA 1PZ2A 4H9XA 4BZYA 4G6CA 4FLRA 3P5ZA 3LPFA 3WJWA 1OBAA 1AD4A 4CVUA 1T5AA 1QPQA 1WNOA 4N0RA 4RZ4A 2FTYA 2VD9A 3GYEA 4EAYA 4MUPA 1VJZA 4QDMA 5C9ZA 1MQQA 2O0TA 2WNWA 1OM0A 3WG6A 4QRNA 2RH9A 4LY4A 2C0HA 4DJFA 5AHMA 1LLOA 2GL5A 4WF7A 1RH9A 4N9CA 3GDRA 2WHJA 2WLYA 1KR1A 1OIMA 4D8LA 3HN3A 4LCRA 5D8ZA 3L2IA 1OT1A 3WX7A 1TPWA 1H63A 2QUMA 4Y90A 1TRDA 2NW0A 1BFNA 4H2HA 2PWFA 5CQ1A 4FAMA 1FY6A 5H2ZA 2EXOA 2VFHA 4NF7A 3LD5A 1R2SA 5M5DA 3V5FA 3RMJA 5HAOA 1QW9A 2QUUA 4UQAA 1JDEA 3VD5A 3PBYA 3MUCA 2P8BA 2DSUA 3T07A 2DIJA 3WMLA 3T4CA 3VIMA 4IFRA 2G5WA 1XYCA 1XH2A 4O50A 5DN1A 4U10A 3IGHX 2QDHA 5KINA 2HNHA 5CC7A 4UTLA 1DIDA 2WNQA 3NZQA 1R3RA 2DW6A 2VZOA 1HN1A 2DZVA 4LUSB 2E68A 2C16A 1KLZA 2ZUUA 3TVAA 1E71M 3KBNA 2HVOA 4UTHA 4DUOA 4MMWA 4J2PA 4GI9A 5LXXA 3PFMA 5I24A 2VGIA 3S9IA 1NARA 1O5XA 2P53A 2C91A 1YNYA 5HPOA 5GQBA 3KUMA 4H8NA 4QG6A 1MNZA 2WCGA 4KWWA 2CW6A 5CZSA 1UASA 1S1RA 3BG3A 2J7DA 3W1TA 2FTPA 3ZVHB 2VTFA 4XAPA 5TBOA 4BEUA 3USBA 1EUNA 3ZXWA 3MMTA 4UTWA 3W7QA 3EKGA 3BLEA 3RITA 4AY7A 4GHRA 3RO6A 2YIHA 1X98A 1GOWA 3DG7A 1HIZA 2WAGA 2Q01A 4GKLA 2F6UA 3GC4A 3MCOA 3CIXA 4S3EA 4WGXA 1OC6A 4Z2GA 1H7RA 1FXQA 1DBTA 1LQ0A 1WAUA 4KRTA 3ARUA 5M1TA 1J9YA 4RDYA 3K5XA 1PKYA 1GQIA 6XIMA 1NDWA 5E0KA 3GKFA 5IFPA 2VP8A 1N8IA 3T0AA 3V16A 2OJPA 1YE6A 1K8CA 1E6QM 1FCBA 3SQLA 2Y70A 4OV9A 3GTHA 4E0CA 1NDZA 3CASA 2GSJA 3O8AA 3OW1A 4OJYA 4GUFA 1PX4A 3U2OA 3W3OA 3VD4A 3M1ZA 2F84A 2A5HA 4O53A 4IIDA 2QCLA 3FYOA 4R33A 1DXFA 1V08A 4XZIA 3TSBA 2W62A 4J9JA 1F9CA 2JF6A 4KFPA 1DP0A 4DVOA 5D4YA 4PMXA 1A3XA 3S9YA 5E0FA 1TJ0A 1MDLA 1ZALA 1MRAA 2QJJA 3ANVA 4CLMA 1V5XA 3MHGA 4KMQA 2DEPA 2G3JA 1XUZA 1C9WA 3SUSA 3OG3A 1TB3A 1MEIA 3FS2A 3FCPA 3EWCA 3RLGA 4IGSA 3P62A 4U31A 4H9UA 3N6JA 1ZCOA 5F2MA 2WC3A 3N2XA 3CL7A 1W6TA 3MHUA 3BQ6A 3AC0A 2VFEA 3UY8A 2WQDA 3WDRA 4X61A 1J10A 2UV8G 3BW3A 3NSNA 5LIUX 1TR1A 1G4SA 1OG0A 3IRSA 3C8FA 3WH8A 4ZOEA 4K68A 4AHPA 4F2UA 2ZUSA 3AISA 4OE7A 3MPGA 2WNNA 4GMEA 3IEBA 4RW3A 2NSXA 4GZ7A 4PGLA 1JF6A 2CBVA 1VD6A 4N9BA 3I3DA 2C71A 7XIMA 3G1XA 1NDYA 4XZNX 4EACA 2QDGA 1VBJA 3R4IA 3APTA 4CNUA 1VHNA 5DCEA 2QGHA 3WLLA 2J9YA 4K8EA 3MMUA 3V0SA 5DX7A 3IACA 4DO6A 1J12A 5EMKA 3MP5A 4ACZB 4O1EA 5C0QA 1LDCA 1F5ZA 4MHBA 3MMDA 1VH7A 4MLRA 5E9XA 2VURA 4ROPA 1W2VA 2JKAA 4K37A 2PB1A 1ZCCA 1ZJIA 3LCXA 1US2A 1L2UA 3VDAA 1ZGDA 3AS1A 1A53A 4H6RA 1E6SM 4Q8OA 2GSHA 3UZ5A 4C6FA 1GNXA 1ALDA 1OGBA 3KDNA 1I2PA 1U5JA 3WQ6A 2HSAA 3TONA 3CZ8A 4DYJA 1DTNA 2CZFA 4YMZA 3NURA 3VMOA 5HQLA 1PIFA 4JS3A 1Q85A 3O0FA 5E09A 3B0VC 5DRCA 3TJXA 1DTUA 1TPUA 1QK2A 4UNKA 1BF6A 3QTGA 4UOZA 2YDSA 3WBXA 4EANA 3M5XA 5LYRA 1B5TA 1E1FA 3DYOA 2PI6A 4O12A 1BAGA 3VDGA 3SAZA 3BGJA 1FH7A 4PUDA 3VGBA 2XG9A 2ALRA 2Z1KA 2ZWYA 3ZSTA 4HA0A 1C8YA 3ANYA 1AH3A 1CZ1A 3S6TA 4UTTA 1EJWC 4FXFA 4MFEA 2GWNA 1XLFA 1GWJA 1MSSA 3EOSA 2QPXA 9RUBA 1QI5A 2AL1A 3NSMA 1I2NA 4PMQA 2YZRA 4HD5A 2E9MA 3ITOA 4NXKA 1M53A 3M4HA 5KETA 3HURA 3L0NA 2ZTJA 4HMNA 3OA5A 4KESA 4BCEA 4M82A 1XIGA 2D2HA 2ZQ0A 5D32A 4CNSA 3CHDA 1BYDA 2XM2A 4QBXA 3A12A 1TIMA 1HKWA 4L4MA 1I75A 2BHZA 4GQ0A 3E0VA 2Y7GA 4M8UA 2WMFA 1Y7VA 1R6WA 2ZX8A 5CPOA 1PX8A 1TCMA 3V18A 3POHA 1H7NA 4AVOA 1EX5A 2C18A 2FGZA 2WW5A 4UMAA 2CZEA 4RZBA 3NTYA 3FJ4A 3GDMA 2BFGA 5LNWA 1T7LA 2CBJA 4AXKA 4H9MA 3PZNA 2DJLA 3UD6A 3QFWA 4ZQOA 4F40A 1P6WA 1G0CA 1CW2A 2KX9A 3S2NA 1A5KC 4F0LA 2OFJA 3PP7A 2NQZA 1F74A 4JCMA 3EMZA 2OOFA 4GO9A 1NP0A 2XSBA 4AD0A 1LUCB 1ME9A 3FYPA 2GVYA 4ZTXA 3M0KA 3P84A 3TLQA 3WK0A 1H51A 2QPUA 5FF3A 5BU9A 3LCGA 4IIBA 1DIKA 1UR4A 3H23A 4LYPA 4REQA 5AZ0A 4GOAA 2J66A 3BAIA 3S83A 2EPNA 4LY8A 1KBJA 3KM8A 3N2MA 1XIBA 3VUPA 1LLZA 2ZA1A 4IP4A 4QR6A 3UG8A 3E2SA 4XIAA 1DJYA 3GHRA 3GXTA 5HPCA 2W92A 4NRRA 3FY1A 3XISA 1UC4A 3QFEA 4W86A 4DZAA 4QG8A 5HR7A 1E0XA 1F2JA 1CPUA 3W86A 1R9YA 4GD0A 2QV5A 2Q8LA 4K7YA 3HGOA 3MW7A 1DE6A 4S3JA 1O5KA 2NUXA 1EHAA 5A8GA 2VL4A 2NXHA 3Q2DA 3S5OA 3M0YA 1ADOA 1W1A1 5LIYX 1M7JA 2JGQA 4UCGA 1T8QA 1PO9A 3WLQA 3B9DA 1KCZA 3S5NA 2D69A 3JZUA 4O0KA 1Q6CA 3C0JA 3W6LA 1XPGA 1KCKA 2FZBA 4LUYA 4N42A 1U1UA 1FFQA 4BF5A 3W7DA 3LEPA 3N11A 1EH9A 4E2OA 1EDTA 1O7AA 4BK9A 4HSHA 1TMLA 2OU4A 2VCCA 3M9YA 3SFWA 3B03A 4JL2A 2DZSA 1I1XA 4BEQA 1S3TC 5DY2A 1KBKA 1TV5A 3WD3A 3W37A 1V77A 3O7UA 4FXRA 1XIJA 4Q4OA 3T44A 3B0YA 3QEZA 4IOTA 1VZWA 2EKGA 2H8XA 5IRPA 1DWIM 2G8ZA 4DJDC 4JY8A 1XIDA 4UQ9A 6ENLA 3EXTA 3URBA 4LBSA 3UWVA 1W1IE 3PB0A 3DKJA 1BTMA 4L9ZA 4GX8A 2EPOA 3TTYA 3IANA 1UWQA 3S1UA 1M03A 1MWOA 4NAEA 1QOPA 5IM51 2Z27A 1O95A 1KFLA 2EJAA 4BR1A 1V7AA 2DT3A 4PFHA 5D2TA 3HO8A 1VHCA 4PRTA 1BXNA 1KRMA 3GO2A 2E6AA 2ZVIA 4JX6A 4NAFB 2PDQA 4O16A 3C3UA 4W84A 5J04A 3Q4DA 4MADA 1R5YA 3UA3A 3VFLA 4R7OA 3T2QA 5EMLA 4DF2A 3RU6A 4MZ1A 1ITQA 3M16A 3HQOA 3WH7A 3WQ4A 5HDRA 3KBJA 1RCXB 2FLIA 3ARVA 5G4HC 1QFEA 2NX9A 1JCJA 2ESCA 4GUGA 3FIGA 4AD1A 3USZA 4NJIA 3SY5A 3JR2A 2XISA 3T2OA 1J5TA 5B7ZA 1I60A 2F61A 2XM1A 4ZQCA 3W01A 4A8NA 4O14A 2DZUA 2QJHA 4WXZA 3EWUA 1KM4A 3KOFA 4F0HA 3NQGA 2G0WA 3ICJA 5AKQA 2VZTA 3UESA 2ZXAA 2PDPA 2V6AA 3H22A 1O5QA 4ADUA 4KWVA 3VAVA 1DJXA 2ZUNA 3NYDA 2BS9A 1EYEA 3L2LA 3VDBA 3ARYA 3W7JA 3TR2A 3PZTA 1FP9A 5LA0A 2Q8ZA 5JBFA 1GVSA 1A3WA 4FSAA 4H8UA 2Y62A 2I5GA 4DXVA 4EPEC 4O11A 1W3LA 3LYEA 1YPIA 4ZO9A 8XIAA 1DIEA 4EP8C 4QQ3A 3NDYA 1HJQA 1PWMA 5DCBA 4TXEA 4DWSC 1UH4A 1VPQA 1CX9A 4UMCA 4YIWA 3BC9A 3T9PA 3ES7A 1FH9A 5BMXA 2GOKA 4C5ZA 5F2LA 1FFRA 3D0CA 3G3DA 3TH6A 1OX4A 3EXSA 3H21A 5K2ZA 3R25A 1FCVA 4IMDA 5D8WA 2KZHA 4PUEA 3WIJA 3CV7A 3RX4A 1C8QA 3PTKA 1QMLA 2OVLA 4QAWA 4EE9A 3UVAA 5AYZA 1H7WA 1ME7A 3EA2A 2YCEA 3WJYA 4CU8A 3C8NA 3E1F1 3FGCA 3OODA 4IG2B 3PF3A 4AX6A 2Y4SA 2AOSA 2F9RA 1PS9A 1PKLA 2DU2A 3G18A 1L6WA 3LHWA 2A3AA 3HFTA 2QF8A 2OLSA 2NLYA 4MWAE 4QE1A 5D2WA 3AI0A 2DT1A 1TPDA 4JKMA 4QDWA 3SCWA 3FEMA 4JTAA 2FGBA 4B2DD 2GSEA 4U2ZA 1FA2A 2QJNA 4NASA 4X2PA 2GDUA 5ABTA 4NZ4A 4LS2A 5D09A 3KRZA 4MAZA 1ZUAX 2BODX 5C7HA 5I7GA 3RGTA 3VNJA 2QR6A 3DIPA 3AXHA 1ZLPA 4MFDA 1V7YA 3CB3A 4W87A 3MC5A 1ONRA 4R27A 3ZJKA 3G6LA 4GISA 2D0GA 4AD3A 3WLOA 1DHKA 3HIJA 1FTXA 3I6RA 1V93A 4AZCA 4IIGA 5C54A 1LWIA 4IHCA 2QAFA 4J3ZA 1K8XA 4O54A 2OLAA 3EX1A 4JOMA 3MS8A 3RF9A 4NXSA 1T41A 2HNEA 3KDOA 1JYNA 5FEZA 1Q2SA 3NZGA 2WLZA 8A3HA 1K7FA 3R94A 1PCKA 4A2RA 3QOMA 4RV3A 1G7UA 3WK2A 3LV5A 2PDKA 1XUUA 2PLCA 3PSWA 3WNOA 3UZZA 3BAXA 4JCLA 3QV6A 4BHYA 3TIMA 1W3JA 3CUFA 1MW2A 3HM7A 2V63A 1UWUA 3C2YA 1HL9A 1VFHA 2AAMA 1UOKA 4JTUA 1OABA 4DF0A 1K7EA 1G6CA 1JZ2A 4MG4A 3CC1A 4JR5A 1XLJA 3IARA 1XLCA 2A3EA 3MJYA 2B81A 2OELA 3CV2A 4GJJA 3S1XA 4YNGA 2PU1A 4IJRA 1AW2A 1V6TA 3ELFA 3RYSA 3LBOA 4H2CA 4B5VA 1FRBA 1VFLA 4PTVA 4FMVA 2DZTA 4V1YA 1OYAA 4QNWA 3TW7A 4BKNA 2X0HA 3QQ1A 2XTKA 5DMNA 5I00A 2O9TA 1WDWA 1VBGA 1IIHA 4XV0A 3WDIA 4UZSA 3MSDA 4ZE5A 2X2YA 3GDKA 4XZ9A 2Q09A 3B9AA 4L1WA 1H09A 4ZTYA 3NSXA 1Q6OA 4OGZA 2PLKA 1DE5A 4AWSA 1SR0A 5IHRA 5HMEA 1CBGA 3BWWA 4O18A 4HBKA 3EDDA 3W26A 1DWGM 5C7VA 5FJTA 4PUWA 4XX6A 4LANA 2QVHA 3QOKA 4IP7A 5DBUA 2PGRA 4HJFA 1JCLA 1Y8BA 3G24A 2BV9A 1Q6DA 5BNKA 3PPCA 4N7QA 1IYXA 2HTMA 1W56A 5AHLA 2XVLA 5F4XA 5EPDA 1UKPA 1DWAM 4AYGA 2E77A 3UR2A 3UQNA 4HMEA 1J4EA 2IKJA 1B31A 4LNYA 2V3GA 5EKYA 3CO4A 2GK1B 3QR3A 4AH7A 4H00A 3LB0A 1OY0A 3MSRA 3PS7A 2X7WA 2AAAA 3CGTA 1JI1A 4P8WA 3NOEA 3W73A 3PAOA 3QZEA 4JN6A 4LC8A 1Q7QA 1US0A 1VBHA 3WDQA 1G67A 3PUEA 3HPAA 2E8YA 4EVZA 1RLDA 4Z1BA 3MWAA 1V6XA 1PTGA 2VEKA 4J3XA 3VDCA 1EOKA 3DXIA 2IKGA 4L80A 2C79A 4GZIA 3M7SA 3U7VA 4ZSTA 3ITLA 3V35A 2DV0A 2CLFA 3CAQA 1WOAA 2VM8A 3LY0A 3F2BA 3SCRA 3SN4A 1V3IA 4H83A 4MWAA 1H1ZA 5I3JA 2WBKA 4ROQA 2PC4A 1QNSA 1QNQA 3ONBA 4GH1A 4HOWA 3BLFA 4ZVJA 2DSVA 1XLDA 4W7WA 3TW6A 1CCWB 1E6PA 1TJRA 1F6PA 4XWUA 2CHRA 2HEJA 3PZIA 4PUUA 4R5EA 4HPNA 3PJTA 1E1CB 4B9ZA 1KM5A 3PY2A 3VC5A 4MB1A 4DJDA 1UQYA 2CLPA 2Q6ZA 1Z42A 3CUJA 1J2WA 1B90A 1V3JA 3GQYA 2LLEA 3GDLA 3G8EA 1Y65A 4X0NA 5JBDA 4PMZA 3T0DA 4WRHA 3NL2A 3PJXA 3GVGA 2L5HA 4OUIA 3NYZA 1EF3A 4I90A 1CGVA 3STGA 2E25A 5AYXA 1V0NA 3K4WA 4GH3A 3SB0A 1IT8A 3WQFA 4IPJA 4I7WA 3TCEA 3RRAA 3HPZA 1LJYA 3LTPA 3CEUA 2PPGA 1A49A 2NSOA 5H8MA 3CT7A 4E4FA 1TPH1 4HU4A 3TTSA 1BEUA 3BV7A 1B3XA 3FSUA 3AZRA 4GIYA 3OIXA 3HV9A 3T1GA 3N3TA 4RR4A 1RVGA 1N8WA 1B9BA 4E38A 2WXDM 4O28A 2WANA 3MCNA 4M80A 3UYIA 3HQNA 1A4LA 1K7XA 1CLVA 3OLIA 2V5BA 1XYMA 4F2BA 4JQ4A 5LXEA 4RNFA 2B4GA 1TRIA 2WWCA 3SIZA 4PBEA 4JIPA 5F4WA 2XFFA 4AXNA 1V3KA 5MKGA 2NQHA 1EC7A 4FNTA 4KETA 1N2VA 7REQB 1GQNA 3W1MA 1GVQA 1M9HA 4AF0B 5JVLA 5A6AA 3CH0A 4L9XA 2ZRUA 3QR1A 4ERIA 2DT2A 5EU9A 2G41A 2EPLX 1JUBA 2DIKA 3BARA 3R0DA 2FB2A 1EPVA 4TX9A 1JG9A 4PUNA 1NJJA 2CITA 1FWAC 5CCZA 1EUAA 1XGEA 1PTAA 5RUBA 3W1PA 1RCQA 1FBAA 3W00A 4ZSUA 2QIWA 3B4UA 4XAFA 3DESA 5LNVA 1QOQA 4DWSA 4DXKA 1RBAA 3U5UA 3NL5A 1TUXA 4GQRA 1S2CA 3IV8A 4X60A 4CQAA 4Q7IA 5BXTA 5FESA 1MO0A 2GJLA 3PN8A 4EF8A 3NFUA 3AHZA 3OGSA 1IE7C 4BQ4A 1N82A 1SJAA 1XHGA 1E40A 2J4GA 2Z7GA 2QJMA 5AC8A 5ABFA 3L67A 2JQXA 1OD0A 1LZOA 3NQ7A 3M6YA 5A6BD 2E7FA 1Q65A 4DY1A 4MNKA 4XZWA 3ATYA 2BP1A 3BAKA 3SGZA 4HNLA 3SGUA 4QJ5B 3V5OA 4F0MA 3QW4B 1GYNA 3C6CA 1DYSA 3MO7A 3RX2A 2X1IA 2DUZA 2X1SA 3SSZA 1XLAA 4IQEA 3UEQA 1CB2A 3UJEA 5BROA 4F8XA 3OZYA 1WKDA 3TDFA 1K4HA 1TPFA 3A9IA 2ZX7A 3T2PA 4EPKA 5CPTA 3Q37A 2WKLA 4JN8A 3WQEA 1U2YA 1HGWA 1IV8A 5HJXA 2C1HA 1W9PA 4Q8VA 4IMFA 4CNTA 3QYQA 1B57A 3ZJ8A 3CT2A 4GYJA 4B4FA 5D9NA 4DJFD 5FF7A 1XIFA 3NO1A 2CLIA 4JDBA 1WXYA 4Z1DA 4TQTA 2WOQA 1SW7A 2Y5SA 4B5SA 4KIRA 1XYZA 2HE8A 2HS8A 1CENA 4R9OA 1AL8A 3KOYA 2NQJA 1V0KA 3O0KA 1H0GA 3TNOA 2Z1VA 1V8EA 3W9ZA 1XPYA 1ZQ5A 2OYKA 3TKFA 4KEMA 1FUYA 4WSJA 2BGQA 2IKHA 4PRRA 1IEIA 3TQVA 1S39A 4Q4RA 4LH8A 1PYMA 4K6AA 3GR4A 3SCPA 3LCWA 4IPNB 3PZMA 2YFOA 2V3EA 4L9YA 3C2FA 1DEDA 3AXMA 2G3MA 4NG3A 3GD6A 2QAPA 1PL9A 2QCHA 3T42A 1EC9A 1W1TA 1AW5A 4JY9A 2C0AA 3M0IA 3GYCA 3K30A 3AICA 1TPC1 1LBFA 1Q8AA 4EKJA 4O1FA 2BGSA 4KCVA 2XUCA 1H5YA 4DJEA 1W32A 2BVDA 4X9SA 4OV4A 3WFZA 3RK8A 3M5VA 1UZ4A 1JCXA 3RAOA 1SO4A 1CT5A 5LHEA 2Y7FA 4XVEA 3H2FA 4Y2WA 3NPWA 3VIJA 4GYKA 3OJGA 3UCCA 1OCBA 4KEVA 4O1BA 4XBKA 4PEKA 4CEXC 1IEWA 4LSBA 2C1GA 3GHTA 1M68A 1BXBA 2ZUWA 3C2OA 2YCJA 3W83A 5CLTA 1ZHAA 3VM7A 5SWUA 1X96A 1UR8A 3W1XA 1S5TA 4UTIA 4M7TA 4ONVA 1A5BA 2PDNA 3AYTA 4PA8A 4B92A 2GJXB 1N8FA 4FEZA 3GB6A 2EPHA 3GNNA 4FNSA 5HNUA 1V6VA 4F4RA 2GGGA 2QJIA 2A0NA 1AG1O 3AUJA 3C2EA 1XXXA 3S42A 4GGBA 1BSIA 4DRSA 4E5TA 3B8DA 3CQ0A 2QDDA 3WNKA 4QLKA 4PUJA 4D6HA 1LBLA 2I17A 1YBQA 4W8LA 4HK5A 3L5MA 2QF7A 4HCLA 1AL7A 3LNPA 3OGRA 1C93A 1B4KA 2VQUA 2YBTA 1PYFA 5AHFA 4A8RA 3SZ8A 3HF3A 4ATWA 4CD4A 4PCSA 1J8VA 1OINA 1K03A 4MJZA 4LYQA 3EOLA 3ZQ9A 1UR9A 1NDVA 3GWQA 3RUBL 2FPYA 1XQLA 3ME3A 4GPNA 2W63A 2HROA 3W76A 2E0PA 2ZRZA 1CGTA 3TC3A 4ZB2A 5EMMA 3L23A 4H19A 3H8AA 1RV8A 1FHVA 1FHLA 1E6ZA 3SRDA 1MXSA 2XN0A 3CXOA 4NJKA 4LV4A 1C3FA 3W75A 4B5NA 1P0NA 1FXPA 1OF6A 2WM1A 5EYWA 2VFIA 4DI9A 2PP3A 4Z0JA 1S5MA 2ZZ3A 1K02A 2ZIDA 4C6OA 4MF4A 4WVXA 1LG2A 2CESA 4WLCA 3H24A 3EA1A 2E67A 4Q7BA 3LHTA 1QNRA 4O0ZA 3TWBA 1W1ZA 5IBXC 3U48A 1D3CA 5D9PA 4O4WA 5A8NA 1E6RA 2R9RA 3GNXA 3TOPA 4U4MA 2WMIB 5EL1A 1PZ0A 4KFNA 2WPBA 4OHQA 3KL5A 3JZEA 3W25A 1B3VA 3HA1A 3W02A 1G5AA 2MANA 3ZZ1A 1EL3A 5K7JA 3GTNA 1NVMA 5A6MA 3L4VA 1QBAA 2FPTA 2A6NA 4FS9A 2V5DA 5T26A 1V79A 1QDSA 3GU9A 4MPQA 2JKEA 4CCEA 1OFRA 4AY8A 3KRBA 4AG0A 1X97A 4E3VA 3LZ3A 3PJUA 3VGDA 4NX0A 3GTIA 2QV4A 1RVKA 4LV9A 2VDIA 4MAVA 4OTKA 3QV9A 2BDQA 5KZDA 2WMGA 2RGLA 1SZFA 4HJWA 3AFBA 2W66A 2EF9A 1O5RA 3B8SA 2A6LA 3BMVA 4LUTA 3S46A 3U4FA 3IJDA 1UR1A 2VC6A 3VKBA 4OVXA 4Q4PA 1TMHA 1Q2RA 3H4GA 1JPMA 2CERA 4J3SA 4JD4A 5HMSA 1POKA 3IIOA 2PEVA 3NEVA 2XFWA 4WJXA 3MB9A 4PB4A 4DO4A 3NXFA 4HIBA 1R86A 4B15A 3SN1A 5MHBA 1E4IA 2PGEA 5E93A 1PV8A 3I6TA 3ZSSA 3UWEA 3H4WA 1QI4A 4AZ5A 4LQ1A 3UXAA 2BVWA 2GPTA 1X6UA 2AQVA 2A3CA 1DXIA 3AIQA 1VCGA 4CCDA 4AEFA 1JEZA 1VIWA 4RW5A 2NWSA 3MP4A 1TX2A 1WX0A 3N04A 3V36A 1SZGA 4DHGA 1UUOA 1PZ1A 2CHOA 4GE8A 3VIGA 1UC5A 1Z3NA 3KRUA 2J7CA 1AFSA 5KITA 1ZY9A 4AMAA 2PDFA 4MPKA 2IQDA 4F2TA 2QW5A 3G0SA 1DPMA 3FKKA 4LUIA 3R13A 3WSUA 1QO5A 1NSJA 2UY4A 3I6EA 4M5PA 4JHOA 3TYZA 3VKAA 3G3MA 1GOOA 2Y63A 2YXOA 2RGMA 4GFSA 1EF2A 4P7QA 3I10A 1SGJA 1IZJA 4CQDA 3F5KA 1JUEA 4UFIA 4GVFA 1E56A 3KCJA 3APYA 1ITXA 2BWGA 3WLRA 3GW3A 2PSNA 3M0HA 3P3BA 4U2YA 1D7FA 3VGGA 2BXVA 3M64A 1OWQA 2F2HA 1FCUA 1E1EA 1TFVA 3V7PA 4ZOBA 1CXFA 3L4UA 1H61A 1QXLA 3CL8A 5A6SA 1EP3A 1IZKA 2NXIA 3SUTA 3F7JA 5HQMA 1EX1A 3LMYA 3KHDA 5CJ5A 2Z2UA 1VKFA 3QHOA 3DI1A 3GVRA 1G4TA 3VX0A 1JDCA 1XD0A 4CN4A 2A85A 4U28A 4C7DA 2DGAA 1SU5A 3TV8A 2A4AA 4KWOA 3V75A 3KAOA 4XUYA 4ATLA 3EAUA 2Z1XA 4F0KA 1I2QA 4JTCA 2BBFA 3GR7A 1BTCA 3NXLA 1EO7A 2I5IA 3U9IA 3U6WA 2AGTA 5G2IA 1W17A 1PHWA 4V28A 3N13A 4DELA 1J93A 1L6YA 2HMCA 4UFKA 1L8NA 1I4NA 4LALA 3W82A 4PMDA 5L6UA 3PZGA 2FH8A 1LF1A 1HUVA 1F6YA 1ZZMA 5KMYA 1UD5A 3TSDA 4JTQA 1GYLA 5CSYA 4IPLA 3N2BA 2FHBA 3BH4A 3E5PA 3NWRA 3NCOA 1FWHC 3PB2A 1DQXA 3BTNA 3I3BA 3WQPA 1VR6A 4JIRA 1FWSA 4EXBA 1Q4WA 5AC7A 4ORIA 5C9WA 3WLNA 4UNIA 4Z2IA 4FNRA 4M6PA 2EG8A 3HG4A 4YS1A 4DN1A 3PTMA 3ZM8A 4XB3A 3WUGA 1IEQA 1LROA 3FJLA 3G77A 3GBEA 1ISXA 1E9ZB 3GW0A 1GHSA 2V3FA 1VCFA 3R58A 4GACA 3CAWA 5K9DA 4Y9OA 2NQ5A 1ISZA 3CUGA 1XLGA 2J25A 1VEOA 8XIMA 5LKYA 5F1VA 1J11A 1OFOA 3TQKA 2HXUA 3IIPA 3A24A 1TV4A 2BLEA 3B8TA 3S6OA 1OQFA 2XGZA 1UWSA 3MI3A 3PZQA 2XSXA 3A4WA 3LSBA 4HPXA 3VC6A 1V6UA 3KOWA 3GKAA 3K13A 4NX5A 5KSWA 3ABSA 3M6DA 2OZ0A 4AVFA 2BHYA 3S1GA 4ZOAA 7TAAA 2DUXA 4ZCWA 1R0MA 3LRLA 4LTSA 5D03A 1PWLA 3TN6A 4FX6M 3BLOA 3N4FA 4N4PA 4M19A 1DJZA 3FA3A 3U0HA 3E3HA 7CGTA 2ZZ6A 1H3GA 3A4XA 5H6HA 3ZT6A 2ATSA 3FJ6A 2CLOA 5A3HA 5AC5A 1WAWA 1XISA 2V82A 1H0IA 3TN5A 4NVTA 1HNYA 2RDWA 1B3OA 2ZX9A 3W88A 5CXPA 2VFDA 4W7VA 1CDGA 4ZO7A 3KVJA 4PUKA 3ZR4A 3IAPA 2NVDA 1YHTA 4HZ7A 3SO7A 4WKFA 3B06A 1KRAC 3KP1A 4WY0F 4MKVA 4V2XA 3CIVA 1E6NA 4DM1A 4IIEA 4JTIA 5D02A 3B9OA 4GUIA 2Y6ZA 1B0IA 3HQPA 2OWXA 3W38A 1Q8JA 2OODA 3D3AA 1XSJA 1KXVA 2PCQA 4Q8QA 2PWEA 4C6JA 1HW6A 1XD1A 2E1DA 2I1OA 3KLLA 2OCZA 2NQLA 1KR0A 2I57A 3VCRA 5FF4A 1PKNA 3T05A 1K9TA 1NU5A 5ABEA 1EP2A 3MKKA 2A3LA 4A21A 5DXXA 5IXEA 3LZ5A 1GVFA 4YU1A 4US6A 1DJWA 1S5VA 1FWTA 2ZRWA 1ODZA 2TMDA 1XBXA 5D04C 2ASHA 3N14A 1I0DA 1FCQA 1TV3A 4RNIA 4Z2KA 4RV8A 1TV8A 1VJSA 1XLBA 4X3ZA 2XYLA 4ZR8A 4DM2A 1XC6A 4H04A 4MDPA 1XH0A 3PAJA 3TWAA 3ZIZA 1YYAA 3WBAA 1JQVA 1K6AA 4GJ1A 3WMCA 1EFZA 3FLUA 4FIRA 1C29A 2QUVA 1UMYA 5E5CA 1RPXA 2XFRA 4D1IA 2B7QA 4HZMA 2J9ZA 1FH8A 2ZXBA 3AO0A 4KCUA 1KTBA 1JDDA 5CBIA 1DORA 1BXCA 5HMFA 2GVGA 2QVNA 2X0YA 4BI7A 1ZAIA 4KH2A 3W2UA 3AS3A 1SO3A 3QJAA 3GNOA 2IS7A 3VIKA 3VINA 1CGUA 3BOFA 3LU2A 5CG7A 4GVIA 5I3GA 5BRQA 4HVXA 1T99A 3NL3A 1FWDC 3RPMA 1RJQA 1O12A 1A5AA 2VZVA 6REQB 4M24A 4Q8PA 5AZ1A 1ZFJA 4IJCA 3S47A 3F4CA 3MO4A 3WEMA 1DJNA 4H3DA 2XPKA 1C92A 3QXBA 1K9EA 1BYBA 1XDLA 3UJ2A 2WZEA 3T8LA 2ZUMA 3REQB 3CQJA 4GCXA 5CZTA 1GT8A 1EXPA 3NVTA 3P74A 5C2GA 1BF2A 1EGMA 2Z1WA 3BO9A 1AQFA 5HATA 4AW7A 4US5A 3WEZA 2YDQA 1IT7A 1REQB 1LRTA 2ACRA 3DFOA 1HJXA 4EF9A 3OIHA 4Q3MA 3CHVA 1D8CA 1VFSA 5FL1A 3B9EA 4LJ3A 1TUFA 3A4AA 3TJ4A 2JK2A 1TO3A 2YCLA 4BJHA 4GBDA 1QATA 5GPRA 2JEQA 4ZBCA 3D47A 2ACUA 4OBTA 5LSMA 5B80A 2WK2A 4M7SA 3UXDA 1EC8A 2PA6A 3E38A 2ISSA 1W3TA 4H8VA 2VVNA 4PL2A 3HOJA 1M3UA 1QHPA 3VYLA 3LBCA 3EWZA 4HA3A 4UZUA 4FPSA 1U1HA 4MLJA 5GNZA 4TVCA 2YCIX 4GYPA 2CETA 2JIEA 4I6KA 5F4SA 2F8QA 2O4MA 3N2CA 4KW2A 3KTSA 4M3PA 2ZZ1A 2PAJA 3WH6A 3STFA 2PFHA 1E70M 2RUSA 3JU2A 4U5IA 4S3DA 1JCTA 1RPKA 2PWDA 4HNTA 1Z8AA 1LP6A 3LGDA 2V5LA 4TR9A 4M1RA 4NSBA 3BURA 1S2AA 4I5RA 1EZ2A 2BNJA 1XKJA 4ZB0A 2NV1A 3SN0A 3WZ0E 3GNDA 5HULA 2ABBA 3TTQA 1HFBA 3O6CA 4M1BA 1VPXA 2YXGA 1KM2A 3C3NA 3TYCA 4J40A 3IWPA 4B9YA 5CEWA 2PDYA 1JXJA 2R91A 5A8PA 1EKOA 2R8WA 1OCJA 4A3HA 3N9KA 3TYUA 3TQPA 3LCFA 4JL1A 1RXOB 1TWIA 5BYWA 4LS1A 4PTDA 4ADSA 1OFQA 3ABXA 4FLSA 3L5AA 3W1QA 3IJ9A 2Y5EA 1R85A 4QLLA 3UWZA 4JQ2A 1W9XA 3N12A 1Q6FA 2JF7A 3BLKA 4HPHA 1V03A 1MFUA 4XAZA 3KW3A 3WNNA 4H6QA 2VX6A 1V51A 4GGHA 3AU6A 5D33A 1IHIA 3WQVA 4HU8A 1ZBWA 3L4ZA 3TSMA 4G9PA 5I78A 3WH5A 3W72A 1OSEA 2J8TA 4CD8A 1IZCA 3P14A 3EGJA 1Y5WA 1GHRA 4E2DA 1QK0A 3DCPA 1A5NC 4LEQA 4C65A 2RJHA 4RPQA 4DO5A 1ZBVA 3UNDA 1RJPA 3F03K 4HPGA 3II1A 1XWYA 2B7PA 2G3FA 3P0WA 4M6QA 3FA5A 4WZHA 4KGLA 1EBHA 1IGWA 4LF1A 1P1MA 3PZ9A 6TAAA 4IFOA 3UR5A 4HOZA 5A5WA 1Y5XA 4IPIA 1EIBA 4XTDA 1P48A 1UD4A 3ABZA 2PWUA 2ZICA 4DBDA 3LTSA 4I7UA 3LMZA 1GJWA 1TG7A 3GH7A 1TCDA 3IAQA 3PR2A 1QWGA 1B9ZA 4Q7NA 2J8FA 1E43A 2DW7A 2VNCA 3BXWA 1F76A 4IX0A 2PF0A 4DNHA 4FO4A 3CUIA 1JAKA 5DBTA 4MWAD 1X8FA 2QS8A 4E8GA 1BVZA 3SRHA 2J6VA 4PMRA 3WNLA 1QW7A 1EO5A 2XIMA 2XH0A 3GC5A 5I5RA 3BK0A 4B16A 3N9SA 1UMLA 3VCNA 4C6BA 4B4HA 2UZ9A 4OKDA 3S2LA 1MMFA 1TIWA 4TX8A 3LGEA 1YEYA 4NJGA 4DJDD 3KWSA 2BXZA 2E6DA 2HQAA 2VEGA 4PCNA 3W7NA 2FH6A 1KXHA 2VYOA 2AMXA 4AZ7A 4K36A 2GWGA 6CGTA 2J8GA 1R3YA 5AYIA 4XD3A 2Y8KA 1W5OA 1PJ9A 3TAKA 4DX3A 1I1WA 3CU2A 4Y9NA 1OGGA 4C1KA 3VFCA 2BTMA 3DYMA 1OHLA 2P3ZA 1KO0A 1EJUC 3OLEA 4NNCA 1VGAA 1E3XA 1ZBCA 1SFSA 4Y8FA 5A2BA 4UQBA 4GI8A 1R46A 3CB8A 3KOZA 2Z29A 1U5HA 2VEIA 3QW3A 3CBWA 3A64A 3P2VA 4C6CA 1WKEA 4IWWA 4QP0A 3PZUA 5JH2A 1LORA 4TU1A 3WF3A 1TA3A 1NELA 1KFWA 2CXGA 1E51A 3WF0A 1XG3A 2J9XA 3QM3A 1I0BA 3AIUA 4KRZA 4PRWA 2VDHA 1KBBA 2DT0A 4MIMA 2Y1HA 3EWDA 1AH0A 1TE1A 3IGXA 1CEOA 3IVTA 2TODA 1NAL1 1GZGA 5AHNA 4DBEA 3RIKA 5BOFA 1KM6A 4EPBC 3O16A 3E96A 5K4XA 1VBUA 2JBMA 3OBAA 2BOFX 3EEGA 4R3UA 1K6WA 4I5UA 2CIPA 3MA8A 3SCSA 3RX3A 4CEUC 3H2OA 3DH7A 3S2CA 1LOQA 2ZZ5A 1Z44A 2GQ9A 4L1XA 5FEWA 4L6DA 2Y61A 3QR0A 2X1TA 3GTXA 3VD3A 2PGFA 1KTCA 3NG3A 3P93A 2OT0A 3W71A 1E9LA 1UB3A 3DFYA 2I16A 1OFEA 2WMJA 4LAOA 3CPUA 4Z1CA 1Q7MA 4IQDA 3DHFA 3VUSA 4YPJA 2C3ZA 3AS2A 1BPLB 3LCLA 3EZ4A 1PBGA 3LV6A 4DUWA 4HTYA 3AZTA 4GUJA 3H7RA 5I07A 4Z1YA 4J7RA 4RCXA 4UC5A 4DWSD 3CHCA 2ZX5A 2GVLA 4CKQA 3DDMA 2XH2A 1CTNA 1M41A 2PDXA 4GYFA 3NL6A 5BXPA 1SR9A 4ZFCA 1CLXA 1PKMA 4XIMA 1NWSA 1K8ZA 2NXGA 1J0IA 3GG8A 3N6QA 2YJQA 1JFHA 3OVQA 1QPKA 5FD0A 3DHUA 2ZC8A 5A6TC 2H9AA 4D9PA 3BG9A 2CBIA 2CLLA 4GFIA 4XZLX 1KBLA 4XKYB 3CMGA 3TOYA 3LQLA 1S2VA 4G7FA 3WEOA 4Q8TA 1ZL1A 2J24A 3IVSA 3P8JA 3GAYA 3SIMA 6PTDA 3FXGA 3S4TA 3U8GA 4F0SA 1J0KA 3GLCA 2NVCA 3C52A 3OLDA 2FYMA 1BRLA 1OT2A 3W2NA 4F3HA 4DUXA 2CXEA 4JFWA 4B5WA 2WPGA 3BGAA 2E6FA 5BWAA 1W3HA 3QVQA 3SFKA 4G7EB 3A5VA 1NF0A 3ARQA 2VZSA 3K2GA 5LNRA 2OEMA 4RJEA 4NHVA 1BWVA 3U4AA 4A22A 3KVKA 1JIBA 4MJMA 1Q63A 3G8RA 2YR1A 1QTWA 1S2TA 3V1HA 2VEMA 4LVDA 3K8LA 1NFGA 3CUHA 4YLWA 5CZ0A 4JGDA 3NDZA 4RXFA 4AC1X 1O1HA 3ES8A 3IJ7A 5CLWA 4MYXA 4ERAA 4KBXA 3V0UA 1QUMA 3W4RA 2A7PA 2Q3RA 4J2MA 3ALFA 4AY1A 1XLHA 4GWEA 3RG6A 2FHCA 5DMMA 4I8DA 4ZQRA 4H7ZA 1EQPA 4PL1A 3ZT7A 4OWGA 2XH7A 2FZ9A 5CGQA 5FEXA 1JPHA 4AAJA 3NVDA 2W9MA 3TYEA 1B4EA 1VJIA 3H26A 4XZBA 1FWIC 3T4WA 1XP3A 1Q6EA 1VENA 3WBYA 4IM4A 4MM1A 1LOLA 4E4PA 1MFVA 1NFBA 4PB3A 4GXMA 3UT0A 4PULA 2TPSA 1A0EA 4PFMA 3GG1A 1KBIA 4LUJA 3O05A 4B3ZA 4DJED 3BANA 3OVPA 1B3YA 4D6FA 4J5NA 4PR4A 4XD5A 1A50A 2XIOA 3RM8A 3KX6A 2PWVA 3W28A 1E0WA 5C70A 2DUAA 1E4LA 2CEQA 1FP8A 2I5QA 2NVAA 2GOUA 2Y2WA 3W22A 1JAEA 2BG5A 5D9OA 3RLUA 1CNVA 4HNUA 4K1WA 4IZGA 2QCDB 3CWOX 3BOLA 3CLWA 3G2GA 2BY0A 4BWLC 3EB2A 3GXIA 5CPSA 2QCMA 4J35A 1KM0A 3B97A 2FHFA 1S2WA 2BY1A 3OBEA 1UA3A 3S3GA 4N9EA 1W5NA 2WJFA 4POCA 3FDGA 4UTMA 1IWAA 4H8HA 4O8AA 4RL3A 2FMOA 4QE4A 5G4EA 3R43A 3AS0A 1KB3A 1RK6A 2D0FA 2R1KA 1B30A 3WCZA 5HJYA 3A4JA 3WLKX 1MZRA 2A2IA 4JFSA 3D5HA 4DEFA 2HJPA 2F7FA 4FF7A 1UQZA 1KWKA 2DJXA 3LSCA 1XIHA 3PWGA 4F0RA 2J7EA 4LUSA 2FDMA 5GNXA 2QCFA 1UH3A 1TE6A 1KFCA 4FLOA 2VFFA 4UTJA 3MYOA 3T55A 3T09A 2IKIA 4DWDA 1PB0A 3ARTA 3IS4A 2WNZA 2NUWA 1FX6A 4K8HA 3KBSA 2YX0A 4HZ8A 1CXKA 5JH1A 1U30A 1YMYA 4WSHA 1F4AA 1IEXA 4FOKA 4M51A 4LNCA 4L6HA 1C8XA 1EA0A 1FWJC 3OO2A 4PSPA 2ANUA 2OQYA 3TXZA 3TUUA 4DXXA 2EG6A 3KBWA 3BAYA 1UIOA 3ZVHA 1HL2A 2C19A 3DYPA 1XINA 1Z9AA 4HCHA 1LL7A 4WY0B 2QCGA 3LENA 3BOXA 5HWMA 1KFEA 1JF5A 2PDGA 2FZMA 3V0TA 1XLEA 4QNEA 1GKRA 3LNMA 3A3WA 5CC5A 4D8AA 3H55A 1JRBA 1L6GA 2Z2BA 4A3UA 5BW6A 3WMSA 5AHIA 1LQAA 4XSMA 3RXZA 1LG1A 1BD0A 5DT5A 2WSPA 3M44A 4L4LA 1AA1B 2EHHA 2PDLA 3AYVA 4F9DA 3S1VA 2OO6A 4YTQA 3GDBA 3OEXA 3F4NA 5C2CA 3KBVA 1W9VA 3RJYA 3VIOA 3RDKA 1FWCC 3OVGA 2VEPA 3APGA 3URNA 1U5VA 4MTVA 2HK0A 1KRCC 4JQ3A 1R3VA 3LM3A 3W2KA 2UY5A 4F66A 2Q8XA 1R87A 4G56A 1NFPA 3CPGA 2VT0A 5CJMA 5LZLA 2D3LA 1EJ7L 1EWDA 1QW8A 3E2VA 1JZ6A 4OBRA 2O56A 1VYSX 4XKMA 1PZ3A 3S5YA 3M0MA 2OSYA 4IFKB 3GXPA 2QCDA 4JIQA 3FFSA 3R1ZA 1WDPA 4C6PA 3UW6A 5C55A 2QLYA 3POCA 1YDNA 1TREA 1H50A 3JS3A 1Z69A 5DEZA 1VLWA 3B3DA 1S3HA 1E9IA 2FB3A 4EWND 3UWWA 4CD7A 4EXAA 3K46A 5CG0A 2B7NA 1XBZA 3C2VA 2WSRA 3HG2A 1UWRA 4CQCA 1UUQA 4Q22A 1GW9A 1Q5MA 2POZA 1FHDA 4AIOA 4ICCX 2X0SA 2ZXDA 1DQUA 3O63A 4E8DA 4B5UA 1GPWA 2FFIA 1NIUA 5C9RA 5I6SA 4LYRA 3WF4A 3VDHA 4P7NA 2D2OA 1UZ1A 2AL2B 2J74A 3EEZA 4XG1A 4GC3A 3VZZA 2C1IA 3RFAA 4LC6A 3WD2A 1QHOA 3ABQA 1GUVA 4W8AA 1WP6A 1TSIA 3GUGA 2FZDA 4LCSA 2I9UA 2DH3A 3S2JA 1JD9A 3O06A 4B91A 1GQKA 3WN6A 5I3HA 3LQGA 5I3KA 2VR2A 4C5YA 1KFJA 1ISVA 3AJXA 1MXDA 3BLDA 3HV8A 5AFDA 1YDOA 3ZR5A 1GJPA 1ZJBA 3VD9A 5JXQA 2YW4A 5M3WA 3OP2A 3MSGA 1XGDA 5F2GA 3MUXA 3BL3A 1F7BA 3U57A 4GUHA 1TV2A 3PWAA 4ACZA 2HVMA 4JQ1A 3QRHA 1B1YA 3GNPA 1MNSA 4YCOA 3P60A 1EJXC 5F1UA 5G1YA 1C90A 4O17A 4TTUA 1BKHA 4AZ6A 2J7FA 4U3AA 4I6VA 3W84A 1WPCA 3LLFA 3UG4A 1QASA 4Y9MA 2R1MA 1QPRA 1L9WA 4Q4SA 1VAHA 3HJZA 2GYIA 1RJRA 2P5NA 3GX9A 4GRSA 3WLPA 2XFYA 1J79A 1T0OA 4NRSA 2ICSA 4S3AA 1XSIA 1P6BA 4NIRA 3C4UA 2G3IA 2INZA 3MUZ1 1L6SA 1ADSA 5U4NA 1NEYA 3SGGA 2E9BA 4LVFA 4DJFC 4QAIA 4RE2A 4UTKA 1GQLA 2D3NA 1F61A 3TC7A 1VC4A 4DZ5A 4AD2A 3DX5A 1TZ7A 1KXQA 3GFZA 1QOXA 5KEZA 2R1NA 4G1NA 3PUGA 4IPPA 4LB3A 2J78A 2QULA 4LX4A 4C1NB 1LRQA 1IXPA 3G1VA 3GU2A 1GPFA 4BQ2A 3TP4A 3UG5A 2O9RA 1AW1A 5HQEA 1FQ0A 1QJWA 4LVGA 3BSMA 2AQWA 2PDWA 3IJ8A 4MKNA 4GI4A 4P8VA 1NOFA 3N25A 1K1DA 3BJSA 2YW3A 4DB7A 4QFUA 1Y0EA 2OGJA 3M41A 1OCNA 2EEXA 4NL1A 3O07A 4IT1A 1OGSA 4IGHA 2REQB 3WFAA 3T0BA 4PMOA 2ZUTA 4M6UA 5CSSA 2H6RA 5BCAA 1RALA 4C6NA 3FK4A 1JI2A 3MV11 1HJSA 1KGUA 2HPIA 2ZDRA 3QMSA 4MB5A 2A7RA 4H01A 4UR9A 2J88A 1VPYA 2RDXA 2V3DA 1GKPA 3SQSA 1W5PA 3B0UX 4XTIA 1QI2A 3FNDA 4YTTA 3TYBA 2W3ZA 4FXSA 1RY8A 3H4XA 2VGFA 3L21A 2DSKA 4WK9A 4KQNA 1HXJA 3A22A 3QPZA 4UIOA 5T8GA 2P76A 4WGHA 1WDSA 5U7SA 4DUVA 1N55A 4NZ1A 1JULA 1H2JA 2E5CA 4JZ5A 9XIMA 1RBOB 4L7ZA 4WJ8A 3OA3A 3PNZA 1PAMA 4KKXA 1HG3A 1K3UA 1TVLA 1PEZA 1GYMA 1FWEC 1LUCA 2WBGA 2PD5A 4N6EA 1XH1A 2D23A 3DAQA 3CLMA 3EA3A 3A23A 1LM1A 3AHTA 3BDKA 2DVUA 2OWWA 1F3TA 5A1AA 3EPOA 3G1HA 4YVXA 3SURA 3H2CA 2WVTA 1P7TB 4JHMA 3QYSA 4AMCA 3OQ8A 2FVKA 1E72M 1HTIA 2SFPA 2PC8A 2C15A 4XZHA 2QKFA 3FYYA 2VX7A 1YNPA 8TIMA 1LL6A 3I7RA 2E3ZA 1UZDA 4L65A 3P0XA 3CZLA 1WA3A 3NR0A 1OYCA 1ENUA 2P88A 3AMLA 4DYKA 3TX9A 4GK8A 4Z1AA 3GR8A 4GBUA 4D6GA 1CB7B 1JGMA 2PDCA 4LXFA 2YL6A 3LHYA 3LBMA 4JTLA 4UQDA 2R94A 2PWGA 1IGSA 1POJA 1TTPA 3OBKA 2DSZA 5FJIA 3VGHA 3KFTA 1NY1A 3QF0A 1CGYA 1VF8A 4IP5A 3UZYA 4C6DA 4EPDC 4LGXA 4Q6JA 4Y8EA 2JFEX 4RZ5A 1LLWA 2B31A 4NZJA 1NH6A 1C9DA 3W6YA 2Z6IA 4DBSA 4YVVA 4PMYA 2XN1A 2PUZA 4HA4A 1AUSL 1CECA 3AXIA 4PUMA 2OSXA 2J7BA 1QWKA 1TTJA 1XIMA 4JNYA 2PRLA 7PTDA 4EIVA 3THAA 5AB3A 2ZX6A 3HG5A 4PCFA 1BYCA 4W5ZA 1ZSXA 1GEQA 2XIIA 2WZMA 2GGIA 1AQ0A 3N1AA 4EK7A 2BASA 1J0HA 3VIHA 3N17A 1V6WA 4O1CA 1YQ2A 1B2YA 3NQCA 5FSEC 4M56A 2VGGA 3EB3A 3DG6A 3T78A 2HWGA 1QPNA 5GJNA 1XDJA 4B3LA 4QQUA 4P7OA 1W31A 3C0QA 1C8VA 1XCWA 1XSKA 1A5OC 1DWFM 3O3RA 3V1PA 1FDJA 1KC7A 1L0PA 3WMBA 1XRVA 1UWAA 2OOGA 2P0IA 1AK5A 2XZ7A 3DG3A 1M1BA 4DQWA 4LEFA 5LGXA 2BZNA 4ZB5A 1RR2A 2PCEA 1PX3A 4D1JA 3A5FA 1BWLA 3B9NA 1GJUA 2CWXA 2DZPA 1JZ7A 1XC4A 2GDQA 1WOBA 2YLLA 3W7CA 1ZBKA 2XWDA 4ZOCA 2BOGX 3NPXA 1EWEA 3N2TA 8CGTA 4PEEA 1JJKA 4GINA 2VR4A 3VTRA 1YDVA 4DBWA 1SO5A 5EA9A 1JZ8A 4GA8A 4JTDA 5HUOA 3NQ2A 3W87A 3AYSA 3UVIA 3ZFHA 4O1DA 2O55A 3RO8A 1F07A 1NWUA 3VNIA 1KD0A 2WJZA 1CXHA 1W3IA 4NAFA 1IWPA 3WBWA 3MP3A 3SJ3A 3EWBX 4NNBA 4XAGA 3A47A 1VRXA 3MZ2A 3EPNA 5AECA 5I09A 3N3MA 2DP3A 3NGJA 2GUBA 5E9AA 5A8MA 4DYEA 3VOGA 2PP1A 3M0ZA 1DHPA 4HN8A 3EKLA 1GG0A 2WSKA 1W54A 5FF0A 1J6PA 1SYTA 2PWHA 4KCWA 2G96A 3DU0A 2IPWA 1QBBA 2GLKA 3BJFA 2G37A 5JU6A 2ZZ7A 3WJSA 2C8NA 5CPQA 4G8TA 3DI0A 1GGOA 2QHAA 1PE1A 3Q94A 3W7IA 3WO8A 4AHQA 4N02A 4AU0A 3CIWA 5CGTA 3EMQA 2VEFA 3EMCA 5BZAA 1GG1A 2WVUA 4QITA 1NTHA 4L61A 4GCAA 1L8PA 3I7QA 3UZJA 3TK7A 4HK6A 3BAWA 1AZ1A 3F4DA 3MVTA 3EDEA 2DVXA 2P1FA 1KFKA 3HFYA 2R1PA 3F4VA 4Y7EA 2NWRA 3PANA 1H41A 1BHGA 4S39A 3MUY1 2ZVRA 3CH9A 5HNNA 4C1LA 3HJEA 4W8BA 3FSTA 5CH9A 4Q33A 1KM1A 4LS0A 2W6RA 1P6CA 4P5UA 1Q45A 2VFGA 5C71A 1D2KA 4LBUA 3VIIA 3CZEA 3E2QA 4ERGA 4UMBA 3L4YA 1ZU8A 4IJBA 4JQAA 5J5RA 3ALGA 3FVMA 1KGXA 2G97A 3BG5A 4INFA 2VWSA 1FWWA 1GOIA 1XYBA 5AYBA 1E5NA 3AIBA 2V68A 3C56A 5BRBA 2C14A 3V3WA 4FR6A 3W7LA 4A05A 3WDHA 3C2RA 1G01A 1GONA 1EPXA 2QJGA 1XBVA 1TJPA 4R53A 1ECEA 1KM3A 3K8MA 6XIAA 1JCMP 1YXDA 3KZPA 1ME8A 3DFHA 4N6FA 1VYPX 2CYGA 3NQFA 3LTYA 1QRQA 1GTHA 4FF5A 1YRRA 5A94A 3N29A 4IG2A 3RCMA 1DV7A 1IR1A 4JTSA 2TSYA 5K9CA 3ZJ7A 4YN5A 1GOQA 3ATZA 4S3BA 3AOFA 1A80A 3WLTA 4JYDA 5EMUA 2OSWA 2PTYA 3F2DA 5KZEA 5H8PA 2Y7DA 3NPVA 1OIFA 2EAWA 1JGIA 3W1LA 4RDZA 1ICPA 3N6HA 2VR5A 3CHFA 5AVNA 2HE5A 1R7AA 4UQCA 4WKAA 3ARSA 3HB9A 1QR7A 3LXAA 5CZKA 1OCQA 1XRTA 1NOUA 4WQ6A 5JUVA 1U83A 4TVUA 4H6EA 1HKIA 2DY3A 3W7HA 1LT8A 4S3KA 3PTQA 3QSRA 3AMDA 4UNLA 3M5ZA 2XN2A 2FDSA 2BMBA 1G69A 1MYRA 3G0XA 2ZUVA 2F38A 2DZWA 5DY3A 4HPJA 3D6NA 3GAKA 3B0XA 3OVRA 3AALA 4PBFA 2D2JA 4QS5A 3KP0A 2PDUA 1DJHA 4KEUA 1M6JA 5HXMA 5A2CA 5LA1A 1V4YA 2VQTA 4GG9A 3MVIA 4K8GA 2OLHA 4NI8A 4AQLA 5HINA 4YTRA 4QHRA 1YPXA 1W1VA 1RP8A 4NQ1A 4HU0A 4LAUA 1D3HA 3EDKA 1GORA 3QLLA 3W53A 5GNYA 5PTDA 3LGGA 4AD4A 4FI4A 5BOEA 3CZGA 4TUFA 1HZYA 3HZ3A 1D9EA 2YOCA 5J8LA 3EPMA 3AJ7A 1UR3M 3P80A 1ITCA 1XI3A 2GQAA 4PODA 2VENA 3KVMA 3UF9A 3LRMA 3STPA 3SJNA 3SQMA 1HGYA 3SADA 3MI2A 2DPEA 1EOMA 4CVWA 3UR8A 4QTGA 3SM0A 4PMJA 5EBAA 1IXNA 1O68A 2B7OA 3VKJA 3D46A 4HSOA 1KQZA 4R85A 3VOHA 2Y85A 3W24A 2QQ6A 2ISDA 3GZ3A 4PN2A 3P67A 4H9YA 1DJGA 3B05A 5LIXX 1V3MA 3LHZA 5LNUA 3L12A 4LF2A 8RUCA 4FALA 1ECQA 3ZO9A 3OG2A 1DWJM 4JYFA 1H60A 3WH9A 3OZPA 2YLAA 4XQ6A 3I4KA 1GOKA 5EGRA 3CO8A 2YCKX 4FXJA 3FX4A 2QCCA 2PTDA 1TJ1A 2QMJA 1SFLA 4HA1A 3A9BA 4IGMA 3QKZA 1VEMA 2XVGA 1GTEA 3CYJA 1AZ2A 3K8KA 1XLMA 3N9RA 1MI3A 4YTUA 3E12A 3TC6A 4HMCA 1JCNA 5T91A 2R14A 1HJWA 4W88A 3DFQA 3T0CA 4C6LA 3ZLGA 4HK7A 3LCIA 3VKDA 3MMWA 3IIVA 4ZO8A 1BVWA 4LAZA 7TIMA 4QX4A 2GK1A 4JFTA 5I77A 2YL9A 3KL0A 4AIUA 3TYDA 1XL9A 4EXQA 3EX4A 2I9EA 3GXDA 3WD1A 2FMNA 3G1SA 2WCAA 4FZIA 4IMGA 4R7JA 4C91A 3I4EA 3QC0A 4WCJA 2WSYA 4BY3A 5BXSA 1MW1A 5CKSA 3NO5A 3W6MA 1M7XA 3UXKA 4HT3A 1YTKA 3GM8A 1FKWA 1XYLA 1TKKA 1TPB1 2PDIA 2YA0A 3DBPA 1IXOA 2W79A 3KBMA 2OWCA 3PVFA 4DI8A 4URIA 4JKKA 3NOYA 2CWNA 3NZPA 4CN1A 3ID7A 4X22A 1XX1A 3OGVA 3WDPP 1UJQA 4QDPA 3L7RA 3GG7A 4BFAA 3KOXA 2AKZA 3THUA 4NNAA 2VC9A 5DLCA 4DIAA 2XIQA 3FVDA 5FCZA 3ECQA 4FLQA 3WYZA 2H90A 5L9FA 2BOEX 3RU8X 3SCVA 4X9YA 1OX6A 3WQDA 3VNDA 2KAUC 3PPGA 2P8CA 3ARWA 2P0OA 3QMTA 4WOQA 4GLEA 4WUIA 3BCJA 5CAKA 1W2PA 1HJVA 1BGGA 2QXWA 2O4QA 4GIRA 1E1CA 3W29A 2DORA 1JPIA 1JQXA 1RUSA 3B40A 4QE5A 2ISFA 2PTWA 5D05A 1FWBC 3VGEA 3JRKA 1XLIA 3L0KA 3TROA 4A6GA 2EPMX 3EX2A 5LIKX 1A5SA 5ECVA 3VCCA 1IT0A 1CI1A 1EQCA 4ZGYA 2OXNA 1IR2A 3SSJA 1BG4A 1XCFA 4FHAA 5ABHA 4IMEA 3M07A 4OQVA 1JDFA 5MF5A 2UY3A 1RD5A 1EEXA 3PUDA 2HK1A 3EYPA 3UJRA 4A8IA 5BXRA 2J6XA 2W4XA 1H7OA 1GZ1A 2A7NA 4JYEA 3PK7A 5DCDA 4U3CA 4YXGA 4D2JA 3OZOA 3GXNA 4CUCA 1EJSC 3O6YX 1SQ7A 1XS2A 3LX9A 5G1MA 5FA5A 3VKCA 1W8GA 4WXYA 3TU9A 3FEQA 3UXLA 1DKWA 2MNRA 2CZDA 2OR2A 1SSDA 4QLJA 1F8IA 2FZ8A 1J01A 2ZYFA 3KL3A 4E2VA 1ZAJA 4ZXOA 2NX1A 2ZRVA 1DQWA 4REQB 1KA9F 3LCHA 1V3HA 4IICA 3ITGA 3KXQA 4DLFA 3GH5A 5I2UA 2EG7A 1RCOB 2PBOA 1YE4A 1V0LA 3EWWA 2OTDA 3M46A 3HPSA 4AHOA 2RDUA 1R2RA 1KCXA 1BG9A 3PNUA 2XDFA 1XBYA 3CAVA 3W7OA 1IXQA 3H12A 1ONXA 4IIFA 2Z00A 5DO8A 3QY6A 2RJGA 2O9PA 3T7VA 4ZEPA 3BSHA 3NQ6A 4D6JA 4UCFA 1FWFC 1O1ZA 4ZQNA 5IFTA 3JW7A 3VU2A 7REQA 3XINA 3B8IA 4ZQMA 1A5MC 2QCEA 4AF0A 4A3QA 5DANA 1JNEA 2QPSA 3OYXA 3RR4A 1TV7A 1SJBA 4KF1A 2PF8A 2DFAA 2VC5A 3L65A 4L5ZA 1K77A 4ACYA 2WQPA 3R79A 3MU7A 4R9XA 4N4QA 2VVSA 4JNZA 4OOZA 2XINA 4NYUA 2YZ5A 4XK2A 3BZJA 4NI3A 4LRTA 1I2OA 4LT9A 5HWNA 3ITVA 3DFSA 4PYSA 2YGYA 3THDA 3WKZA 3BLIA 3GE7A 1WKYA 3WELA 1JPDX 4H9ZA 3OHIA 2ZKMX 1H7PA 1I2RA 4PCPA 4WJEA 4CQ8A 1FWGC 1ITUA 2CKSA 3AWOA 1WZMA 2INFA 2Z24A 2OB3A 3SUUA 2GFTA 5AOUA 4QJ1A 1K4GA 3NQBA 2V5KA 2WZHA 2BGNE 3I7SA 3RLHA 3L4XA 3CAKA 4AWTA 5A8QA 1V6YA 1TQJA 1ZJHA 4HNVA 4TOQA 3GFXA 3T8QA 1XIEA 4NZCA 4Y9AA 3AMKA 1W9DM 3ITTA 1MUMA 3IGUA 2YYTA 1OK6A 4A3YA 1OX5A 1UJPA 4NAEB 5JBEA 4ICMA 1MW3A 4JAWA 1MW0A 4P8UA 1OJXA 3M7WA 5TAOA 4GXPA 2CLEA 4MSSA 1SMAA 1F05A 3WLHA 4P61A 3ISIX 4NUWA 3URAA 2VGBA 3LXBA 5CBBA 5HA7A 3TFXA 2X05A 4D6DA 4I9JA 3SW6A 5ABGA 1E55A 2Z26A 3UYCA 4B5XA 2YBUA 4MZ8A 1XKYA 4WDWA 1Q6GA 3Q58A 2OPJA 2Z1SA 3WUBA 1A0CA 4MGGA 5I3FA 3H54A 1TYGA 5BOOA 2EKCA 2IMRA 2HCVA 4GABA 1EJVC 1J6OA 3PBWA 4IIHA 4M6VA 5DQPA 2ACSA 3CWNA 3FOKA 4QSFA 1JUKA 2PS2A 3S8HA 5J5DA 4Q8NA 1UBPC 1BWKA 3DERA 2JE8A 1UD8A 1W9UA 3BZGA 2X2GA 1GK8A 1HL8A 5DF0A 3WFLA 3AMCA 2FIQA 3SDOA 1YXYA 3DBNA 1O6IA 3LLXA 4B3KA 2WHLA 1O4UA 2VELA 3PM6A 1DL3A 3THCA 2FZNA 1LYXA 2J79A 3XIMA 3SBFA 1H5VA 1OEPA 1R7OA 3VMNA 2EQDA 1RK5A 3FW6A 2WHKA 3OU8A 4DO7A 4MB4A 2R24A 1HKJA 3MUAA 4CU7A 4ZENA 3VNMA 3RLVA 1GOXA 4C7FA 3VOCA 1O60A 4PMNA 3DN5A 5FJPA 1BQCA 1R3WA 3L4WA 3K1GA 1GOMA 4JTGA 3BJTA 4JIEA 3QZAA 4L6OA 5E6ZA 2TRSA 4H4IA 3FN9A 1P4CA 2NX3A 1GVEA 3TMQA 1TTQA 1IIGA 3LA4A 4MWAC 1UKSA 2IXVA 2Y89A 4YWSA 3R12A 4RE3A 5G5IA 4BI6A 1J0ZA 4MVAA 1OX4B 1X6NA 5REQB 3H7VA 4E6MA 4OECA 3KVLA 2FPVA 3CMJA 4UB9A 4UFMA 3DFPA 3IUIA 3S1WA 1IF2A 2JEPA 3TFCA 2GVEA 1ZAHA 3S0CA 3E0WA 3FGCB 3UNTA 4HNNA 1QNVA 1XDMA 1O94A 4L1GA 5H1WA 2Y0FA 4MJ2A 3HGSA 2GJXA 2VWTA 1VCVA 3WLMA 4KGJA 2OG9A 3KHJA 1X39A 1ESWA 2JGYA 3WJZA 3UY7A 3P82A 1XYAA 3CQKA 3W2MA 1A47A 4LRSA 5HK4A 1PSCA 1YKWA 2ZFAA 4GQQA 4UBPC 2XJ7A 1E0UA 1HO4A 1KRBC 4UFJA 4UFHA 3E0FA 5JMUA 3BW2A 1XFCA 2BVYA 4CD5A 5C9XA 1WZLA 2GDVA 2HZGA 2YL8A 6TIMA 1G94A 4GZEA 3MWCA 3RILA 1UBSA 2HS6A 1YTEA 3H53A 5FACA 2XHYA 4TX6A 4QSHA 2YB1A 4AZCB 4S23A 3R7MA 2FJUB 1SVDA 1H1YA 5CZJA 3EWYA 4B5TA 2PGWA 4IL0A 3PBUA 3ZT5A 4S2CA 1I45A 2HXTA 4L56A 1SSGA 5BRPA 1TR9A 3L68A 1C7TA 4JX4A 4DF1A 1X38A 1TX0A 3PZOA 4TMBA 4YCPA 2WZIA 2NUYA 4LVBA 4C6EA 4FB7A 3BE7A 2H8ZA 2OX4A 3EBVA 1WUFA 4QEHA 4GQGA 2BY2A 3WY1A 2CLMA 4O57A 4P7RA 1XG4A 3TZNA 3W7MA 5EFDA 5M2FX 3BICA 4RKAA 1YW1A 1JPKA 2PODA 3UPWA 2E4TA 1MZHA 2WMIA 4CD6A 5C6MA 1Z32X 1BKSA 3OLGA 1W9BM 4FK9A 4TV5A 1W3KA 3ZR6A 5EFFA 3NZRA 2B0MA 1EXBA 1G7VA 2DQWA 2XVPA 5DT7A 2WC4A 3VK5A 1W1PA 4D6CA 3K4DA 2VKZG 1CGWA 4O10A 3WK1A 3L4TA 3PC0A 4FR1A 2YB4A 2XGIA 5D30A 2V2DA 3OOQA 4RLIA 3HPFA 3KWXA 1GCYA 4RZ6A 1MDRA 4HZ6A 1AMKA 1OB0A 4NZFA 3VIPA 3R6IA 4JX5A 5FJJA 2GJNA 3WF2A 4P2VA 3QPEA 4GIAA 5C5YA 1Z41A 5M17A 3EOOA 2Z25A 1RY0A 4NY2A 4QXIA 2VZUA 5REQA 1CIUA 1BYAA 3W07A 2OYMA 1GQJA 4HHHA 3W70A 2ZADA 2F6KA 4XVDA 4QGCA 4WDUA 4TVDA 4DAIA 1U22A 2POTA 2OZTA 3S2MA 3PBMA 5LHFA 3VNLA 2E1WA 4Q8MA 3W2JA 3N2OA 5FEPA 1UWTA 5HNTA 4C6MA 3O2LA 1OADA 3TN4A 3R5EA 2OZ8A 1HVQA 3ZWTA 3R8RA 4A3RA 3GRIA 3UU0A 3GXFA 4ATDA 1OF8A 3QV7A 2XSAA 1HKVA 2YDAA 4PC8A 3Q45A 5BWFA 3U7BA 4C6KA 3AIEA 1CGXA 1SFJA 2NLIA 5I0DA 3UBPC 4IQLA 2A3BA 5CSRA 3IJLA 3G1FA 5E0CA 3UA4A 1E6XM 3BCFA 3MI6A 1SFTA 2OEJA 1Q13A 2I7GA 2V9DA 1UW9A 3EWXA 4AIEA 1RP9A 3LPOA 4NZ3A 2RHGA 3TYAA 4ZZ9A 1R9XA 1ADDA 1IQ8A 3LXCA 3TCSA 1SZNA 5A8OA 3U5YA 2YYUA 1BQGA 3P81A 2PTXA 3GBDA 4F48A 1OG6A 3M0XA 1GVOA 4I8YA 2BHUA 3NEHA 2J27A 3SCUA 1U33A 4JTFA 2Y8VA 1QI3A 3FXYA 4ICNA 5BMWA 2IPFA 4MWAB 3MDWA 2EO7A 2X42A 4PE8A 1B3ZA 3MKCA 4ES4A 1EGVA 3VOFA 3PBGA 3HGRA 5TNVA 4P8XA 3V4BA 1BLIA 1YX1A 1WO2A 1P43A 3DKLA 2NZLA 1KFBA 5A6LA 3TTEA 1VFUA 4MY8A 1WCGA 4UTFA 4ZODA 5EBUA 1UYQA 1XV8A 1G9HA 4HU3A 1TVPA 2MUCA 2WVSA 3AWNA 1VBRA 1YDYA 4IXXA 1A3HA 3U2CA 3MANA 2AQOA 4DJEC 2ALDA 1UZHA 3GSMA 3TZFA 4ASTA 3RNDA 2D1ZA 3DFNA 3TQ0A 2DQXA 3H2NA 4J3WA 4FNPA 2WB5A 2V69A 3PULA 5C2XA 2CNCA 1W1YA 4AZBA 4O0QA 2VI0A 3G1AA 5G1TA 3W7EA 3VKKA 1L2QA 3KTCA 3ERPA 1JFXA 5FIPA 1Q6LA 2Z2AA 3RCYA 3RJXA 5HOSA 2DZXA 1ZP3A 2BX7A 2PDHA 3W81A 5HUPA 2QIIA 3UGVA 3W7RA 4RE4A 4I5XA 3OTRA 4H1ZA 1ZB5A 2NQ9A 3HMJG 3MUIA 2A1YA 3E9AA 4XUGA 4JFVA 2EJ1A 1ONWA 1C91A 2Z0IA 3M0VA 5CPMA 5TD4A 4W7UA 3SCNA 2ISVA 2DDXA 4IL2A 1E4NA 4C6IA 2PP0A 4PTWA 5JQ9A 3G5EA 2IUZA 1QCWA 3W0KA 4NP7A 2XIBA 5T9BG 3GVWA 4ECLA 4TTGA 1HQTA 4YL2A 3EB4A 4I9MA 3ITXA 3CV1A 3SCOA 1SM9A 3B8WA 3STEA 2FGLA 3N15A 3ITCA 3KS6A 5FJOA 4Y9PA 2WO5A 2IPJA 1Z6KA 3O6AA 1F6KA 3VPLA 5MKGB 2V8ZA 4XO6A 1QVBA 1Y5VA 3H6OA 5IBXA 1KLYA 1IEVA 4J3VA 5DELA 3I65A 1CXIA 5TF0A 2ZWZA 4KPLA 2VC7A 2VO5A 3WLSA 3TN3A 3IK2A 5IHSA 4GY1A 4MY9A 4OU1A 1FVPA 4V1XA 2VXNA 2H3DA 4WHBA 4I9TA 3FJNA 2BB0A 1UHVA 3ARPA 3VX1A 4S38A 1KW1A 1JYXA 4RE0A 1E3ZA 1YNQA 3FV9A 1TWDA 4XBSA 1R2TA 1VIZA 5FOOA 1KTNA 3RMEA 4O52A 3R8GA 4YVPA 3SUVA 1H7XA 1EGZA 4DWSB 2PBGA 4J3TA 4Q6XA 4ORMA 1V02E 2V0TA 4HN4A 4MDOA 5D2XA 3NQAA 3EOEA 4DNMA 5CSUA 2FVLA 2HBXA 3FKRA 4Z42C 1KV8A 4ZE4A 4X63A 3MY9A 4GNKB 3WD0A 3LOTA 5ABFB 4GJIA 1AQHA 2VOTA 2CKRA 3E74A 1WV2A 2GQ3A 4QCEA 1PTDA 3JUGA 1TZZA 1ODUA 3P7YA 4O19A 1H62A 4W93A 4A2SA 1SPQA 1HJUA 5IOBA 2Z7KA 4MYAA 4N9DA 4TIMA 1F3XA 3MBDA 3GU1A 1CLKA 3NNTA 4K2SA 2NT1A 2ZOXA 1EIXA 3ZOAA 5D2YA 1AMYA 1R9ZA 3N73A 1XICA 4RNHA 1EA9C 2D0HA 1TPEA 1R8LA 2AMGA 5F7UA 1VFOA 4AUBA 4LW7A 1RQHA 5I03A 3WK3A 4Q4KA 1KV5A 5IDIA 1FDYA 4NILA 3PJWA 3VIFA 2ZA2A 3QLDA 3VI2A 4E3TA 3NIYA 3GDTA 1Q6QA 4UFLA 4LCQA 1UWIA 4H7CA 3LDVA 4UQEA 1KQYA 1PHQA 2BSLA 1GZJA 4LVAA 3S9ZA 2A3HA 1I9CB 4HTBA 3VGFA 1UPPA 4WOZA 4LAKA 4Z2LA 4EX4A 2YL5A 1Z48A 3AROA 4PMVA 2X30A 1QU4A 3U2EA 3EDFA 3NQVA 4WSKA 3KCOA 4WX2A 2I56A 1M01A 5KZ6A 2E9LA 4IMAA 3OZMA 4V15A 4HP5A 3MKVA 1UP0A 4S3GA 4FNQA 1DXEA 3VE7A 1UKTA 2VHLA 2Z28A 3UZXA 3FHQA 1QAPA 2YDRA 3EXRA 1UCWA 1EJRC 3NJ3A 1M5WA 4LBRA 2CZ5A 3W27A 1OFBA 2ZRYA 2E5DA 4XD4A 4JDYA 4L4PA 4D72A 3D3FA 1TWSA 3CZKA 2GUYA 3BAJA 3P5YA 4KT2A 3GFYA 4KFOA 3VABA 3P6LA 3IV3A 3N4EA 3G1RA 4ZFMA 4UTUA 2PURA 2QT3A 1EEPA 1WE5A 1OVDA 1PUDA 2V38A 1OK4A 2R1LA 2OQHA 1T96A 3W7PA 3IRDA 1OZMA 3F1QA 1E15A 4H7VA 3W85A 4Y96A 5HWJA 4LB4A 3C0LA 3GVVA 3ZMRA 3AXKA 1UD6A 3WQWA 4XSLA 1HKMA 3UJSA 3LPPA 4BA0A 1B3WA 4LWWA 6REQA 3WQ5A 2P3EA 1WDQA 3LRKA 1UA7A 4NZ5A 4Z2JA 1HVXA 4CGTA 2IQTA 4AWEA 3HU7A 5FI8A 4DLMA 3AIRA 3MT1A 4MY1A 4D8ZA 3REQA 4MOZA 3GS6A 3NGFA 2WZTA 1FWRA 5DXYA 4S2BA 1JRCA 3LI0A 5I02A 5B7YA 1VP5A 1REQA 4H41A 5HMDA 4QEEA 1YBQB 1T6MA 2ZE0A 3AZSA 4UOJA 4GO8A 1WZAA 3CMFA 1OC5A 1DVJA 1G4EA 4AZHA 1E4MM 1KKOA 2IPGA 1AH4A 1Q7ZA 4XBJA 1YTDA 2GGJA 4IISA 3WLIA 4AYSA 1ISYA 4CNNA 3PSVA 3S6DA 1VLIA 2ODOA 3AXXA 3VVGA 3BSGA 3O6DA 1V02A 3RRXA 4TMCA 1K70A 4W89A 3STCA 1JL8A 5LGZA 3EX6A 4CU6A 4JTTA 2D20A 3M47A 3WNMA 5K4ZA 1RAKA 2X16A 2OT1A 1F8MA 1EZWA 3NM3A 4HHPA 3BMWA 4Y6GA 4QS6A 3LK6A 4HYWA 2G3NA 4V33A 1R3QA 3UWUA 1VFTA 3E0IA 3S5ZA 3W1NA 3YPIA 3UG3A 1W91A 4Q4MA 3UERA 1Q4NX 3R10A 1W5MA 5FSDC 3AU2A 1JR1A 5G2HA 4X0VA 4H9TA 3VO0A 3SY8A 4YYCA 1ICQA 3ARRA 2VJXA 3TLLA 3WD4A 4G5DA 1ZP4A 4JKLA 3OPSA 4CNOA 3TE9A 1MQPA 3BPWA 1NWTA 2YBVA 4LU0A 2JIWA 5FAJA 5DFAA 2D2GA 2P50A 3OYZA 1S38A 1PVNA 1TPVA 3HG3A 4F79A 1X1NA 1UROA 1YIXA 1ZNNA 3VM5A 3VOJA 1W5QA 2Z6JA 1XR2A 3UR7A 1JDAA 4PTXA 4O13A 3GH4A 2GVJA 4RUBA 4WD0A 4WKHA 2J62A 4ALDA 4GKTA 4AB4A 1EDGA 1D3GA 4GY0A 4CNPA 3T40A 4K1GA 2E5BA 3INPA 4UWMA 3GIYA 4LUTB 2YPIA 2XVKA 1XCXA 4JHZA 2YA1A 2G50A 2WWDA 1L6FA 3BMXA 4DAFA 2W0UA 5ECUA 2PDMA 3CTLA 4PTNA 2QYGA 1QNOA 5DRIA 1PDYA 2Q3OA 4GNJA 2AKMA 4CN6A 1GVIA 4HSNA 4BI5A 1B54A 2WVVB 3CQIA 1HO1A 4PH6A 3UXIA 5H8UA 2Y24A 1P0BA 1UKQA 3QPYA 1V3LA 3PZVA 1EP1A 1JZ5A 3CS2A 2CLHA 2QDEA 1JVNA 5E6YA 3TMLA 4Z08A 4YHGA 3KCLA 3LM7A 1TZ9A 3IIXA 4OFCA 3P61A 1X7IA 3R0KA 3K4AA 2G95A 3GVQA 3QY8A 3FDKA 2NT0A 2IXUA 3WQ8A 3WJXA 1GVRA 2DH2A 2OO0A 4GNVA 1FHUA 3K1DA 3WUFA 2V2HA 3GHUA 3TTOA 1ISWA 4W5UA 2WMHA 5GVJA 4HGXA 3UPMA 1SW0A 1PCWA 2ZBTA 2DZBA 1UPMB 2PMQA 1GW1A 1W37A 4HYRA 1EHNA 3NDOA 3QN3A 3IVUA 4RX0A 1Q66A 1XYFA 4PMUA 2WSQA 1LQ2A 1W3NA 3WDJA 1RA5A 4BF9A 4YTSA 4GZJA 1R38A 2W67A 3WQGA 4W4QA 4NU7A 1AVAA 3QGAC 5AY7A 2CPUA 2HRWA 3PUOA 2A21A 3CL6A 4Q4QA 1TELA 3SY1A 2J13A 2Y88A 5H91A 4LOCA 2OKTA 3QZ6A 3LI1A 3M0JA 4BQ3A 3G6MA 3LUTA 4Z0SA 2GJPA 2E6YA 2O9OA 4CCCA 3GTFA 1WUEA 4NYYA 4K38A 2WYSA 1G4PA 1OFPA 1WKFA 2Y8UA 4H9VA 3QBUA 3TR9A 4A8LA 2JALA 2J47A 3QV8A 4C6QA 4E8CA 1N7KA 2Q71A 4Z2HA 1US3A 3OB8A 3AIVA 1UR0A 2GUUA 2QZRA 4OUEA 2C6QA 2ISWA 2RFGA 3KTXA 3L9CA 3W74A 4RNJA 1T8XA 4J28A 3RM9A 2CZVA 1SUXA 3O15A 4ZMGA 2I14A 1OD8A 3QSTA 1S5WA 2PU0A 1JYWA 1FDZA 1SW3A 3NZ1A 2BVTA 4C7GA 3WLJA 2W27A 3NO3A 4UXDA 2ADAA 4QISA 4ZO6A 4N2YA 1LOSA 5DMYA 2OKOA 5KTLA 1LL4A 2Y7EA 4K3ZA 2WVVA 5I3IA 1W8SA 3LERA 2ZA3A 1AODA 1Z89A 1VFMA 4Z17A 4LAMA 4Q8WA 3AMGA 4GY7A 4DPPA 1KGWA 3WNPA 3ZVIA 1JD7A 3R89A 5A6KA 3H2AA 3KEHA 3A13A 4XAYA 3GG0A 3VZXA 1EDQA 1OFAA 5G2WA 3UFYA 3F5LA 1E5JA 4W85A 3GZAA 2CLKA 4M81A 2VUNA 4J4KA 5D2VA 1ZRQA 1QT1A 2VRJA 4IMCA 1AJZA 3H7UA 4OOUA 4S3CA 6ALDA 1DOSA 4GVGA 1XLLA 4BS0A 3DECA 2IQ0A 1CXEA 1D8WA 3CNYA 3VD7A 3OHMB 4TO8A 5DMLA 5GJMA 5XIAA 1MVYA 4GYPC 4H6KA 4WR3A 3T81A 4JICA 4YWIA 3WQOA 1BSLA 1TMQA 1P0DA 3EKZA 5KZMA 4AFYA 4AZIA 4IH3A 3GK0A 4O15A 1QHZA 1TQXA 2V30A 5HANA 3ORWA 5A69A 4GQBA 4YYFA 3MDUA 1WXZA 1LTDA 1H4PA 1ONEA 2PLJA 3M43A 5A95A 1A0DA 1SZRA 2W5FA 3AHXA 1W0MA 3HQ1A 1XIIA 1C7SA 3PG8A 5CC6A 1RSCA 3LHUA 1NQKA 1WQ5A 2GQ8A 3A6OA 1WDDA 1DJQA 1CYGA 3CHEA 3Q65A 4LYKA 4D71A 3VMPA 3B8UA 1KXTA 4MNJA 4D6EA 2ZRXA 3RN6A 1LRNA 1XRFA 2PDJA 1TJ2A 3Q67A 4GX9A 1FWNA 1HX0A 1M65A 2P10A 3J7HA 4XKYA 3C5QA 5E1QA 2ONEA 4X2RA 5JIPA 1LWHA 5CAHA 4I3GA 1U1JA 2WV8A 5EB8A 1AJ0A 3A21A 4R34A 3DHPA 3PHAA 3RHGA 4U33A 2UBPC 3S5SA 5I3DA 2HVNA 1UUMA 1DIOA 2PZNA 3EDJA 5LNSA 4ML4A 3VOIA 3R2GA 3TAOA 5CBJA 1NOWA 1EBGA 5ENLA 4WDXA 4G7EA 4EOUA 4HCDA 1A5CA 4KEZA 5CGMA 4UUIA 2D22A 4RDVA 3F5JA 4NKCA 1FOBA 4QG9A 4PTMA 3BLPX 1F3EA 4ZXLA 4YJ5A 5GJPA 4K7VA 3JVAA 3BGGA 2INEA 3THQA 3G1YA 2XZ9A 2VMFA 4PZVA 2QEZA 1KCLA 1UD2A 4MNMA 2CFFA 2E8ZA 3TJIA 3W7KA 5HNRA 1ZENA 3BQ5A 1MUWA 3BCDA 1UD3A 1XF0A 1M04A 3PWIA 3QGKC 1ZJAA 2V2CA 2XVNA 4XD6A 4A29A 3DGRA 3HTWA 2FKPA 1LCOA 3BV4A 2XGBA 1J96A 1WZKA 1D7KA 3L0GA 2CC0A 3ARXA 5T9CE 1S5NA 5AVHA 5G4WA 3NQMA 3AHVA 4ML9A 1RQEA 3MZNA 3B04A 4M29A 1MRQA 2ZC1A 4QROA 4I7VA 3CUZA 1HT6A 1R30A 4FIQA 3UCQA 1AD1A 3AIWA 1BVNP 2TAAA 1X6LA 3WL0A 3VILA 3NUKA 2UY2A 4L4OA 4GXWA 3N19B 5F2IA 1NP2A 5D37A 3W2LA 4AX7A 5CJNA 2XH4A 2X7VA 4MNLA 2RDTA 1SMDA 3TA6A 1VQTA 1WXJA 3QGVA 4LFYA 3CWHA 3E0LA 4C60A 3GHSA 4JEJA 1K9DA 5TQLA 5LIWX 2XWEA 1K9FA 4Q8UA 4QM1A 1G1YA 4AC7C 2F6XA 2FTWA 1YPFA 1UOZA 3PPFA 2OEKA 3DFTA 1WDRA 3KZSA 2VRQA 5CC3A 1Q6RA 2CU0A 2VCAA 1XJBA 1RBLA 1SJCA 2DZAA 3CZJA 4FA3A 3LN3A 4JTHA 1VYRA 3WL1A 4V27A 2ACQA 2VOMA 4A35A 3IUHA 1V0MA