2I8AA

Salmonella typhimurium liganded by phosphate ion at 1.64a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
b'KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
molecule tags Transferase
source organism Salmonella typhimurium
publication title Salmonella typhimurium liganded by phosphate ion at 1.64A resolution
rcsb
total genus 92
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2i8aA00
1A69A 1OVGA 2QDKA 4U2KA 3KHSA 1U1DA 5CXQA 3C74A 4L5AA 2AI1A 3FNQA 4QEZA 1WTAA 4D8YA 1YRYE 1JPVA 1B8NA 1V3QE 4L5YA 3OZDA 4D9HA 1CB0A 1ODKA 1ZOSA 5K1ZA 3FAZA 1I80A 1M73E 1U1EA 1Z33A 1ECPA 4TXMA 4ECEA 3UAWA 1K27A 4L5CA 1U1GA 3NM6B 1Y6QA 2I4TA 4TS9A 1A9TA 5C80A 3EMVA 3OOEA 3FB1A 1Z5OA 1JDVA 1PBNA 1A9QA 3E9ZA 2GUWA 3DF9A 4QARA 4X24A 2P4SA 1V41E 4BMXA 1JDTA 3OOHA 1ODJA 5B7GA 4OF4A 1ULAA 2OC4A 1A9SA 2HWUA 4TYMA 3PNPA 2RJ3A 1Z5NA 3INYA 1SD2A 4G89A 4KN5A 4I2VA 2BSXA 3OCCA 2AI3A 5EPUA 2OECA 5F76A 4R2XA 3F8WA 3GGSA 1Z37A 3LGSA 4D98A 4PR3A 5IU6A 1SD1A 4F2WA 4WKCA 3EUFA 1FXUA 1V4NA 1A9OA 3EUEA 1QE5A 1RYZA 4WKNA 1K3FA 3BJEA 5CYGA 3ODGA 4MCHA 4DA8A 2QPLA 1NW4A 4LKRA 3KVYA 1TGVA 4F1WA 4WKOA 3IOMA 1RXCA 1SQ6A 1TD1A 3IEXA 4JWTA 1OV6A 4OJTA 1LVUA 5F7OA 3OZCA 2HN9A 4UC0A 3D1VA 3UAZA 4L6IA 4TXHA 4NY1A 5EFOA 1T8WA 2AC7A 2OXFA 4OGLA 1N3IA 4M3NA 4BN0A 4QASA 5KB3A 1VMKA 1OUMA 3OPVA 1NC3A 3FWPA 1Y6RA 1A9RA 1RXYA 1Z38A 4YO8A 1TCVA 3P0FA 1OTYA 1PKEA 3GB9A 5EUBA 1RXUA 4E1VA 5F7ZA 1PR0A 4GKAA 3ONVA 1T8YA 4EB8A 3DPSA 2B94A 3LBAA 4F2PA 4D8XA 1TCUA 4WKPA 4DARA 5F73A 3KVVA 1NC1A 1Z34A 4R2WA 4BMZA 1Q1GA 3BGSA 4TXJA 4YJKA 4GLJA 3MMSA 4G41A 2A0WA 4TXLA 1PR4A 3FOWA 4RJ2A 4TXNA 5B7PA 1U1FA 5IFKA 2AI2A 4OY3A 3UAYA 3BSFA 4F3KA 4YMLA 1C3XA 3LA8A 4NS1A 1VFNA 4BMYA 3KVRA 4DA6A 1RFGE 3FUCA 1T0UA 4M1EA 3QPBA 3U40A 4P54A 1RCTE 1RR6A 1PR6A 3E0QA 1PW7A 4MARA 1CG6A 4LDNA 1RSZA 1Y1TA 4PNPA 2QTTA 3TL6A 2A0XA 5F77A 1Y1QA 4H1TA 1V2HE 1ZL2A 1OU4A 2HSWA 1LV8A 5F7XA 4DABA 4OEHA 3DP9A 1JDZA 3BL6A 1ODIA 3DJFA 4K6OA 3PNSA 4NSNA 1K9SA 3NM4A 4EARA 4D8VA 1V45E 5CCDA 3O4VA 4FFSA 2QSUA 1ULBA 4TS3A 1Y1RA 3ENZA 5CXSA 4JP5A 4G8JA 4LNAA 5B7NA 1PK7A 3SCZA 4DANA 1YQUA 1PK9A 1Z5PA 1VHWA 4GLFA 1PR2A 1SJ9A 3UAXA 5CCEA 4DAEA 5F78A 1YR3A 4TTAA 2OC9A 1VHJA 4GMHA 4QFBA 1B8OA 1JDUA 1JP7A 3E9RA 1Z36A 4JOSA 1YQQA 5ETJA 3O6VA 5JPCA 1JE0A 5F7JA 1LX7A 5FAKA 4YNBA 1G2OA 3DDOA 2ISCA 1PF7E 2I8AA 4L0MA 4QAQA 3PHBE 2A8YA 2XRFA 4QATA 4TTIA 3OZBA 1JYSA 3NM5A 1Z39A 4DA7A 4TTJA 1U1CA 4LNHA 5DK6A 1T8RA 5I3CA 1RXSA 1YBFA 4DAOA 4LZWA 1A9PA 4MCIA 2Q7OE 3K8QA 3KU4A 3EEIA 5B7QA 3T94A 1OTXA 3KUKA 3MB8A 3P0EA 4DA0A 1XE3A 4R31A 3OZEA 1JDSA 1RT9A 2PGAA 2HRDA 3PHCA 2ON6A 4OGKA 4IP0A 1Z35A 4WKBA 4M7WA 2IQ5A 5CYFA 1V48A 1TGYA 3OF3A 1Y1SA 2QTGA 1PWYE 3UAVA 1PR5A 3UT6A 1PR1A 3K8OE 2H8GA 1ODLA 1JE1A 4F3CA 3NBQA 1T8SA 2A0YA
chains in the Genus database with same CATH superfamily
3AY0A 4LGVA 4K9MA 5ENVA 4FB4A 2BBOA 3DP7A 2VYVD 3JTMA 1L5LA 2P0AA 4UXIA 2AEEA 2R7MA 4K88A 2F43B 3L5OA 1JHRA 1PQWA 3C3MA 1Z9BA 2PX2A 4M46A 4TSRA 4A8JB 4BRUA 3RIEA 1LZLA 1PWHA 3L7AA 1OXBB 1BRTA 1EBBA 1ZOIA 3IQXA 3LQRA 3W8NA 1A2KC 1UZAA 4TMXA 3N86A 2XJ4A 1QLHA 4QU5A 1BROA 1DOHA 4UBJA 5FEUA 4OXNA 4A10A 4BO7A 3WL4A 4ALLA 2AVNA 1B8NA 4YT5A 2JIOA 1EVIA 3CVOA 4GHWA 4OHCA 4U2EA 4CKWB 2JL1A 3THSA 1QHGA 1XD9A 3ZCSA 4EG4A 2I2WA 3R5TA 3SN6A 5ALZA 3BFPA 4X20B 3D02A 2ZPTX 3ROQA 2VDRB 3WA7A 4JGGA 3ZPXA 1XEXB 3R6DA 1S6YA 1AY0A 2FW9A 3P2EA 4BKPA 3PXCX 5TQ0A 3L05A 3HVRA 1NJ6A 1U1GA 2W4MA 5LQKA 5AJYA 3VNRA 3RS0A 5CFRA 3FRIA 5EI5A 2BSAA 1BDMA 1SCKA 2I1VB 2NZ8A 4G5OA 3W9UA 2QDXA 2XH8A 2L69A 2CLKB 2Y1CA 3JYQA 4H31A 5D2CA 4Z0NA 4Q37A 2I9PA 2BOVA 1AOXA 1JSCA 5C7YA 1LDYA 2PUWA 3MUEA 3O8DA 5LUBA 3U5ZB 2AK3A 2P4SA 1E2BA 1KZYC 2NW6A 4O4IB 5CLQA 3WB9A 3QVGA 3I34X 4GC5A 4O8CA 3KXDA 1DCTA 2PVCA 3I4CA 1FQJA 5EXEA 2FPKA 3SQLA 4O2RA 2GX6A 3ZCXA 2Q5HA 4TKLA 1WB4A 1GTG1 1JAYA 2EW8A 3JR3A 2WA1A 4RJLA 2PA0A 3Q0EA 5CW2A 1PUJA 1UQTA 1E0AA 1Y4AE 3ZZ0A 2BUAA 2YR0A 1XR3A 3BJZA 2XITA 4OLAA 1KGSA 1QDEA 2QLFA 2HDOA 1FFBA 4OLBA 2IYWA 3IP1A 1CFZA 1ENZA 5DN6A 1YL7A 1AQYA 3ESBA 3KALA 4RKYA 4E21A 1NHWA 3WHIA 4UHBA 1OW3B 2WSBA 5JLAA 3AHIA 1KGDA 1KPIA 1ZKMA 3NV7A 4FFVA 4WLOA 4YECA 4ZEOA 5L4SA 1NBWB 4GKKB 3HA3A 3V34A 4BNDA 3H4MA 1V9CA 1XKLA 2EJCA 3LVRE 4LJ8A 4PPNA 4WZBA 4YJHA 5G4KA 3EUEA 3BDIA 3UT5B 5IASA 4MWSA 4BKMA 5AIBA 2EJBA 1L7DA 4WT7A 1VJTA 1JEQB 3SXPA 4LK3A 3AX6A 4OKIA 1EK1A 2WZCA 3B6ZA 1GARA 2YH2A 2WMYA 3DD5A 3G89A 1Y3BE 4FKZA 4IIJB 3U09A 5T67A 3IGFA 1W2WB 1L5HB 5B58T 4D43A 3CG0A 5EZYF 1FMLA 2ZKLA 4HNQA 3F97A 3TBFA 2W2XA 1NF9A 3EIQA 2IHVA 3L7JA 4LVUA 2O5EA 2B5OA 3COSA 4HWPA 1OWMA 2GPWA 3M2PA 1CUJA 1E6LA 4R3NA 4I99A 2N1BA 1L7QA 4XVHA 4CV2A 3HUEA 4ZQIA 3AM3A 4N7BA 1GL3A 1MT3A 3SC2B 1NULA 1KEKA 4B31A 2BLLA 2OCKA 1LZKA 1EUCB 2PX6A 3HWSA 3JQ9C 4ZAZA 4UDNA 5TMBA 3S2FA 3A9SA 2RHLA 3IR7A 5CT9A 3IUMA 5CM8B 1XMQB 4RMGA 4BMSA 3WGJA 3OJ0A 5CLFA 5K8CA 4I1PA 4Y2RA 4B44A 2I33A 3MLAA 5IDVA 1TYCA 1E5LA 2I2FA 2W6CX 3WVNA 4OYRA 4MPDA 3THRA 1X7HA 2O59A 3JYHA 4LYFA 5KJ6A 3BMOB 4X44A 1CIPA 1QGYA 3ZD8A 4P5PA 3IRVA 3LDGA 3TQQA 4B6QA 2ZRBA 4YP9A 4YHBA 4HLCA 4QVKA 4KAAA 5A4AA 4DA9A 2EKBA 4JMPA 1EVKA 2M6KA 4X64B 2DUUA 1DXHA 3K9HA 2ZFUA 4Y18A 1SXQA 2P7HA 1G8FA 2AE2A 1NQAO 4BN0A 3KT8A 2YYYA 2B34A 3RK0A 1ENYA 1HDYA 3R77A 2G72A 3KTOA 2OL4A 4LJ5A 2IDKA 4OGWA 3RUHA 1ZZEA 2HWWA 3TMAA 2A14A 5I7RA 1IN7A 3KKQA 3QPWA 1D07A 1P2GA 2ATEA 4P38A 4C7JA 1RWXA 3ZDXB 3TVDA 4ZREA 2H1WA 1GWNA 2SECE 3WMGA 5AVWA 2VWGA 3BSWA 3L6OO 3TR0A 4WBNF 5IH7A 3MJFA 1RD4A 2L18A 3VTZA 1G1AA 4D9CA 5LUAA 1N0WA 4N5NA 1HE1C 2AEJA 1KEPA 3BA1A 3MTEA 1OT5A 2CLFB 4RA6B 2HJRA 1Q1EA 1M67A 2IP1A 3U17A 1ARZA 1JYFA 4KQ9A 1N1GA 1GEGA 2ZTMA 3CTMA 3M4JA 1QAMA 1W93A 2CNWD 1IM5A 3SX0A 1RZVA 3N2KB 4WZZA 3QJYA 1T0IA 4N4AA 4ZAXA 3ZNPA 2NPFA 4KE8A 3T4XA 4X7BA 1KP2A 1SY7A 3P0FA 4F60A 3H2IA 2O14A 2WHQA 3V1YA 3RANA 1T6NA 2EX4A 4LXUA 2JIRA 5DASA 5IK2A 5T41A 4BVKA 3A9TA 3VHRA 2VHQA 1RRVA 1O0SA 1UJNA 1DBVO 4YLGA 4A0SA 2OLEA 4H3SA 2DVMA 1DZ3A 5CCXA 1MQ9A 3DONA 4N8SA 1S8FA 3B6KA 4R1NA 4U02A 5C1DA 3EQ6A 4JGIA 3IEPA 1T9CA 1GPLA 1ZM7A 2R6AA 2NOAA 4KP7A 2XYVA 4IILA 4NJMB 4ETIA 5BSMA 1HH4A 2FA9A 3GUZA 3MWJA 1EFHA 3RV3A 1NONA 4QPCA 1EVJA 1H1LA 2OOKA 2ZYDA 3GMDA 2EW1A 1CW2B 3O8OB 5B4TA 5KYKA 2R1TB 1I4EB 4NDAA 2BFFB 5L3VA 4H60A 1PEYA 5AVJA 5GZ1A 3PWKA 1L8OA 2H7VA 1NX9A 5AI6A 3ZQKA 4MW5A 3NBFA 1NWCA 4WV3A 4XSHA 3KE9A 2RGXA 1OE0A 4LSMA 5E3IA 4EAQA 4HQ0A 4TLEA 2J45A 1GSIA 4B6FA 3MQ4A 4L08A 3PI7A 2QYTA 1DV2A 5E3JA 4QG7A 4ZI2A 1DT3A 1QMPA 2HJHA 2XSZD 1SM4A 5ECGC 3TQHA 3N5KA 1YU6A 4FMPA 4ZV9A 1M74A 5ALVA 1BDHA 4O4JF 3RC1A 1YZGA 2FWMX 4WWHA 3TR6A 2VP9A 1RQPA 2A0WA 2QP4A 4PV7A 4TXLA 3TD9A 1BYUA 3ROTA 3WWEA 1GLVA 2IYVA 3RVLA 2G09A 5EJ6A 4OQMA 1MHPA 2H1FA 3QHAA 4H35A 1NTRA 3IX7A 4F8YA 1I6KA 1VG1A 1WPXA 2JGIA 2Q6TA 1QQ5A 1M2HA 3DA8A 1N5RA 2AUTA 4YTEA 2HK8A 3LUFA 2FZWA 5GY7A 3CE9A 3ASVA 2RGAA 4LWQA 4NS1A 2J6CA 1GLGA 2RHOA 4MWZA 1UBUS 1SHJA 2MU1A 2Z8YM 5IYZB 1EX7A 4NF2A 4AJPA 3LXXA 3VH2A 4BRSA 1IHDA 5M34A 2QBYA 5SICE 1UC9A 3DAOA 1IIRA 3TM5A 1NJFA 4JJGA 2MTBA 2C98A 1SZDA 2Y1KA 5CB8A 2QROA 2UV8A 1TIBA 1XN4A 3K70C 4GMDA 1GAXA 4UBKA 1VA4A 2I55A 5BV1A 4FHDA 4U5QA 4QBHA 2G9QA 4TLBA 5HGJA 3RPEA 3CPHA 4J8PA 4EKDA 2ZIGA 3RBZA 1EK6A 4CUZA 3MMNA 4K7JA 4QFDA 4Y0AA 4R83A 1Q57A 4AY4A 1I7QB 4RK4A 3HM2A 2WKWA 4RFSB 5DBEX 1FDVA 2WUVA 5CCBA 2OZLA 1ONSA 4NJEA 1UT5A 2QYHA 2VSFA 2YDYA 2C82A 1K97A 3BL6A 3VV3A 4GXRA 3VU8A 1OJ7A 5BR1A 4LYJA 5IT5A 1MABA 5AKZA 1LNZA 3DL7A 4YJFA 3T7CA 4CCSA 4ZMSA 2ATXA 1L4UA 4KQHA 1JJIA 4DEYA 3ZDAA 1KE2A 3AVPA 3I72A 2C07A 3G9ZA 4U7PB 4CHGA 1C30B 4E08A 4U6SA 5TGDA 5DEOA 1WLYA 3NQ41 4E88A 2P9FA 2AB0A 2X6QA 2ZBRA 3EHDA 1OH7A 3MJRA 6LDHA 1KEZA 3WLIA 5IVPA 4HLDA 1NAIA 1H2AS 3CEMA 2A9OA 4X63A 3VO2A 2Y6UA 1VE7A 3VQTA 3VYWA 1X42A 2HPVA 4FK8A 4P31A 1Q0ZA 4RANA 2C7PA 4Q4HB 1DHTA 2JDIA 5EJMA 3ZWWA 3DUWA 4KN9S 1DKLA 1ZUNA 5GM2A 4CKBA 2LR0A 2A84A 5EIHA 1I9CA 3T4UA 1KAEA 1H6CA 2V7QD 3DZ8A 1ZJZA 3UV7A 4MV1A 2VSNA 4FDVA 2G1AA 4DANA 2QLLA 4CWAA 2CT8A 2IVFA 2W43A 4IKEA 3MHTA 2ZR9A 3BXOA 2OZEA 4O02B 2Y6VA 1RI1A 5AVVA 2O23A 2Q2OA 1K9VF 2VATA 5K8VA 4M9CA 1WZEA 2Q1WA 3T0IA 2IPXA 2X7XA 4JASB 2IDMA 2WYWA 4KVFA 2ID4A 2Q7XA 4WFKA 3JD3A 5AXAA 5K8TA 4RY9A 4JMLA 3WBFA 2NACA 1ORDA 1QONA 1A8QA 1ATIA 1MH1A 2IV2X 3OJXA 1RAEA 4JH0A 4LN1A 4LXIA 2W2KB 1KJZA 4RAOA 2WAYA 2C84A 4MULA 3V2IA 5AKGA 1VGRA 1CNEA 3ELWA 5EAIA 5KNCD 2AOWA 1J23A 2RKOA 3R5KA 5LM3A 3L84A 3ELUA 3RYHB 3AR9A 3LCJA 1RLMA 4DTIA 1FUEA 1AN0A 1Y7HA 2BGGA 3WLHA 2D7CA 4Q9HA 2WKRA 3FA2A 3GJ8A 4C89A 5KSZA 5FO0A 1JDUA 3LQFA 3ZLUA 3PQ3A 2IZZA 2LGJA 5CBPA 5F2OA 2NV0A 1XCJA 4Q3CA 2QE6A 4WFJA 1QFZA 5GZ3A 1K0UA 3DHVA 2HIMA 1YDEA 2VJAA 5E1OA 3ZWYA 5TY0A 5KOHB 1Z63A 2G9UA 4RF5A 3ROZA 4N5IX 2IS1A 5DMHA 5F7JA 4IIGA 3OZFA 1IN8A 1GHTA 1MFZA 4WDRA 3QF4B 1GGVA 2Y1OA 5KNBA 4GE0A 3Q0IA 2P5TB 1E3IA 1ZD1A 2HMAA 2ZT8A 4BNKA 2J4FA 3AUAA 1E2QA 3N0XA 3I73A 1CZUA 2IY8A 4PLZA 4BV3A 3PFGA 1GLNA 4CW7A 5AVQA 2QG9A 2B4QA 4X5OA 2WTMA 4TLLB 1FP2A 1JG2A 1E8NA 3BIJA 4IIJF 1RTKA 7REQB 2QTLA 5FV4A 4L0QA 3QVLA 1KMCA 3PHBE 4KPEC 2H1OA 4HQLA 2E4XA 3IIIA 3VR5H 1CF4A 4ND2A 1PFQA 2J9YB 2WINI 4LFAB 2IYNA 1EINA 4OCZA 5K0LA 4AMUA 4Q6BA 3OZBA 1O08A 2XHEA 1AV6A 2ZYUX 3EFOA 2FRDA 4KQ2A 1XTBA 2CLHB 2HK7A 3K3PA 3MNFA 2ZJZA 5DOVA 4A0QA 3Q3JB 4B5KA 4QUEA 4DA7A 5HJ7A 1XPOA 4Y0NA 1W34A 3VM6A 2ORWA 3TUZC 4JYCA 3W06A 5I6DA 2YIJA 2JLQA 4Z4QA 1XWWA 1GSAA 3LVQE 2C3OA 1KK1A 1RCUA 2WYIA 1TLFA 4G1BA 1EZ4A 3PDCA 9MHTA 1TNDA 5IWCA 5MF6A 5JT1A 4E5VA 2CBXA 2PVSA 3IMGA 1VRVA 4LZWA 2XB4A 3UXEA 3WGHA 1A9PA 4GM4A 3LHKA 3K8QA 2BUCA 5GONF 3T95A 1KQOA 1VGVA 3PTLA 2O8VA 2WABA 3DEJA 4JVSB 4E5SA 5EYPA 4ZCTA 1Z8NA 3H04A 3PKZA 3L4KA 4PCUA 4BAUA 4CM3A 5GZ6A 1Z6XA 3RQIA 5HWSA 3S8YA 1PL7A 4HL6A 4WOBA 3OETA 1KQPA 3QKSB 1G1MA 3RUPA 1AHHA 1BWPA 4Z2YA 3I5UA 1RT9A 4F86A 4D41A 2HGSA 1ZSYA 2PD6A 1L7XA 2BFDB 2DJIA 5KIAA 2O5CA 5IBCA 3RKRA 3ANMA 5HM6A 1QTRA 1K92A 3DNMA 2F1JA 2VSQA 4MK4A 4PHCA 4QHYA 4I1SA 3N7TA 5A2QA 2BRUA 1E7WA 3N8DA 5CPBA 2OHFA 4RTJA 2ANCA 3M6XA 4FCTA 2VK8A 2Z2ZA 2IZ1A 2JGJA 3N75A 4OVKA 5JAOA 4XWWA 4R9NA 5J4LA 1FBNA 4DSAA 3EG9A 4E31A 4NV1A 1ZH8A 3UAVA 4BU0A 3RFUA 3QUCA 4BGIA 1L6IA 1C7JA 4JT8A 1CRPA 5I9IA 1WCWA 4LQ4A 1UJ5A 2G1PA 5EC8A 4WNCA 1PDOA 1BG6A 3NVAA 5AW3A 2AJ8A 2RHDA 4WCVA 3I9LA 4F3CA 5LWQA 2JCSA 3NBQA 4N5LA 4DY4A 1U7PA 4YASA 5KQLA 2IKSA 2XXAB 3UPDA 1F3OA 1NBAA 5AI5A 2AW5A 2GHIA 1DCKA 3K9CA 2TMYA 2R6FA 4GQIA 4M0PA 4D1YA 2W2KA 1QUFA 2GXQA 4O2BF 4P2GA 1J2UA 2YMPA 1JJBA 1FJ2A 4X93A 4CJXA 3WBKA 3ROPA 2R0QC 2FX5A 2C9BA 3EXEB 4CIWA 4TQGA 4QBKA 4QA9A 4QWMA 4M0DA 3ZDQA 2IW3A 1UUFA 1H6DA 2Y0DA 3QXJA 2DFNA 1M6VA 1PYDA 5LJLA 1PV4A 1NJ1A 3AR8A 3PTZA 4CR8A 2QN1A 3GLFA 3DQQA 3E35A 3OIGA 2IL1A 1PG0A 1B3BA 1H2HA 3R0XA 3IJRA 1YRBA 1HNWB 4K3VA 4DC1A 4Y1GA 1QO0A 2QPAA 1JLLB 3OQ6A 4LXYA 4UHKA 2Q9AA 1CQIB 5K1ZA 4KH0A 4ACAA 1JHUA 2J87A 4EF6A 1GUFA 3RTGA 2IYQA 1RI5A 1TK2A 1RPNA 5JTTA 3CNHA 4X94A 4X54A 4RTQA 1KZHA 1EA5A 1LPNA 4KAJA 1H94A 3UK1A 2Q0XA 2YWEA 2FKAA 4URUR 1TEHA 2I7CA 1ZSNA 3EMVA 4QUKA 2IELA 1T3GA 2JFYA 2QGFA 1LSSA 4JBWA 4L3VA 1EVEA 3IVMA 3RVKA 1P5FA 4PW0A 2FRXA 3OKCA 1U9YA 1H8HA 1DPGA 4KXQA 1UJMA 1LK5A 3JQCA 1VKOA 3QXCA 2WFLB 3GJ0A 3ACCA 2FWIA 4RHTA 1P4JA 1GUBA 1J5PA 3SHOA 1JZTA 2OZLB 3AI1A 1J2EA 4NJEB 2PFSA 1CTQA 1BJRE 1GTSA 3PDUA 5CFLA 2A7XA 4MZXA 2V97A 1VYVA 2ZB7A 1KI1A 4ZHQF 3OKFA 1CCWA 3GJ4A 4CQMA 4RACA 5BUZA 3AHCA 3DXZA 2XBMA 4RD4A 5DFAA 3URKA 1JEOA 1ZM9A 4M22A 4HUJA 3VC3A 2NTNA 4B9EA 3FR7A 3PNPA 4CTMA 3FXAA 4JB3A 4BO5A 4D96A 2IEAA 4Y6QA 5DNWA 3SQXA 5ERGB 5H82A 1LQ2A 3T35A 5AOVA 4CCYA 1HDXA 2OWDA 1BOFA 3D0OA 1UADA 1M8FA 2AI3A 2O3UA 1ZD3A 4TYWA 4L76A 3KX2A 2JVIA 1LFAA 3GGGA 3HJNA 1Z25A 4OK3A 1MCZA 1P0IA 2BI7A 4UZSA 3U3KA 3MS7A 5D3MA 4EGQA 2CLIB 2P8SA 4PNZA 3D3EA 3KKPA 3LSYA 4JX9A 5FWYB 1N2EA 4RZXA 4E3WA 1VQ1A 1L7AA 4ARZB 1ZXLA 3PHLA 2O06A 4FIDA 4LJ9A 3VR2D 1NLUA 3OFNA 4J49A 4CEHA 3U9SA 5EMKA 2CXTA 4MO2A 5L7YA 5ER9A 1SBYA 1SZJG 2QIPA 1LXCA 3E1GA 3K0HA 4ZKDA 4LF5B 3AR3A 1DEHA 3HDQA 3ODGA 5A4IS 3E9CA 1K3TA 4DW8A 1W75A 3EAGA 3GQVA 2EU8A 3VKFA 2A5DA 5LQAA 1GCAA 2ZYAA 1NW4A 2O1WA 3AVYA 3ZYCA 4M9ZA 2GEFA 2WICA 3QWBA 2PQMA 5EA2A 1HOTA 3R9WA 4QECA 1MQAA 4AMBA 3PLRA 1P9LA 1SC4A 3ZDZB 1NMZA 3QENA 1CRQA 4A5OA 3OSUA 1WUKS 3ZGXA 4BFWA 1XEXA 3GZ4A 4B8ZA 2QUIA 3DEAA 3FYUA 5GJCA 3G8DA 4C0KA 4CV1A 3G2JA 3LUJA 4B0PA 1IJKA 3H1TA 3LK6A 5B3AA 2AFHB 5AOBA 2NZWA 4RL4A 1BH2A 1EVLA 4FEYA 3D8TA 3V8MA 4F9GA 2O2DA 3L7OA 1GZVA 1NW6A 5FBLB 4EW3A 4C14A 2BFFA 2R48A 2RHBA 5FUVA 3EGXA 1U63A 4M0LA 2Y71A 2B35A 3I92A 1BX3A 5J1SB 3NYIA 3VHXB 4IX9A 1Y6GA 2NMVA 2I6SA 3M5WA 1LKZA 4IYJA 3R3HA 5FLXA 3WIEA 3F5MA 2ZUCA 1YR7A 4ND3A 4XYMA 3ZWBA 4EG6A 5HUJA 2H51A 3EA0A 1Z0DA 3EPRA 2BGWA 1F0PA 3K6RA 4WBSA 1OAAA 1L4KA 2WHPA 4GLLA 1U11A 1M0EA 4B3RB 1VE3A 4B2IA 2HO4A 1X1EA 3KKKA 3EPPA 5L3SB 2X9VA 5L3RA 4XM0A 1YJQA 3I6ZA 2RHRA 1NASA 5JCXA 1U0GA 4Q1CA 4BNIA 1NVUQ 2BUBA 3D7LA 4MIEA 3WJAA 1YVRA 4FUTA 5B1DA 4XCXA 5T8KC 3SM9A 5KCMA 4G0OA 4XUCA 3UCFA 4P4SA 5C0OE 3RAJA 4H08A 2A92A 4G5RA 3OPVA 3D6AA 4K81B 3L8ZA 1KIFA 2V5VA 3KWLA 2YOGA 2WU0A 1PLKA 1Q12A 1DMRA 1DBIA 2RIPA 2M6SA 3HCAA 4FJ2A 3L4BA 1BU5A 3JQ9A 3NHLA 5GTDA 1NUUA 1MA0A 2HQBA 3KAPA 4J0KA 4Q39A 2A9JA 3K35A 1RXYA 2OBFA 2JAQA 3BRWD 3RC7A 2UDPA 4E30A 1HO3A 2VC2B 1KP3A 3DMFA 1KH3A 4Q9AA 3RSCA 1S2MA 4B6GA 4RIIA 5IAJA 2EWMA 1WTCA 2FNAA 1YC5A 2E6KA 3BGIA 3IAM6 3O2SB 1E2DA 2X8LA 2JFXA 2P9GA 3DF7A 3SBEA 4KFCA 3A4VA 1OFTA 2VYVA 2FEXA 4LA4A 1IMOA 5EUBA 4A26A 3JAMA 4GWLA 2L2QA 5IMSA 2RD2A 4ZYZA 3D8HA 1LX6A 3OTQA 2QMZA 1GGHA 1U8FO 4FGZA 5KU1A 3MELA 1ZR4A 4AJ2A 2G25A 1N5LA 1FSPA 1AB5A 3BL5A 3P26A 4NRDA 4KR9A 1U4OA 2GF2A 2NPIA 2VJYA 4N0DA 2GVDC 4DLNA 4PZYA 5TARA 1SKYE 2AUMA 2XYRA 4R0NA 2W5UA 2IXFA 3GCXA 4K40A 3KOWA 5FV7A 3I5YA 3SOZA 4H7IA 3KPVA 3I3SR 4FC6A 3FJOA 1FS5A 2J7KA 2DBYA 5IVHA 1SKAA 2CWWA 3EDYA 1YTUA 1VJGA 3RD5A 1XVLA 5SZKB 1PAUA 1NR5A 1NT2A 2CF5A 3NNSA 4RHYA 3LP8A 1KFEB 3CNEA 4B8WA 2Z0MA 3LZDA 4DIMA 3QG5A 1RHJA 2PGOA 3PEFA 3C1UA 5LP6C 1LD3A 4RJ2A 4TXNA 2DHEA 2GPBA 1T4CA 2CN1A 3S3TA 1UKZA 1YB1A 4JA0A 1LDMA 3TSZA 1EJ2A 1M8PA 4Z1OA 1MJ5A 1QGUA 2V7UA 3RSZA 4BNXA 1C3LA 5FWAA 3OMLA 1DV1A 1QKIA 3ZDDA 1NKTA 5DISB 3CN7A 1T3ZA 2CDAA 2P2CA 3KVRA 4KQCA 4OOFA 3EAFA 2CDRA 2ZCUA 5K3SA 2Y92A 1OIWA 4DCPA 5I9NA 1TRHA 2B99A 2MWMA 4JLOA 5I5EA 2BH9A 1AB6A 1B4DA 1UJ4A 1JKJA 3BXXA 2ATVA 4U8GA 1G5FA 2WWRA 4JJEA 4V2UA 2C9ZA 3QLTA 3T5CA 5J4VA 1N8TA 3HXOA 1L8LA 4XVCA 4P0TA 2I2AA 1QYVA 3HBMA 4DCMA 4PLTA 4XR9A 3I1IA 3OZGA 3U80A 1DWQA 1KE1A 3MSXA 1C8KA 3DNFA 2NZUG 3KXKA 4XIJA 1ZJJA 3LYAA 1ANKA 5U1PA 3UWSA 4QEKA 4YX9A 5JQGB 2VHEA 2G80A 4KV9A 8ATCA 3DMTC 3KSZO 4YRNA 5TLSA 1P0PA 3IR6A 5BOSA 1X86B 4Q4LA 2WSMA 1P81A 2EKDA 3CLUD 1NLFA 4IG4A 1IZYA 4KX5A 4OEHA 1T2UA 1NBMA 3G8AA 5B4UA 3BPSA 2F9FA 2Q3BA 4DMRA 5KOIA 1TAUA 2Z56A 4QUHA 5K0BA 3P0RA 2GRAA 1KK0A 1D09A 1QGZA 1JSXA 4EFKA 5BWMA 4NSNA 1QM5A 3BMNA 3D4LA 3ISVA 1E4YA 3D7KA 13PKA 1V9LA 3BE8A 4MW4A 1YASA 2L17A 1EAMA 3GCZA 1GNLA 3M89A 4WVFA 2AFHE 5K0GA 3Q41A 3DVLA 4J0FA 4UTOA 4AO8A 5M5BA 4L15A 4EKYA 3MBIA 1ZINA 4G4GA 4BXOA 3SC4A 3C4VA 3DBLB 4G5QA 3V7FA 1G20B 2FYTA 4NFYA 4YJ2A 2QP3A 3ILYA 4PS0A 4K05A 3C6YA 1ZUIA 4JI3B 1OC2A 1OZFA 1IDOA 3L6RA 3RTEA 4HNUA 5BR7A 3OX2A 4CIYA 3RS5A 3F1LA 4D26A 1HE5A 1H2ZA 1NPDA 2IS6A 3EDQA 1NSYA 4EPXA 4G8JA 1IJEA 4ZGBA 1Z2OX 1XXLA 1Z5GA 4IJWA 2ZLBA 1SEVA 4FR5A 4NENA 2IEZA 1JECA 1Z6PA 5BSEA 2ZR7A 2VF8A 1O8BA 1Q3TA 2ZRQA 4L4UA 3FMVA 3RIGA 3JU3A 3SJZA 4DJTA 2LD4A 1U8YA 3W5SA 3IQIX 3QKRB 3PYLA 2QRNA 4L5BA 4E2YA 1ZXXA 3M6WA 4RH0A 4M7PA 4L3OA 2VHWA 4CMIB 4EG3A 1V3TA 4HVTA 4WK4B 1JVSA 3ADBA 2F4VB 2DWOA 1QG2A 2NT4A 1W49A 1QV7A 3GRZA 2BEWB 5LLSA 1GGEA 1RADA 1CPYA 4MI3A 2FPGB 5IAAA 3RHZA 1B76A 1XRSB 4EF5A 4I81A 2I1QA 2IGTA 3S2IA 4Q4HA 4A0GA 2PEYA 4E5KA 4IMJB 2QEQA 4E5YA 1GR1A 2NWQA 3FB4A 4M37A 4ALKA 1H2XA 2GO7A 2YNMD 4P82A 3CF6R 4MVXA 3VR5A 1LSJA 2W2PA 2HXYA 4JT9A 2AG5A 3L0IB 4NK5A 1W36C 1SVKA 1RZ3A 2ZDHA 1A7UA 1Y1LA 1Z36A 2AN1A 1XZIA 2I3AA 2LIPA 4EGSA 3CA8A 3L4JA 3ONEA 1XA0A 4O1MA 4CTJA 3L1IA 3QH4A 2C8LA 2F3RA 2X7HA 3KQSA 2DQ4A 3P2MA 1WL8A 1MENA 1L5VA 1TJNA 1O6ZA 2IYXA 3P7MA 2ZUTA 4A23A 1MEEA 5FAKA 4CG1A 2D7JA 1QCCA 3ENKA 4GMGA 1Q21A 4MVJH 4V2IA 2GVZC 2GS9A 1LLFA 1GQSA 2JFUA 3AZPA 3CW8X 1G2OA 5HZHA 1M0TA 1C2YA 3PR2B 3KQKA 4MCHA 3EMBA 4IHJA 1N2GA 1T5DX 1U65A 1HMPA 2NVWA 1E5XA 3MLEA 4IEIA 3R8CA 4JELA 3STUA 3UMJA 3AILA 4JC0A 2ZT6A 5IUNC 1D4AA 4D3DA 4RTMA 1X8JA 4OSEA 4ZQEA 1RVDA 4FE3A 1DVRA 2VLBA 3MGCA 3PE4A 2PZGA 3QWIA 2D0IA 4FWIB 4OA5A 1B16A 3WMFA 2PZEA 1BXRB 1BVHA 2ZBEA 3PD1A 5F5NA 4B6JA 4HNAB 1E2NA 1FFHA 1H66A 2ZIZA 2HLHA 5ES3A 4F45A 2RH8A 3LF1A 1OI3A 1V6AA 2F1IA 3AFNA 2I34A 3IULA 4C76A 4TKMA 4AY6A 1KSGA 4YJGB 1XTZA 2EGHA 3CFYA 3S55A 1E3WB 3GDOA 1M8GA 1M2VB 2Y1FA 4REQA 3KJNA 1ZYUA 5ADVA 4FU0A 4WZBE 1PSWA 2Y05A 5A5FA 3H2GA 2VDWA 4JEUA 2CLMB 3L0ZA 3LQQA 4BMVA 5A4MS 5C4IA 5LZ2A 4EX6A 1YBFA 4DAOA 1CS4C 3UJ9A 1E4EA 3ICCA 4NZOA 2WYHA 1PWZA 2GB4A 5D85A 1ZAKA 1YB7A 4JJZA 4EKEA 1JFLA 1K0FA 4X9XA 4DJDC 2HT1A 5EIBD 3REGA 2OPHA 5J4KA 1KO5A 1XQ1A 2XXBA 4MQUA 5F2NA 2PKXA 2PXHA 4X7PA 2BP7B 2EGGA 5IHPA 2VOEA 4OQDA 2IU3A 4RVUA 4YCJA 3DBIA 1YOVB 2PBLA 1T4MA 3FJ1A 3MMXA 1KO7A 1VE9A 3D6VA 1FDOA 3DG9A 4WVLA 3PSAA 5IJ0B 4GZ3A 4KHPB 4KO1S 3AEXA 5LQCA 2I2BA 4Q1BA 1XU4A 2P9QA 1WM1A 4QGBA 4TV9F 2CGEA 2QMOA 3BH7A 4ZOQI 1XKQA 2YDXA 2IHNA 4UVHA 1B74A 1Y5RA 2AEFA 2JGNA 3O91A 2QTMA 2UVQA 4R9UC 4V0ME 4J9UE 3GLGA 2YXNA 1AURA 1PR5A 1U8XX 3R5XA 4B82A 3BHIA 4TWBA 1PVOA 2N46A 2R1TA 4R51A 1ENOA 1U8UA 4NU0A 1LSUA 2OAP1 1ZSVA 3CMCO 4R4JA 1P1FA 3AV3A 1C2TA 1TUGA 3P20A 4Y9DA 1MQ8B 5FL7A 1OZAA 1M6HA 3GH1A 3ORRA 1NBOA 3T3OA 4AWAA 1UOEA 3MAGA 2DGDA 4YMIA 2WSSD 5M3BA 1KXJA 1D5WA 3QKWA 1BNCA 3AERB 5CD9A 1F06A 1Y9DA 4NDNE 1HDOA 1GTRA 1QFJA 4G09A 4BQPA 4I55A 4W6QA 5JD5A 2BE7A 4YVFA 4R1LA 3WLSA 2I67A 4PHTA 2EHDA 1KZ4A 4X60A 1UBEA 1UKEA 1IHPA 3FCUB 1D6MA 3UC5A 4NS4A 1WXEA 1OXKB 4YAJA 3EG5A 1MW8X 1I4LD 1SCBA 2AVDA 2R1UA 3A1TA 4K03A 3R7BA 2FZGA 2VH1A 3JD4A 3NB0A 1F7UA 1ISGA 5ALXA 5TQJA 4R6XA 3UEOA 1ICEA 2NV6A 2H7XA 3BTVA 5CW1A 1P3JA 5YASA 3U1TA 2CLCX 521PA 1NKSA 1YRYE 5KYWA 3M9XA 5JDCA 2RDMA 1YONA 1KEEA 1ADJA 4A9AA 2ORIA 3B1XA 3OA0A 3HBJA 3SYRA 3H5VA 5SZJA 2Z04A 4HZUA 2FF7A 2FWNA 4DNOA 4ZVPA 3M70A 4Q7KA 2Z09A 2QMQA 2VTKA 3DDZX 1D6JA 2QTHA 4NPAA 4OFXA 1CQZA 5IDYA 1I7SB 1DNPA 1LBHA 2DLNA 1L4YA 1X7XA 1UBOS 2WFMA 1K27A 4FYVA 3SEQA 2QVZX 1LI7A 3GXOA 4AX4A 1IUKA 3LI2A 4GGOA 1DC6A 5LYJB 5TQVA 2XE8A 1L5MA 3CGWA 1XZKA 3UA4A 1A5TA 4BNWA 1ZI6A 3QIVA 2YOHA 4K9OA 4B34A 3W5BA 1A9QA 4W5OA 1XJ5A 2ZXEA 4QHTA 3QVTA 4JUIA 3V1TC 4M6WB 4YCDA 4ZO7A 5TPWB 3WAGA 3VU9B 1UMCB 2JPDA 4E3ZA 1CV2A 2ZRLA 1D0IA 2GDJA 1LPAB 2BDEA 4CDRA 4FMDF 3HUTA 4GR5A 2X0IA 4BVJA 4ARBA 2B4KA 4ECAA 5EXTA 3EWNA 3I8XA 3IQZA 5A0FA 3I2HA 3CZ4A 1N25A 4IS2A 4ITVA 1YS4A 1HEIA 2IFTA 4V0KA 1USVA 1ZNXA 2A6PA 2MIIA 2F00A 1HWYA 3JD0A 3MGBA 2DBZA 3CKYA 3TKAA 1KL7A 1J0DA 5H83A 1Z5NA 1SVOA 2JFZA 3NT5A 2G0NA 3PZBA 4OI1A 4M1ZA 4UOZA 3AXSA 2YZMA 3LIIA 4QFCA 1SD2A 3F9RA 4WACA 4Z6KA 1NU6A 3D0QA 4X90A 4ESVA 3ABRB 1ZL0A 1Z2EA 5KHLB 2OTCA 4HN9A 2J8ZA 4WADA 5CG1A 1H3EA 3R0ZA 3HDYA 4MVJF 1XLUA 2IX3A 2GCIA 2ETVA 2FV8A 2XV1A 2BHSA 3K0KA 1GQYA 3D59A 1P73A 1UXGA 2WJVA 2X4IA 1AMOA 2VDUE 4WKCA 1NNI1 1V4NA 1COWA 2P8JA 3GLTA 1VSTA 1A9OA 3RYCB 2RBEA 4C4AA 1VYUA 5KCZA 3CC8A 3RYHA 4HAYA 1VB3A 3ZCUA 4GSLA 3A4YA 2GF0A 2V9CA 1E7YA 2Q3MA 4A8TA 2RE8A 2ZYVX 4PONA 5I4BA 2KW5A 2QPLA 3HJAA 3ELBA 3ZWAA 1KYIA 3QKTA 1EFCA 1CZLA 1SBNE 4Y2JA 4BFLA 5AM2A 4MRPA 3DKKA 4EFMA 2ODBA 5CT5A 4MGIR 3LBHA 1IBMB 1VI5A 4FS8A 4ARCA 2GBIA 4WXPA 4FX2A 3WMRA 1P3DA 2AKEA 2G17A 2NXEA 1GO2A 3G59A 3LC2O 3OJOA 4JYMA 2X4GA 5FH9A 1ZH6A 3OLVA 1GRVA 3FPJA 3IEXA 4AKEA 4EJ0A 1I32A 2H0RA 2BFMA 3HR7A 4CLRA 1U80A 5H0IA 1AJEA 2N42A 3SMVA 5JH7B 1LVUA 1AKVA 2ZB2A 1BDIA 3S81A 1DIBA 4ZAVA 3U48A 1D2NA 5JY6A 2AFIA 1NMYA 2PZLA 3NX4A 5ALUA 2BJHA 1YQXA 2J67A 4JOCA 2REQB 3CISA 4B7CA 5BMVA 4FNMA 3UHFA 1EG2A 4O4IA 5BVHB 2ZGVA 1VPWA 2WLTA 1W48A 4YCSA 1YUNA 1JAXA 2FPGA 4L6IA 2CLEB 1C50A 1Z5UA 4RWZA 1T34A 1T8WA 4OXYA 1XRMA 1BVUA 3SR0A 5L3SA 1B8UA 2CMKA 2EAUA 3I6QA 1B43A 3F8SA 1U0TA 4PFJA 2BZSA 3HA7A 3RF6A 3TQCA 1FP6A 5A7FA 2AC2A 1XTTA 4OOEA 1HZJA 5DSZA 3LC0A 2XKKA 2A9PA 2V6BA 4IXTA 4OB7A 3A11A 3ECCA 4I36A 1YQ9A 1E1DA 1OA1A 1G8SA 2NXJA 2DXIA 1HDIA 3NHUA 1MDFA 1W4RA 4C3VA 4LGMA 4ZQCB 2CXQA 3LY8A 2NO5A 4K9LA 4PQFA 3G7NA 1IZ9A 2Y4NA 3AOEC 5CT4A 3KOUA 3K6SB 2PE5A 1QOQB 5DXFA 3MB5A 4HXFB 1NC3A 5HP4A 3HK2A 5BRJA 4RS4A 5EJ2A 2IH2A 1Q0UA 4KQFA 2O6HA 2WF5A 3AONB 4Q18A 5AJUA 3UMYA 4YK7A 8ABPA 3E70C 1D1PA 2B1QA 4BUCA 1QIHA 2MSWA 3KZVA 3Q40A 3HN2A 4Z86A 4KSBA 5HA5A 5AKEA 5I9SA 3WYNA 2AOTA 4WTOA 1TCVA 5GOTA 2XQJA 2XTJA 1EGMB 2P2YA 4L5JA 1HT0A 4XIFA 2J9RA 3MXOA 1QKJA 3I30X 3RV4A 2X22A 4XWYA 1FTGA 4HUQB 3T7SA 5EHQA 5EJAA 3Q0TA 2HMYB 2PMDA 1E62A 2H2FA 2QTCA 3DDNA 4HJRA 1UL1X 3D2LA 3I12A 4LEIA 4BNMA 4DJ5X 3NASA 1PSDA 5KTKA 1QYDA 1YS6A 4GYKA 2CZCA 3IHWA 3O83A 2PKWA 4I1YA 4WE3A 2OD7A 3OT1A 1NPTO 4NH0A 4F7DA 3FOZA 1TVEA 2VRNA 2H57A 2GESA 4JP1A 1QHYA 3LYUA 1MVNA 5EP4A 5KYGA 5HRAA 2BEVB 3OAAD 3S99A 3I6IA 3GO4A 2PZJA 3HEAA 4HAIA 2GASA 4F8JA 3I2IA 3WLTA 3CBQA 3ZWDA 3ET4A 1UBKS 5IP5A 4DLAA 3K9QO 4B4KA 4TVSA 3KR0A 2QZZA 4C6SA 1W35A 4A7PA 1LQTA 4E5PA 3IDQA 3WRXC 2JS7A 4EEKA 1T3TA 3CYFA 3EGCA 3AF6A 4OP2A 3A28A 2R6R1 1NFFA 1P29A 2FUNB 1I3MA 5FOQA 2W6NA 1KMNA 2VT2A 5J5AA 5M04A 4DB2A 4OUKX 1P1CA 5TS3A 4AKSA 1XAHA 1X0VA 3QVWA 3T3EA 5JS1A 4Q5IA 4BLTA 1QU3A 4PCLA 2VBGA 5CVTA 2LE0A 4UZEA 1BMFD 3LKZA 4F4IA 4AYTA 1MEJA 1OMOA 1ZOLA 4C3ZA 3G82C 1DTEA 1FFSA 4X71A 4DREA 3O03A 3VNVA 3P5SA 1KWKA 2AI2A 2XTZA 3CIFA 4J94A 4RJTA 3EXG2 4RVOA 3ES9A 2V0NA 1C7EA 1OFVA 2E55A 1F6WA 1S5PA 1QV6A 3NT2A 3QBDA 1SRRA 1OGJA 2XBUA 2B2NA 3AEQA 2NG1A 4RD1A 4MUMA 3HWWA 4HDOB 4XDYA 5HZKA 2YYSA 3FF1A 5COAA 4P54A 2V7QA 4XJXA 4J03A 1E2PA 1GZ3A 2CSUA 3CH5A 4MVYA 4PR0A 3VMFA 2BMEA 3O4FA 3OHSX 2B98A 3BTSA 4J9VA 1WU7A 2AMYA 2Z98A 3K9BA 2GYWA 4TVBA 3SIPA 2EJUA 1RSZA 3KPYA 4JENA 3OLZA 1EDDA 1CQIA 2LXNA 1C5KA 1AK2A 1U28C 2ZJYA 3K4PA 1T3LA 3TD6A 4H1HA 2XMQA 2GPAA 4TLMB 3CN9A 3QV1A 4ZYVA 4ZZ0A 4M8LA 1B0UA 3AP2A 3RNLA 1PZGA 4MWDA 4RTPA 1Y1QA 4E13A 1MF7A 2VL7A 3F5QA 3PRHA 4DIFA 2NVUB 1QSGA 3L7BA 3KLOA 4GI7A 4EH1A 3KHUA 2UU9B 2I6FA 3GFSA 1ZC3A 4M21A 4Q3AA 2IZ5A 3WJ7A 5K8LA 3LZ6A 2JLVA 4KR6A 2E2WA 2WE7A 1KU0A 4JJ8A 4BWFB 5AKYA 1C4XA 5BYBA 4FFOA 3TE7A 1XXHB 4QNRA 4R98A 4F72A 2R2AA 1O7JA 1SIBE 3LT4A 4Q82A 3UB3A 1BHJA 2QRKA 1YFLA 2PQ0A 4LV6A 3HV0A 4GXTA 5AKJA 1C4OA 1SXJE 1QGAA 1E3LA 3REOA 3DHWC 4JP8A 1NJ5A 2QSZA 1NDUA 1O5OA 5MGBA 1S3FA 3FFWA 1J99A 3HKEA 3I37X 4UATA 5EUCA 3GHYA 5IH3A 4DIEA 3AV0B 1JHVA 3GMSA 2O52A 2KSQA 3BEDA 5SV2A 1NBME 2F8TA 4BKUA 4Q1DA 5C1BA 4D25A 4MCJA 3SFZA 4TT8A 3O4GA 1EQAA 4M2LA 5BO5A 1CX9B 3SR3A 2TYSB 5BWOA 4ZO4A 4G4IA 3V4ZA 2RAVA 5EVCA 2AFIB 3HYSA 2XOKD 4KTVE 4LNAA 1PK7A 1I2BA 3GLFB 2HLNA 3HA2A 1W96A 5AVSA 2GNOA 2O1SA 5FTWA 4RK0A 1BX0A 1Q3HA 2DWCA 1ZW6A 3B5IA 3FSEA 1R0ZA 4G23A 4TL7A 3KJGA 3SFVA 2H9IA 3F4LA 3WWZA 1VHWA 3IEUA 2PUFA 5AVKA 1SJ9A 4S2EA 3T1VA 3HLKA 3AF0A 1I1HA 3WYDA 2BJVA 3PEWA 4YIHA 4Q9NA 2F1KA 4JUAA 2FPXA 2H0AA 3RR2A 5JASA 1OD6A 3GLIE 2JIBA 1JLMA 1OHHD 2NXNA 2NO7A 3BGWA 3ESXA 2AK2A 3OEHD 4OP1A 1F5NA 1X7DA 2O1EA 1DRUA 5E9JA 4FEAA 3AEUB 4BFYA 4LQLA 4G9GA 1P80A 3SU8A 3W3AD 1AMNA 1YO6A 2OC9A 2Q5EA 3DMTA 1ZJ4A 4OQEA 2XKBA 1K88A 3WX0A 5IF3A 2FFJA 1NT4A 5JZOA 1CJSA 2FG6C 1NVXQ 3DTTA 2JFVA 2L19A 3NDPA 1XDGA 3QU4A 3T61A 6CHYA 5HTOA 3L7DA 3EGXB 4EJSA 2F1OA 1R5JA 2JJ1D 1W0JD 4J29A 5CB6A 3H9QA 5D5QA 5J40A 2QPTA 5K99A 3OQOA 2ZSAA 3A1VA 5JMTA 4IDEA 3DEKA 1GY8A 3GJTA 3L6UA 3N07A 1B7GO 1AD2A 4PRZA 4W63A 4EA6A 1NXVA 1T35A 2PWBA 4DMCA 1I33A 3F7NA 5FHRA 4GOMD 4H7PA 3MERA 3QHQA 4S3MA 4LFCB 3EVGA 1QWSA 2YQ4A 3Q5DA 4NIMA 2WWHA 3NTUA 1RBYA 4QNMA 1GNSA 3F2VA 3GBVA 1OASA 3A6HA 1JSLA 4O2AB 4JGBA 5JALA 4KUHA 2QMEA 2DLDA 5ED4A 2YN2A 1LA2A 4RMHA 5JSHA 1FS6A 5J2UF 4YAUA 4G0XA 4B80A 1Z4PX 1M1YA 4BC0A 1HL3A 3GEHA 3FZQA 1YULA 2OZKA 3ZI4A 2Z1MA 4D8UA 2GXAA 4MDYA 2FSPA 4QATA 5IBPA 2QRVA 3DXFA 4Y30A 1G8JA 4U6QA 3P9SA 2HO5A 2ZIEA 1VHTA 3G3EA 3QEJA 4TL9A 3KKMA 5EEGA 3IBFA 4JJ4A 4WUTA 5JD3A 4ZDWA 3FTNA 1Z39A 1JR3D 2EF0A 3OZWA 3A2NA 1YQDA 1DTSA 5AHWA 1E98A 3IBCA 4GGPA 1F51E 4NZ9A 2BN4A 4ME6A 4DR6B 1CUWA 1R74A 3GRKA 4Y2HA 5DTRA 3M5DA 2ZWIA 5EXDA 5ECWA 3KSAC 3DEZA 2OORC 5C7LO 5K5EA 1R9GA 3BZUA 2F1HA 2HJ9A 5B2FA 3F5SA 1GCOA 1N6HA 1UBRS 1X94A 3H3JA 3VGJA 4XGIA 3D3WA 4HZUB 1GPKA 1BAPA 3GPDG 1UBHS 2JHPA 3KOOA 1NM5A 4P7KA 1B0PA 5CK4A 3B7GA 3TX2A 4O0MA 1LS6A 3CTPA 4KODA 3D4PA 4ZGWA 5DYWA 5BSUA 4G9BA 3KDAA 1T0JB 1NY6A 2JK1A 4K9KA 2ERYA 3HLTA 1P2BA 2OHOA 4R31A 3RSFA 1X14A 1WXFA 2J33A 2PPLA 2V7TA 2YJTD 1SKYB 3ISJA 3PHCA 3K5PA 4PAMA 1JKFA 4QQRA 4RVDA 2Q45A 3TZ6A 5HDBB 3C3YA 3ZE7A 1V7ZA 1SD5A 5CIWA 1N36B 4ZTZB 5KHOC 2GM3A 4INJA 5JQWA 3IJ5A 1JMKC 2C92A 2JAPA 2F43A 3FPSA 4RHCA 2ZWVA 2R65A 4U2CA 4UUBA 4A5SA 2HL6A 2VJMB 1H85A 2H1SA 1EFLA 1XFDA 5KOHA 1KYYA 4KFUA 1KO4A 1RLIA 2Q1UA 2EOAA 4IFBA 1BS9A 2O2CA 1FFGA 1BN7A 3VTFA 2OCPA 3U3XA 3MWEA 3GUCA 5DHQA 4G0QA 4TUYB 4NLLA 1G3QA 4WJLA 3AP3A 3PUYA 2FXVA 1KSHA 2ZUUA 3NKVA 4OJYA 4RF4A 4HDMA 4WLEA 2GBLC 5D51S 4E4RA 1OGIA 2HA3A 1G3RA 4J0EA 3K0BA 5HE9A 2GZHA 2G6BA 2CJXA 2BMAA 3ISTA 3JYLA 3PZRA 4IDQA 2OZPA 1Y89A 3EQ9A 1PW5A 5SY4A 2AJLI 2ZQ5A 2AIRA 3GT3A 2VQ6A 3MXTA 3H9UA 5ECDA 2HFKA 4OBXA 1F5SA 4CM6A 4DE5A 1K63A 2W6OA 2AN5A 2QUHA 3O21A 3W9YA 1LWOA 4BASA 2ZVQX 4YAFA 1KDTA 3C70A 4J7UA 3A2KA 2BR3A 3C74A 3EWSA 4L5AA 4XB1A 4YN3A 3TCNA 1EBUA 3GVXA 4NAUA 4A27A 4D9IA 3EPJA 1MZPA 3W2EA 7ABPA 1UBMS 4Q34A 4X1YB 3U6KA 3EPHA 1XZFA 3TTXA 1EPUA 3VHQA 3M5CA 3FOEC 4FNGA 1B3RA 3UHAA 3M4NA 4L5YA 4UTPA 4Z8YA 1WIWA 3OZDA 1LDBA 4YUXA 1SVUA 5THXA 3SZGA 4M49A 3DE1X 4QICA 3WFJA 3B20A 4FEGA 1I80A 3L6EA 4KIUA 2FP3A 4R8LA 4ZWNA 1YBAA 3VTAA 4Q3OA 2L42A 1M73E 16PKA 2WQ6A 3H65A 1PTKA 1II9A 2TMGA 3C16C 3NHMA 3HWX1 1RFLA 4TXMA 4WGFA 3QFHA 5CM9C 3DVSX 1Y6QA 2I4TA 3NIDB 2SCUB 3CV3A 3QPCA 4KW7A 3EBLA 5CDGA 3K0EA 3FB1A 4FE4A 1MAUA 3LYHA 1FTNA 3PUXA 5JPIA 2P9TA 3QU7A 3UO8B 3AB8A 4U0KA 5B55A 1PBNA 1L1FA 1QTIA 4YRMA 4LBVA 4ZD6A 3SJAA 3GEDA 4MVJD 3T9AA 2C61A 4GRAA 1KPHA 1V4VA 1Z28A 2G4LA 3RYTC 2WJWA 5CD1A 4CQLA 1QK4A 2R87A 4M87A 4EVSA 4OBBA 3DKRA 1F20A 2IHZA 4NBSA 2PL3A 1UIMA 3JAKA 3HCRA 5A1JA 4F97A 3K94A 1Y7TA 5I8ZA 4X1IA 4XQEA 1G4UR 3C45A 3O4RA 4C9BA 2IS4A 2PN1A 1SPBS 2HWUA 1P7PA 2GK7A 3FETA 5HF6A 1E2UA 4HO1X 4S0XA 4HK4A 3RVRA 4CR6A 2JD1A 3R3ZA 4P1ZA 3ANXA 3ZK9A 3WNDA 4YT4A 1RU3A 3FDZA 4JYBA 4EKGA 1J21A 4O33A 4LFBB 1FNBA 4E4YA 2QTRA 5GQSA 5GADl 3HBLA 2Z4TA 1NG1A 3BZWA 3NIWA 1NN0A 4FW9A 4EB0A 4G6ZA 3WIBA 5KREA 2OV8A 2FZLA 3MTGA 3Q8WA 3BAZA 3WO0A 5LQJA 2ST1A 4YT8A 4YIKA 3BVPA 3PLAE 5F2KA 5HS4A 2H18A 5B58C 2P27A 3TLAA 5EMNA 2AX4A 5H70A 1QQ7A 5DIZA 1PHPA 4D9JA 1LSOA 1WHTA 2YBDA 4CN9A 1N2CB 3ZGLA 2V03A 4H18A 1SRQA 1KDYA 3WHKA 4WBNB 1QR6A 4UQLA 4IHKA 1QDLB 4MI9A 1FY2A 4GU5A 4KG7A 5C18A 4XX1A 1KQFA 4JI4B 1W4LA 3BMXA 3AUFA 5JV5A 2ZSHA 1DUSA 2OUKA 5ECYA 2WE8A 1ACMA 3GARA 4IL5A 4UREA 1OPRA 1P2SA 3A1WA 3F71A 4FGSA 5IW8A 4MUIA 3OM0A 4IDOA 4ZRNA 4C0WA 4CM8B 4HN4B 4KGXA 2PZBA 4PCAA 1FP7A 1VYHA 2CXSA 3NCHA 3QHPA 3KZCA 3IHLA 1UZLA 2HSEA 4M1OA 2BFAA 4N7MA 4TS1A 1XTIA 4IRXA 1KY2A 2FUG6 1R0CA 2C7BA 5KVVA 1OV6A 3H97A 4UZFA 5A0TA 2C9CA 1HYEA 2I4MA 1MB9A 2C88A 1N1EA 1YMVA 3MCTA 3TEFA 3VBCA 5C1IA 1RYBA 2HZ7A 3AEKA 4Z2AA 4W7HA 3AERA 3SBXA 3GV0A 2ZP1A 2LDXA 3L93A 1KDOA 1C0LA 3AF5A 3I0ZA 4GVXA 4LZAA 4EECA 5U4QA 1JSRA 4D3FA 2D8MA 3KDSE 3PF9A 1TW3A 3U3RA 5A4JA 3DULA 4O4HF 3THOA 3D6FA 1CQXA 1XEWY 1BKYA 4QDZA 5LZ7A 1YF3A 4UBOA 2XT0A 3AZOA 5HEKA 4N01A 4BE9A 3DL4A 3R0QA 1DX9A 3U44B 4YONB 3MJ4A 1PT8A 1HQYE 3C7CB 5DI3B 2J3KA 4EHBA 3C43A 1MD9A 3FCSB 3O1LA 2E49A 5TT1A 4F2GA 4B6EA 3ZGZA 5GPBA 2VQSA 3JSXA 5DHUA 2G1JA 2HOQA 4ZEXA 1GKUB 3VDRA 4J16C 5LDGA 1YB2A 4C4XA 1TXGA 4YPVA 5KJCA 1UPFA 1U2RA 2ZAOA 4OL9A 4ZCLA 2ZOSA 1YOVA 4IZOA 1FEZA 4OHBA 5B53A 2EGUA 4IDBA 1XMIA 3SZLA 2K7FA 4DDTA 3QE0A 3ODPA 3WLNA 3N3BC 2SKEA 4YJDA 1XYVA 1Z7BA 3NATA 4FDUA 4M1KA 4F6CA 4WNAA 3N74A 3TAHA 4C78A 1JXMA 2WU4A 1L8XA 2YL2A 2ZQYA 5B1HA 1C3OB 4O2BB 2P68A 2TSYB 4HDAA 2XZPA 1QHXA 3A9VA 2G08A 4CNBA 4DSZA 1O2DA 1EQ2A 1G8PA 1R8JA 5LWHA 3WZLA 3OQNA 3F3KA 2NO0A 4D97A 4REQB 2HA7A 4UNIA 1XA3A 5EINA 3TYXA 1A5AB 4Z4IA 2LP4Y 4NCIA 4IWYA 5J9FA 1WHSA 3PKJA 5IM4F 4DCVA 3BUSA 1KJJA 1SUBA 5BW6B 5F7ZA 4NBNA 3UG7A 4HNAA 3UXHA 4KUEA 4CCWA 2BFNA 1E7QA 3BMOA 3RARA 1VCIA 4MP6A 4N82A 4KITB 1ULZA 3I1JA 1EP3B 5JDCC 2BFEB 1NW9B 4FZ5A 5K3CA 1DDIA 1USKA 2I65A 3EZNA 4NMXB 1RBZA 5FEMA 4IJQA 5F98A 1P0QA 3E5HA 3N0VA 4GPTA 1X9IA 4D9BA 1S96A 4Y9SA 4H4EA 1IEQA 3MS2A 2TMDA 2G67A 2VI5A 3AG6A 4TMYA 3B89A 4U7GA 4ZDKA 4GRIA 5HKKA 1GZUA 2GM9A 3OQ1A 4R8SA 3CNNA 1NWHA 3I32A 1NLYA 5CAEA 1QAOA 4MLPA 1CK4A 4MRAA 2UZAA 4HWTA 3BGSA 4ZVOA 1MB4A 3KFLA 5EUMA 5K3BA 2MCFA 3ZIAA 1OLXB 1L5GB 1BHO1 5PGMA 2P77A 4GPAA 1XVVA 2JH8A 5L4NA 1IFXA 2Q3FA 5AQ1A 2CV1A 1SHKA 2H5LA 5AUNB 2WQZA 5IFKA 3GUYA 2H1IA 3E82A 4X7RA 2WF6A 1Y8AA 3HP7A 5A3SA 1OLUB 4RZIA 4D79A 2P35A 1UK7A 3G2QA 3VZBA 3U7FB 5E6RA 3SF8A 4QLBA 4V0MA 5JAHA 2XQVA 5IM5A 1A9XA 4RZUA 1H9CA 1YZVA 3KZOA 3E2MA 2CNBA 5F21A 4IKPA 2C4UA 4XW2A 2GPSA 4KE6A 5FPYA 4HS4A 5CP8A 2OB2A 3H11B 4ETMA 1ECBA 1XKTA 1RFGE 2M98A 3BCHA 3PCTA 4B6OA 2YWCA 3HTXA 3F6CA 3M0EA 2F3UA 3Q3VA 2ZUFA 3FKJA 4Y2VA 3ZJTA 3M4XA 2IV7A 1JILA 3H9CA 2Y1GA 5DHTA 4RKFA 2GPJA 5ALHA 2C5GA 1IAQA 4YDHB 1KI2A 2V7XA 3SNKA 5AD1A 2E5LB 2VP6A 4HGQA 4XD2A 5KZMB 2OD9A 2BFBA 4IBOA 2C3PA 4DWWA 4NONA 1CP3A 3F96A 1M54A 5A06A 3ELDA 3WIUA 2VTBA 2ZBFA 1XLTA 4E5NA 4MQEB 3BD9A 4TTPA 1QRAA 5DN9A 1MX5A 2CUNA 5ELLA 1PD1A 2GQ0A 2PD4A 5IYZA 2JFOA 4ZDIA 1QP4A 2KBEA 1YE8A 2MDTA 3MF4A 3PNOA 3IL2A 2XMDA 3E4CA 3UW1A 2I3BA 4YLYA 2QXYA 4RJIA 4UM9D 3RAFC 1P6UA 5F1KA 1T5IA 2P40A 1PJ8A 1Z0KA 1D2MA 3G5AA 5IJXA 4BP9A 3MHPA 4PTLA 1RLOA 1C81A 5TMEA 1Z88A 4BGVA 2OAEA 2YHIA 1YU9A 2O2HA 1N1MA 3K53A 2PNJA 2PUGA 4MR7A 4E6PA 1WPRA 3HL4A 4U1RA 1X6VA 3PHIA 3PI6A 3FBGA 2RGGA 2V7EA 3EE6A 2H85A 3DZDA 4OXQA 4S0ZA 2XGJA 2D3TA 3C14C 4H9GA 3VNBA 2YIMA 1BD4A 1NN5A 3AGPA 4XI9A 3EPKA 4C20A 1AA9A 4DUZB 3TAUA 3C3KA 2PYDA 4GC9A 4B6PA 3D8RA 4Y2PA 4DGSA 1P1HA 1P7VA 2QY6A 1ZR2A 1JA9A 4LVNA 4MROA 1E9BA 4M9XA 2Q3CA 4TS3A 5WRFA 1K8RA 2C97A 2ZE5A 4MQBA 4AP5A 1H9BA 4GEKA 4G24A 4J2OA 3VPXA 2OQ2A 2ZYIA 3ME5A 4QRDA 4UVIA 1ZY2A 1I14A 1CUFA 5FI0B 5TDHA 1K68A 2HRRA 1TMKA 2JGLA 1XF1A 2JLRA 2XUGA 4MWGA 4W1QA 4COOA 1NRWA 2CDNA 4Z51A 4MYDA 3EBOA 3AETA 1D6NA 1LK7A 4NATA 4MB0A 3V1MA 2CCKA 4EX7A 1GT91 3DW3X 5KPDA 4QOHA 5FKJA 1EIZA 3FR8A 4ZTUB 1MAWA 1PR2A 2GT1A 4KRGA 3B5JA 3DWFA 1WJGA 4N65A 3WXMA 1FX0A 2BKVA 2VPQA 1SB8A 5DU2A 5G2OA 2CKDA 1SIOA 3MS4A 4GI3A 3V9PA 1SUEA 5K03A 2PJRA 1VMAA 4TV9B 4E7PA 2WPDA 3C5EA 5FO1A 4EEZA 1U31A 1R0WA 1L4HA 2QTFA 3OF2A 1BQ4A 3PUJA 1PJAA 4ZZIA 4HGRA 4MVJG 1XJCA 3GLGE 3KB6A 5DNVA 1DCFA 2WTUA 1GRNA 3A6ZA 3EYAA 4NULA 2HJSA 4ER0A 2VDQB 3DOUA 1Z45A 4JYZA 1GRQA 4GGMX 4RELA 2H2AA 1TFRA 4BX3A 3OIUA 2E82A 2PRIA 4OP3A 5ITZB 3CF0A 3E8XA 3H6HA 4QGFA 2E87A 3UAGA 4UXHA 4QBTA 1IJBA 3ZGNA 1IAVA 5C7IO 1X38A 3DB2A 5B64A 4EGFA 1R8SA 4QPZA 5LN1A 1WF6A 1LJLA 3NHBA 3ZE6A 3RIXA 1SCJA 1Y42X 5JROA 3TZHA 1CDEA 4JVLA 2A2ZA 2NZYA 2CKMA 4WECA 2G5PA 5D84A 1VLZA 2QVLA 4MLCA 4MWCA 4IH4A 3KP1A 3OPYA 3JQPA 4EATA 1AK1A 3MINB 3B1WA 3N70A 4GZ6A 2BTQB 5TF0A 1S3GA 4QUDA 4R5HA 2E1PA 1P5JA 3KYJB 1D5CA 1Q15A 2VRCA 3PX3A 3SJCA 1ZMBA 4Q1FA 1BGWA 3BIFA 3FMOB 3PA8A 2UKDA 2H0QA 1CR4A 1PI3A 3HR8A 3SJBA 3SGLA 2BFEA 2P11A 2ODPA 2ZI6A 4L0MA 4Q19A 4YRKA 3RYCA 4YMSA 5DGHA 3RSOA 3HXMA 4IXDA 1CUXA 2W6PA 5AYVA 1QB8A 4K26A 1Q50A 4HVLA 4NBLA 2XVMA 1PZFA 3ZV4A 2EX0A 3GLFE 1PT9A 4H16A 2YC2C 4PZLA 5J2TF 2Q29A 3SC6A 3CO0S 1UZNA 4TV8A 4E12A 2EQ5A 5IAEA 4RVHA 1J8FA 1PHRA 3GEPA 4KQWA 1M72A 1GG5A 5KVSA 5L3QA 4HLQB 3SHVA 3ZIUA 2LUOA 1DJPA 3FZYA 4MTCA 2IHBA 1T8RA 3U7QA 1DRJA 1DC3A 3FCAA 3WNZA 3ZXXA 1AUPA 1W5SA 3GEEA 5K6TA 1JGTA 1I0LA 3SEFA 1WVIA 2VHUA 1Q2XA 1SC9A 4AQ7A 4EOGA 2W70A 1C3OA 3OZRA 4O2BA 4DCSA 4LJKA 5D8DA 3OC6A 5FBZA 5FA5A 4BRZA 4DHWA 1K98A 2ERCA 3AJAA 4OQNA 5GWXA 1SBCA 3D6UA 2C5SA 3U4GA 3H18A 2IEBA 3LPMA 4MITA 4FD3A 4R1SA 3TQRA 1XSEA 1G291 4Q7LA 4OMFG 4CLDA 2O05A 3I05A 2ACKA 1KOLA 1XO1A 2F64A 4QELA 5HQJA 1DQRA 2PR7A 4XSVA 3HYRA 2AG6A 3JQGB 2UZ0A 1G8YA 2WOJA 4AN0A 2BCEA 2O3QA 4ZOLB 4W8OA 4TYPA 1IOZA 5D6OA 4ZJYA 4H6WA 4IMRA 3A6FA 4YAWA 2P90A 1PDWA 1SG9A 3AY7A 3RT7A 3TLYA 4YRBA 2YRFA 1IY2A 3TSAA 2HJVA 1CUHA 2SNIE 3AEZA 3HEMA 1TGYA 2Q8PA 3I9JA 2G7MC 1TK3A 1Y1SA 2HJGA 4K8RB 1PVDA 1OQAA 2WD8A 4O4LF 4S1VA 1OI2A 4UD2A 3BWCA 1PS0A 2PXXA 4NBTA 2JH9A 3D7SA 3TJRA 5HILA 4YMVA 3J81k 4W9NC 1W5BA 2C2ZA 3NFYA 2GLUA 1XLTC 3HSYA 2H00A 3OE7A 4XVQA 4HTAA 1LI5A 4LWZA 3L1HA 2XDQB 1CIJA 4CKWA 4AQYB 4KDCA 2R25B 3Q98A 2O8FA 3DGEC 4JKYA 2LPMA 5JEDA 4OQLA 3GVPA 5I4KA 1EWTA 1ZLXA 3NAMA 4ZGGA 5JWRA 3OU6A 4C0HA 2QHXA 4G37A 1Q6YA 1KBZA 4WA7A 3T54A 1SXHA 1W4BA 3VPBA 4OX9B 3ZWVA 4DJFC 5E8RA 3ACBA 5FLEX 2Q5QA 1A69A 3DDWA 4Y6GB 1YA8A 4O3MA 5TMDA 4OIMA 4AJNA 2QA5A 4MLZA 4BZWA 2Q6IA 3IVXA 3DLIA 2JZOA 1E9FA 3K6KA 4FM9A 3GRYA 3RS7A 1F2UB 4YRSA 3WIDA 4R68A 1Z4OA 3FNBA 1M2JA 3OD1A 4QTTB 3PUKA 4LCEA 2J46A 4KR7A 2DUNA 3ZZUA 4D3ZA 1WTAA 3PSHA 1JJAA 1E9RA 2J30A 3CRVA 3PQCA 4FI3F 1W47A 4JLMA 1FVOA 5JWHA 3O4HA 5HKKD 4Z53A 3CUSA 1LDGA 2Z1NA 1N5KA 4RPCA 4UAUA 4Q6WA 2LRHA 3VPHA 1HNNA 3COVA 4OI0A 1MAVA 1WQ3A 4NHOA 2PFGA 4BVLA 2Z2XA 1EKXA 3KD2A 1N9GB 2RHTA 2X40A 2NU7A 3C15C 1LF5A 2QF7A 3KCQA 2PLRA 4JB8A 4YAOA 4EHAA 4G5GA 5DM4A 1R4ZA 1U1EA 2ODTX 4N03A 3B53X 5LYJF 1XNGA 2QE7D 3GLGB 2ZUDA 1HE3A 2GCPA 4QD3A 2OCGA 2O2ZA 4OH7A 4H1WA 1AH2A 1A9TA 4L1KA 4CCYB 4M55A 4R9RA 3RAGA 3KPJA 5IJ9A 4G25A 4ZICA 3EASA 1YACA 1Z7WA 3FDZB 1TW2A 2APJA 7GPBA 2XT6A 4H1VA 1NQTA 2B0JA 1S2DA 3E9ZA 2H31A 3FSGD 4QPPA 1NVTA 1T1JA 4P8RA 1DEAA 1IUOA 2PBZA 3BEOA 4TSFA 1E77A 4FR2A 2ONZA 2IYTA 3VH1A 2XADA 4MDHA 4YS6A 3LOPA 1JDTA 3I4LA 3OEHA 1WHTB 3PC8C 1XDBA 1ZBDA 4Y8VA 2CVFA 3TR5A 1U9JA 3LDUA 4IIDA 4LVOA 2C2BA 4DV2B 4NICA 3ZVRA 2ONKA 3EXG1 2XVXA 3ER6A 2HQOA 4TYMA 1Q1NA 4DLSA 1UDBA 3JWIA 5LOVF 1G5RA 4P80A 1UIRA 1XTQA 1P17A 2WF9A 3EN0A 4B3DA 4EO7A 1JHOA 1Z62A 4AUEA 1ESZA 4FYHA 4K46A 3NETA 1TF7A 3AT1A 3KZXA 1E79A 5IX8A 1AKRA 4DUGD 2I7DA 3BC1A 4M8IA 2PU7A 1E3WA 4JIGA 2VDLB 3N5CA 4MW0A 3SQMA 5KKCA 5F76A 2D1TA 4ZT6A 4K0KB 1FU7A 5HJ5A 4MQFB 3UJ6A 4TUYF 1C1XA 2VXYA 3H2BA 3MGAA 4MPPA 4QJ5A 3R24A 2DFTA 2M32A 2C2XA 3OC0A 4PR3A 2RGBA 4II3A 4LJ4A 4BLUA 3ZE8A 1OXSC 1VG8A 3HCDA 1KEVA 1CQWA 5HVNA 1M1XB 4Y6PA 2OLJA 5J4YA 3RSSA 3NTRA 2DH5A 4LCJA 3GUVA 4S04A 1WBBA 4OFWA 3K0AA 2HHLA 1GNQA 4LMAA 4KRXA 4MVWA 4XIGS 3WMWA 1ZK3A 3PX2A 1K08A 1OSNA 2Y0CA 3DOFA 2QT1A 5CX4A 3T5GA 5MN6A 4XGQA 4B2PA 4QLOA 2YXPX 2DTXA 1RAGA 4IYRA 2PSEA 4D0RA 2F62A 2PKYX 3B3QA 3GP3A 4XQ0A 4UTNA 1E3TA 4C3UA 1B14A 4EL5A 4U5XA 4PYKA 1AZWA 3IP7A 5CDFA 4BJ5A 4BVEA 1VKNA 2ZREA 1VDMA 3I01M 3LWNA 3R3SA 4HNSA 5AW8A 3ZUPA 2PD3A 4F38A 4ENWA 2QLBA 1LVGA 1SK8A 3C1OA 2ZDQA 4QXAA 3T1TA 1DXQA 1STOA 2C9MA 1GZ5A 2IOHA 4BZZA 1N0IA 1USUA 1ULSA 2O2YA 5KQGA 1U7HA 1GADO 5JC1A 2W6QA 3RWMB 2PLNA 3WICA 4ER3A 2HPHA 4UUPA 3FW1A 1IHYA 1U6IA 2EWWA 2WJ3A 3DMHA 1M66A 3AUKA 2W9XA 2N9UA 1Y8CA 5IC6A 3JQ8A 4FOOA 1XB2A 4L50A 4PEVA 2M6RA 1CETA 3CEAA 4G5XA 4XM2A 3W3ZB 4JFAA 3ZHTA 4LXGA 1L6RA 1MGOA 3A1DA 3E6AA 2QSJA 5K4AA 4OGLA 1UPBA 1IRIA 2V5AA 4D2IA 4QGHA 5IM4A 2IIBA 1N0UA 5CJPA 4Z4CA 1TU0A 5AWFC 1HGXA 1R6VA 2WSYB 3AR7A 1L7OA 1OT3A 2EERA 3H8JA 3ROXA 3BXGA 4CM9A 4AG6A 5KWEA 2VZ0A 1WULS 5B30A 2OSBA 4NE9A 3ZR4B 3K30A 3L0CA 3TLCA 1YMUA 1CZRA 3THWA 2J0EA 4FMCF 3ROEA 3ZD7A 3ZGYA 1GU0A 2V58A 3WRXA 3UKOA 4MW7A 4S1PA 2X86A 4US2R 1R5NA 5EYPB 1ND5A 4EY5A 2B0CA 3BD6A 3R3JA 5I48A 4JV5B 1UDCA 3EXFA 1NW3A 4DMFA 5LA6B 1FU4A 1H0RA 4P3OA 1SAYA 4L9AA 5ALNA 3JYOA 4L75A 3ANSA 1A8SA 3R20A 3FVRA 3PK0A 4FQ8A 3AG5A 5DLPA 5KAPA 1J8DA 1GL7A 3H5RA 4GAEA 4LMBA 4ZOCA 1FSSA 2DHCA 1ISPA 1JBQA 3JWEA 3BE4A 3VU1A 2WNSA 1G5TA 4KU4A 3JQQA 3G5UA 2A9KA 2AC4A 1MORA 3GB9A 1J07A 1KMMA 4NU8X 2WT8A 4OXRA 2ZWPA 3BORA 4E1VA 3GNSA 1KRXA 1GAWA 1KFCB 1GG8A 1EFRD 4HFMA 4I7EA 1DAFA 4MGZR 4MHSA 5HCNA 1JV2B 1FNMA 2JD0A 4FGWA 4JJFA 2R6ZA 1IHOA 2JFGA 4ID3A 4KMRA 2I5PO 3QXGA 4O63O 4J1SA 1E3QA 3IELA 3CZPA 1DLIA 2WILA 1YJ5A 2OCBA 2DKNA 2MJLA 3R5HA 3ZS8A 4D8XA 1YNOA 3Q9SA 4QYMA 4TN1A 4BQFA 3WDLA 1KORA 3CWZA 2EZ8A 3C7AA 3KKOA 2IYRA 4QDUA 1QCDA 5JCOA 3B8EA 4MEJA 3Q7QA 2HX1A 2NZVG 3R3WA 2JLCA 3DBRA 1Z34A 4ZYTA 2AZXA 2R6CA 3KB1A 3LFHA 1H4TA 4KLCA 4LHYA 2Q50A 4R2WA 4C29A 3OQMA 5DLYA 1XLVA 4BVHA 1V39A 2BEKA 1PT7A 1C9YA 2QUBA 1E2GA 4ND5A 1T2EA 3PFHA 1FP1D 1Z0IA 4F3RA 1N8KA 1NJGA 1PS9A 4KL8S 1GTVA 4JQYA 3X1XA 1NVGA 1PZHA 1PTJC 2R4QA 3OCXA 5C8VA 2H1LA 1EWRA 5CIYA 3KQUA 1L4LA 5EY5B 3WL8A 3T3DA 3LHSA 3HNPA 3BGDA 5JQGA 1U04A 1J0EA 2HZBA 3U37A 1TMGE 4CL3A 3JWGA 4YWJA 3UB4A 4D9EA 3VYUB 4IMIB 1IHUA 3R3XA 4V0QA 2XMPA 3PP8A 1RWKA 2FEKA 4F85A 1RHQA 4ZQHA 4MKFA 1BSVA 1C0EA 4AJ1A 3RDPA 4DV6B 1UT6A 3FM9A 4QDOA 1ELOA 2ZAIA 2HC9A 1ZWLA 2XRMA 2WM8A 2D5IA 3RFFA 1R7RA 4XYGA 3SKXA 1T9DA 5JNVA 1S9HA 3U1BA 3LTNC 3VVBA 2I76A 5FIUA 3DPIA 1BKDR 2P6PA 1GNPA 2RHJA 5LMZA 3H1BA 4MR8A 4ZQFA 5HOQA 1PW7A 1EVYA 3HVIA 1GQRA 4N5MA 1IXRC 1JAZA 2J09A 2XWJI 1V5FA 4GOKA 1NQOA 1YZ3A 4HX9A 4N5DA 2CMHA 1XP8A 3VSEA 4DCJA 3U7IA 4HYQA 3A1FA 4L8GA 2GDZA 4CI0B 5BVGA 1F2DA 5DBGA 3ER9A 1NI3A 5CBKA 3JQDA 4KMOA 4H1TA 3FDJA 1V2HE 1AN9A 3DV0A 1X2EA 1Z7YA 1A04A 3DV9A 3TIXB 3NAQA 1E1MA 2JF0A 4EUNA 4ZYYA 2JLUA 5F7XA 2E5FA 4OHYA 3I01A 5AI4A 1DMSA 3FRHA 2G70A 1JDZA 3I39X 1AA6A 1TQ8A 5I01A 1OV4A 2K6GA 2YWDA 4UAVA 3DZGA 3GD5A 1ZG3A 3W6OA 1PGPA 4XFJA 4M8NE 1U5BA 2VPWA 4IOLA 2F4NA 4RAQA 4ZU6X 1I7LA 2ZRJA 3JWPA 4OX9Y 2RI6A 5HMLA 5C46F 2J5KA 3BK1A 3MA0A 5ICMA 1JG4A 2BFOA 5IC4A 4LECA 1I8TA 2YJ6A 2IXGA 4KWEA 4L0DA 4D8VA 2ZTLA 1MB0A 4V1CB 4FFSA 5JO0A 4HQFA 1NFRA 4PVCA 2GAJA 2XOXA 3FWYA 1EK5A 1SQSA 1ZHHA 2NZJA 2JGDA 3DYBA 3I83A 3L18A 4JC8A 4LHSA 4OXXA 3L1VA 4ZJUA 5C8XA 2A1TR 3AH8A 4UM7A 4CMEC 1OY1A 2D62A 2ZYGA 4URXR 3ICOA 5JVDA 1AKUA 2C5BA 2ROQA 2IUUA 1GPUA 4K6FA 1C4KA 4FDTA 2X14A 3W8FA 4CGZA 3UMVA 3TN7A 2ZBUA 4QU0A 3A4LA 2PIAA 1JEDA 4L16A 4BCDA 2WHEA 4GMXA 5D7BA 2PUBA 4JI7B 1B8VA 1JAIA 1WHSB 2P3OA 2PAAA 3HABA 3PQEA 1JT9A 2KMLA 2PY6A 5DYGA 1FX0B 4HYYA 3D0RA 3HACA 1BWQA 3HGQA 4MSUA 4U3JB 2JZCA 3PD0A 3H2HA 1JJVA 3BWMA 1Y6JA 1KU6A 3DJYA 1U0HC 3QUSA 1HRDA 3W6PA 1RHMA 2CXXA 3R6WA 4LDPA 4PS1A 3AEQB 5EQFA 1YIAA 5HW0A 3CPEA 5CXUA 2PS9A 2HEIA 4ND6A 2H9AA 1UP7A 3HRIA 4FSXA 3S4YA 4UOEA 4UTVA 5KSYA 4HB4A 1E7SA 2N0SA 1WZNA 3M1LA 4LJRA 4QBFA 2IHYA 3DL2A 3F6YA 4YUWA 1R3DA 1HT3A 4ISBA 4F12A 3ZVNA 2HD4A 1E6CA 5KC8A 5JS6A 1AUXA 1S01A 5FBHA 1BEEA 3ZDRA 4FW8A 3AIIA 4QNNA 4B3XA 3A1CA 3MIZA 3RWOA 2W8ZA 2EFCB 3FDIA 3ILVA 2GTHA 2VJLA 4ZYLA 4O4JA 2GCEA 5DNCA 3BD8A 2R86A 4L5IA 3ROMA 2CUKA 4YV0A 4IQ8A 1VSVA 2MSKA 1YFJA 4MV8A 4Q93A 4O1IA 3HB1A 5ETJA 3OIYA 1M2EA 3DMRA 3H9EO 1LX7A 4YP0A 4OMCA 2AJBA 3BCSA 3FWNA 1AO3A 4GVLA 4OG2A 5FI3A 4LXTA 1N3LA 1N3BA 3HC7A 3DOOA 4H3VA 4IJKA 2DSTA 3U3ZA 1I0ZA 4YP7A 2W2OA 3X1ZA 1PUXA 4RCZA 4PTYA 2IJGX 2C9YA 4GNKA 1I3CA 3R75A 3STYA 2RHHA 1T8UA 3KHTA 3M4ZA 3WL5A 3B9RA 4BZQA 3P96A 2DX7A 5T4FA 2R84A 1LK0A 5I8PA 4KV7A 3U19A 1M5UA 3CX8A 3NUQA 5LZ5A 1NXQA 2IEGA 1LLDA 2N3ZA 2QOEA 5DCWA 3FOBA 2VJDA 3DCIA 3KRTA 4MJLA 1XEFA 1I36A 4F21A 1BVYF 3PS9A 4JQCA 1J56A 4DM7A 1T5SA 1B41A 5ARCA 2XWPA 3TM4A 1YJ8A 1RJ9A 2BJWA 2QI9F 3OE4A 2BDUA 5E1BA 5GV8A 2KS6A 3I8OA 2NUTA 2AR9A 3EOAI 1AGRA 1Z6AA 3AXTA 3FNEA 3EUAA 2O7RA 2GZ2A 3CF4A 1W5FA 1JBEA 4E94A 4F04A 4WK2B 4DNXA 5AW9A 2I62A 3OE7D 1R0BA 1SVWA 2OQIA 4INAA 4OBWA 3FUUA 1TTHA 2BAGA 3GIDA 3GJXC 1DPFA 3U4HA 5KSOA 4MCIA 3Q8LA 1YDGA 4WOKA 4JZKA 3A70A 3PR3A 5B7QA 1VMEA 4YR9A 2C29D 1RYFA 2G9NA 1N2CA 1UMKA 1ZDMA 1F2TA 1BXZA 2Y27A 3P0EA 1T1EA 1ML4A 3Q85A 2WIDA 4DA0A 3OT1B 1SOUA 1SFRA 2FCAA 2YXBA 4N3BA 4QT4A 4WUVA 1QH9A 3B82A 2C1EA 4FKMA 3IV7A 4JODA 3TPCA 3V55A 3V4LA 1R6BX 4L51A 1QHIA 3IE2A 4RM3A 5D3ZA 2GXSA 3A9WA 3K9FC 4DWJA 3ML1A 4Y2QA 3RRMA 1E1LA 4M1MA 4WKBA 3EZFA 4HD8A 4BQNA 3U56A 1E2IA 5I7FA 3WYGA 4CKCA 1H2BA 2QS9A 2A1TS 5ENDA 1Z0AA 1TZCA 3N1UA 2F1RA 3VC7A 4TLDA 3EAQA 5HQ3B 4MRMA 2NYVA 4X61A 3C3PA 4BJ1A 2QAGA 1GITA 4JFRA 1XZNA 1PJZA 1T10A 2ZETA 5HG0A 4BMCA 4RK7A 2WMDA 1E6MA 4UBLA 3ZKAA 4CQMB 4NU5A 3WDSA 3D8UA 4JLSA 4A0RA 1R4NA 4JVNA 3T5AA 4O8ZA 4LJLA 4L9WA 2JGDB 3JVEA 1JG7A 4QJIA 4BE7B 4R16A 1ISHA 1OVMA 1QLWA 3OZSA 3BG5A 4ZT4A 1VHQA 1P1RA 2H54A 2XR1A 4IIYA 4CGYA 3D2CA 4GOND 4PRYA 4RENA 4MV7A 3SZ3A 5JH7A 1XU7A 4ZC1A 1XAGA 4QDTA 4ZVTA 1EGAA 4NXMB 5C3UA 3SFTA 4X6YA 4HQKA 2W4IA 1NUQA 3OPNA 1P5HA 1Y8ZA 7MDHA 3CZMA 1LC0A 2X9LA 3R2JA 2D59A 2GKOA 2OHIA 3VNSA 2XYGA 1O97D 3R09A 3R9KA 1R8YA 5FD8A 4RTSA 3NHAA 5GV7A 4ZEMA 4J0CA 2PL1A 4DG5A 5IT4A 2E5WA 3NR2A 1XK6A