2I8EA

Structure of sso1404, a predicted dna repair-associated protein from sulfolobus solfataricus p2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
88
structure length
88
Chain Sequence
AMLYLIFYDITDDNLRNRVAEFLKKKGLDRIQYSVFMGDLNSSRLKDVEAGLKIIGNRKKLQEDERFFILIVPITENQFRERIVIGYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel family of sequence-specific endoribonucleases associated with the clustered regularly interspaced short palindromic repeats.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
total genus 24
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i8eA01
2I0XA 2BM0A 4MAKA 3ZZTA 1P9QC 1U2RA 1VI7A 2NPFA 2WBMA 4FN5A 5G4DA 1DARA 3B8HA 2EFGA 2E1RA 2BM1A 3ZZ0A 2KDOA 2BV3A 1KTVA 1ZM2A 2L9NA 4QR1A 2IVYA 2CVEA 3B78A 4ZCKA 4ES2A 3E3XA 4ZCLA 2XEXA 1T95A 1N0VC 1ELOA 4ZCMA 4ES1A 4QR2A 4MYUA 3ZZUA 3B82A 4QR0A 4M1KA 3EXCX 1N0UA 2I8EA 4ZCIA 4TNOA 4MYTA 3UI3A 1ZM9A 3LH2S 1ZM3A 2J7KA 4ES3A 3OQ2A 1ZPWX 1ZM4A 2ZITA 1FNMA
chains in the Genus database with same CATH superfamily
1KLMA 2ZHAA 2HNYB 3MM5A 5JVHQ 2B4VA 3DXSX 4MJKA 4HKQA 3S7RA 2JEIA 3M6WA 2OKQA 4ID8A 3W9HA 2RQKA 4FN5A 1NDCA 3CDAA 1UKUA 3DOLA 4ERDA 3KG4A 1RHUB 5LJ3Y 3FMBA 5LJ5Y 4U7UK 3QZ7A 4GO5X 4C3LA 4MT1A 4CLFA 4U95A 2HBYB 4J9PA 1T05B 4CO5A 3DLHA 4RW9A 2XLJA 4NOHA 4X84A 4FF4A 3MGJA 4OHZA 4X4OA 4KT0C 2CJYB 1RTJB 2H5JB 2LCWA 2OPSB 3R5BA 3CC2S 2P6SA 2WW4A 1XR7A 4ZVOB 4WE1B 3MURP 2JC0A 2HHPA 2VBXA 2Y1IA 2RF2A 3OSNA 4IH6A 4RPFA 5KG0A 1VQ5S 1LWEB 5D4OA 3KJFB 4PEOA 1AB8A 1LWFA 4DU8A 2Z30B 3HFZB 1QAJA 2JEFA 1MLAA 3OHBA 3BSAA 1B0PA 3IRXA 4PG4A 4C8NA 2ZDOA 4IFYA 4GC7A 3D6MB 4WWSA 4WTOB 4TU8A 4ED3A 1FRJA 3DRSB 4DL7A 2VKZG 4LQ3A 4HDHA 3GSDA 4EMDA 1S0OA 2HKEA 2P9GA 4P72A 3RAMA 1K0VA 1ZTTA 4V19X 2U2FA 2XYHB 1NHVA 4ZCMA 5IQ6A 3AODA 1J27A 2BOAA 5I3UA 3BZQA 2R7VA 3ZTSA 3BJYA 2OJ3A 1SBRA 1Y10A 4ZVTB 5EN1A 2PFFB 4Q45A 3VZIA 2CQ2A 3THTA 2PC6A 4F7VA 4P2FA 2R2RA 2Y8YA 2NREA 3IAM9 2RIJA 1GEHA 1WD6A 3ZTPA 1LK5A 1X0PA 1OPZA 2NYHA 3I0SA 5IT4A 4AUKA 4JV2A 5I4MA 1VRUA 4OJ3A 1TUGB 3RW6A 2W2PP 4J7CA 4FNIA 5E3CA 5HJXA 3KK2A 1I1GA 2NLWA 5HATA 2UUBF 3QRRA 1IM4A 2ZC3A 3GFXA 4PRFA 2DNQA 3T1YJ 5E33A 3PM9A 4TY8B 4O3NA 4H4MB 1JXVA 1T95A 3EGZA 3KNGA 3QT5A 3A3OB 1N8RT 2J7UA 2NXCA 1HBOA 1KRPA 4QIWD 2A2CA 5GAEU 5F9LA 1H98A 2O3DA 4AL6A 3HHNB 1NDKA 1G6BA 1S1TA 2AJFE 2CQDA 1VRTA 3CJ4A 5I42B 4C11A 4DV6J 2E1CA 2HNZA 2R8GA 1F60B 4GMKA 3I31A 3MM6B 1SUQA 3H90A 1OPIA 1BE4A 1QDUB 3BEGB 3DRPB 3I87A 5J2NB 4DFPA 2BJDA 4ELVA 3CT9A 2J0SD 2I1RA 3PG9A 2ZH5A 3HX9A 3HT0A 5JXSA 1HPZB 1FK9A 1T9YA 1WORA 2GAHC 5IS2A 2L41A 2BV3A 5FD1A 2VZ9A 2PEHA 2JLEA 4JI5F 4W92B 1TV6A 2AEFA 3M32B 2YNIA 2IDLA 3I0RA 4DV3F 3W5YA 4DU7A 4OI0A 5DG7A 1CVJA 3RBEA 1VJQA 1HL6A 1UEVA 3EICA 3NGSA 1U6FA 4DX5A 3G8QA 1M5KC 1TL4A 4RL1A 1RAFB 1BQMA 1UJ5A 1S99A 2BKPA 2EFNA 2NS1B 3PCOB 5B0AA 1JLAA 2AX0A 3M6XA 4U9RA 3CW2C 3W60A 1ZM9A 3G6VA 3M30B 2BBEA 2C3PA 4HH0A 4PR6A 4B3TJ 2DXDA 1RAGB 4UUXA 5FLXU 2Q66A 1UPPA 1DLOB 4KR0B 3DC2A 4FZVA 3U1NA 2DGSA 1B0TA 2IMOA 1NK6A 3PZPA 2VDIA 2M8HA 2ZNZA 3MMBB 3T5JA 2PO4A 1BXNA 1RT1A 1YJRA 2LYVA 1R8HA 3AFGA 3KDNA 1LOUA 3W7BA 3CCQS 3FEZA 2Y1JA 1CC7A 1WTFA 4USMA 4DR6F 3HK2A 2N3LA 1DAXA 2LDYA 3MPVA 4A48A 1DTQA 4MK8A 1UZDA 1NHKL 1Q8KA 4G1IA 3ZFVA 3KLHA 2XEXA 2QJ3A 3M9MB 2W9BA 1DFDA 2G2ZA 5DQIA 1IM6A 2V2QA 2QLWA 3K58A 3L9ZA 2XS5A 1Y9OA 4ATNA 1FI4A 3ISNC 4IH7A 3DRXA 3TWZA 1A0OB 1VDHA 2M2BA 4DR6J 2UP1A 1Z4UA 2IM3A 4Y3CA 1FJGF 2E5GA 2YWEA 2VC0A 2ZJPQ 3IR7B 3GJRB 3IO1A 1LXNA 3VGUA 2K1RA 1O0PA 4X4PA 3OVSA 2AU0A 3K2YA 3H40A 4QBUA 2CQ1A 4IO1A 2RDJA 4DF4A 1KSPA 3N0VA 1FD8A 2B0GA 1XMBA 1EKRA 1TZ0A 2XNQA 3LP2B 3OV7A 1HR0J 4IRKA 1XNQF 3J7AN 2L9NA 3PYFA 1VQPS 3WBZA 4C11B 1X8DA 1LW0B 4Q0BB 4CCHA 2W01A 2OTJS 3UFCX 4F3OA 3TUPA 3JSMA 2KRRA 3JAMU 3UWTA 2PMZD 4J9NA 2QYCA 1HQUB 3G82A 1S57A 1RHMB 2RMLA 3TA2A 5KT3A 1VOMA 5FDLB 2ZM6F 5H9FK 4WIQA 1Q95G 4KSEB 2JRSA 3IAS9 3M32A 3M8PB 1KC8T 4P73A 4G1QA 5KFJA 2V2VA 2ZD1B 4JI0F 1JLGA 3MTKA 4PYDA 2YBVA 4PQUA 4GKKF 1U2RA 4DJBA 3J7Z5 1VQ4S 2ZUGA 3CD5A 2KJVA 1CJKB 4DV4F 2DNNA 4KGKA 5BJRA 2J9DA 2FIUA 4GVBB 3VAIA 4ZHRA 2KL8A 3Q8YA 4LSZB 1S10A 2OLWA 1RKJA 2UVWA 2CJBA 2HRUA 1N54B 4NZ6A 3M6VA 4K4YA 4LF4J 5KFVA 1VRTB 3H2LA 2ZM6J 3AHPA 4X64F 1AA1B 1NPKA 3KG0A 4QWCA 5A8RB 2M88A 3K5LA 1WKLA 2J0XA 3H4BA 2H5IB 2VBWA 1XQIA 2I38A 3L7PA 4KY3A 3SSQA 1FKAF 5IWAF 4N47A 3Q0AA 5D77A 4U6PA 1VQ6S 1PO6A 4WTYA 3MHYA 2EEYA 2ZJQQ 2J7WA 1FWKA 1P9YA 2XC9A 2W4PA 2MSTA 1JLFB 1Q7YT 1D3WA 1QUPA 3GR0A 3MCNA 4Z7YA 2XULA 3P96A 1M1GA 4RW4B 2C2OB 1VQMS 4I67A 4A8MP 4OYWA 4LSNB 4WFBQ 1RAJA 3C19A 5F0WA 5FIIA 4KTQA 2MQPA 4Q43A 5KT2A 3PO4A 1F5AA 1X4GA 3SCJE 4JI2J 3B4DA 4UY85 2NUUG 1SQGA 2IPOB 4CI0B 5AE3A 5M2UA 1VC0A 4FF2A 2XGQA 3SYZA 5J2PA 3E3XA 4M5HA 4ECQA 3DMJA 4LVNP 3S8SA 4LFBJ 3G86A 1NUEA 1IJFB 1N0UA 1PYSB 4PG8A 4P10A 1RWPB 4RWXA 3AQOA 1NNDA 1FRHA 1TVRB 3N01A 1NBEB 2JWNA 1KVIA 2G0IA 2XZDB 3IGNA 4KO0B 1EARA 1Q16B 4P7VA 5ETPA 3T19A 4DXLA 1PYTA 1FNMA 4EU0A 2X3GA 3VALA 5J2QB 4K5SA 1VQYA 3CJRA 4QW8A 1TELA 1FRIA 3V6KA 4R5PA 3ZXWA 2HZCA 3C46A 2H9ZA 4FYYB 1R27B 1S48A 3EWGA 1FDNA 3HVTB 2Y0BB 1X9SA 2DO0A 3F41A 5IOLA 4YR3A 4EEYA 1D9AA 5LMUF 4J5OA 2HFVA 1P1TA 2PMWA 3O6QA 1WEZA 1QD1A 1TKZB 3U7JA 4RW7A 1KBRA 5L9NA 4A8YA 1J5EJ 1NH8A 1EP4A 2GIRA 4OZNA 2E1PA 2VQEJ 1HNVA 3B82A 3M8YA 3MCSA 3MD1A 2AIRB 4I7FB 3AH6A 2CJXB 3TVKA 3N79A 3MECA 1JLBA 3CJKB 1F2HA 3ULHA 1DQ9A 2CPZA 4JYAF 1F5BA 4OI4A 4A8XA 4N7TA 1N4LA 5KFCA 3Q23A 1UFLA 2WRMA 2OEJA 4DV1F 2N82B 2LEBA 2QO3A 1XMQF 1OS5A 1M0SA 1RHKB 3ILOA 4HHJA 4Q0BA 2JC1A 2DNPA 3UVJB 5I42A 4DQIA 1OY8A 1ZA1B 5L1LA 5C24A 1T03A 2MHEA 3NCRA 3JTPA 3Q8PB 2Y3YA 4JI1F 4LF9J 2AJQA 5KFZA 5GVQA 1DY3A 3IG1B 2V5HG 4HHUA 4O3SA 5HP1B 1T7PA 4F0HA 1VC5A 1N32J 4DR5F 2GNKA 3UNYA 1JB0C 2B9YA 3GCWP 1H2TZ 3TNVA 3BDEA 4ZPVR 2BJ8A 2RD5C 1IR2A 3I0RB 3QRPA 1WG1A 4K2XA 2HHUA 3OUYA 2QTWA 1MW7A 4KE5A 4U7CA 2W9CA 2HZVA 3QJPA 2JH3A 1P27B 3K5PA 4G6VB 2YNHA 3M1VA 1C0UB 3FSXA 4BS2A 4LF2A 3EX7B 5A6WA 4K0KF 2VJVA 1XERA 3IBFB 3LP0A 3CO9A 4O3QA 4O3RA 2XMTA 3UDEA 1U24A 1GMWA 3MPYA 2KO1A 2PA8D 5B08A 2M7SA 2HPUA 4ECUA 1CJVA 1QY7A 3QNWB 4O23A 4C2MA 1RWVB 2MQLA 3LPEA 1SVDA 2D74B 1UAWA 1RT2B 2YWKA 3BPSP 1IN0A 3I82A 3LWMA 1TKTB 3H5XA 1N0VC 4W90B 4AFFA 4CWBA 4KHPF 1RBLA 1YJ7A 4WP9A 1X31C 3VVUA 2UXBF 3DI6A 2DXEA 2QEXS 1DJ0A 1RAAB 5ETMA 1REVB 2WVDA 5DO2A 2DR8A 5B0BA 2LA6A 4IR1A 2HQGA 4V19J 3LTOA 4OZJA 1XR5A 2YKPA 8RUCA 1T11A 2ILZA 2FY8A 3M4XA 4FPIA 3C14B 1RHQB 3OL7A 2VDHA 2VB6A 2MY8A 3U02A 4EBDA 3RB0A 1UVLA 4HACA 1VRQC 1ULRA 3KK1A 3VGTA 4ZJLA 2LECA 3PW2A 3OPKA 1FE0A 1ZZFA 2FYXA 3QATA 1GXLA 2GGPB 4ZVUB 2HHSA 3IFEA 1NMEB 1CBKA 2GJ2A 3HZEA 1QAXA 2YNFB 3TVYA 4CLWA 1S12A 4ZDNA 5KFAA 1KQGB 4ZLNA 3V81B 4M5NA 4ED5A 3K5NA 2CQHA 2F4FA 4DPUA 5KG5A 3J81j 2YKNA 2R8KA 2VPWB 4X4NA 4P52A 3BSNA 1NZAA 4DL5A 3THVA 3G2XA 2CAJA 2ZBCA 1PILA 3BREA 5A8KB 3UN3A 3C6TB 1S6PB 3R7SB 3OTOJ 5ITHA 1Y0HA 3G71S 3K5MA 2LQ8A 1VGYA 2VODA 1HKAA 2R7UA 1TUWA 1Y5LB 3FQLA 2F8HA 2KI2A 3ONQA 2BM0A 4LIRA 4R0JA 3HMJG 1A6LA 4F4KA 3A3PB 1X5PA 1Z1ZA 2GJIA 2R4FA 1MG7A 4UQTA 2BANB 1HI0P 2BJEA 1IKYA 2W4DA 3TW0A 2PN6A 2HNYA 4I1TA 3WHIA 5KFOA 1KR4A 3PR4A 3OTOF 2X7IA 3T3FA 2DRBA 4CO2A 3P8BB 3R2CJ 3UD4P 1S59A 4YB6A 4L3NA 2UXCJ 4TQSA 2O1PA 1X4DA 3NS5A 5BXIA 3W8PA 3BF4A 3DN9A 3KXDA 3HFVA 2VG7B 4ZLLA 3KFWX 4KV8B 2R7RA 4Y2CA 3CCRS 4DR2F 3X1LB 5F8IA 1V5IB 2GQCA 2GMJA 3UD5A 2GX8A 3GFZA 4F2RA 4ED1A 1T9WA 1EQ0A 1EZZB 2AGPA 4LF4F 3ISZA 3UDCA 3BGRB 1LW2B 3C66A 4N8NA 1KOHA 4C7QA 3ETMA 4NA1A 1LWCB 2P8IA 4FVCA 2DHGA 1RWMB 3EZOA 5LL6d 2DGVA 2HURA 3TJAA 5BR8J 3UCUP 1SL2A 3TAMA 3DKDA 1YIJS 4ZKAA 1M1HA 2R2TA 1BLUA 5CCLA 2R7WA 3C16A 2KHCA 3SZ2A 4UTGA 1M90T 5AT1B 1D9FA 3W5XA 1FDDA 2CNLB 4C97A 2V4RA 2ZH6A 2ZC4A 1X5SA 3EJMA 4M5GA 1YTYA 3VCDA 3I56S 1CQMA 3ILLA 1WDTA 3FNNA 4DV0F 2VG5A 3OR1B 4PG6A 3RBDA 1NO8A 2MQNA 4J37A 1HHQA 4ED6A 1XK8A 4Z7CA 4FNHA 4OZ5A 2GGPA 4OYOA 3FBEA 3MAQA 3NCPA 1TK8A 1Y7PA 5HBMA 4WKYA 1CJUA 2XS2A 3H25A 2FHKA 2FJDB 4PXEA 3HVAA 2W7PA 4FXDA 3NCQA 4OYBA 3N5BA 1RT4A 3ICLA 2YKOA 2ZVIA 1IR0A 3DOMA 4LRFA 1GT8A 5G4DA 3T6BA 5AJ3J 1TK5A 2VKRA 4QYZJ 2CQCA 4KKOA 1UA0A 3MR3A 1HYSA 2AEJA 2ASYA 2M8DB 3Q22A 5E41A 2ROPA 3HVWA 2V94A 3HO1A 3MAAA 5E0OA 3M2UB 1MNEA 2QLXA 2B9WA 3MR5A 2FVCA 2IHR1 1YJ9S 2Y9HA 1RCXB 4RUCA 2MY7A 5D0HA 3Q83A 1X60A 2LQ5A 3GWCA 2POKA 4ZP7A 2LXFA 4OYZA 2YWGA 5KG1A 1JLEB 3AJ2A 3HDSA 2AJ1A 5F41A 2RH3A 1W2BR 4JI6J 4K4SA 2HWHA 4JI7F 2BE2B 2GJFA 3FSYA 1MMLA 4KV8A 1NU4A 4C48A 2ZNYA 5CYMB 3FBFA 1RWXB 2C3UA 3IM8A 3IR6B 1HMVA 3EYZA 4YB7A 2F4VJ 1DQ8A 3MM9A 1C1CA 1P6TA 3NGRA 4URQU 3T9NA 5C5JA 3DM2B 3MCOA 4PUOA 4JYAJ 4O44A 3CJ8A 3PJ9A 4ZPTR 3PX4A 3P49B 2HW3A 1AYEA 4EO6A 2KYXA 2NPIA 3S1TA 2LQJA 2YQ3A 3T1AA 4RNNA 3EDRB 2WHOA 1LWCA 1U7LA 4D3HA 3GMGA 1SV5B 2VQEF 3C15A 1ZH5A 1VK8A 1JLQB 1Q5YA 3BN4A 3M2VB 1SJ1A 4DPOA 5L1KA 5IT9U 3BGLA 2UUAJ 4GKJJ 1RKIA 1DHMA 4OIXA 3KHGA 2F4VF 2QLBB 5EX3A 2ZITA 2D1CA 3D0GE 4FYVB 3GU0A 5CXTA 1S7HA 4DR4J 3H8YA 2J6SA 4JOUA 5LMNJ 3DDIA 3MWBA 3RZAA 2IDEA 3DRRB 1NJZA 2HFUA 2YX4A 4K5RA 4DSKA 2D9PA 2DBBA 4RNOA 4ELTA 2V34A 3KUGA 2YKMB 2DNOA 3AOAA 3DU6A 1X4BA 4YR2A 4IRDA 4CLYA 4LMZA 4EBEA 2G2OA 3MUVP 2B4PA 1WF1A 4B17A 1HWLA 1OYEA 2ZBPA 4IDKA 4EUVA 3DGPA 1LEOA 3MXHP 3BGOP 3UDLA 2A1BA 2ATCB 4O4GA 2V2KA 3DLLQ 4ZIWA 2O67A 1REVA 2MLYA 3PX0A 3OXGA 1HWKA 5LSOA 1VCTA 3CCTA 2D3O1 1TKDA 3VAGA 2PMHA 1AZSA 2DHAA 4LF8F 2RQ4A 1XMOF 1D1UA 3PO5A 1HIYA 3KJQB 1F9EB 1JKHA 4CIOA 4IYQA 3D68A 2XY6A 1R8PA 5D0GA 2AV5A 4FP9A 3VWSA 1ELOA 2OPPB 3GLJA 1N5YB 2QFJA 2BE2A 1GX5A 5F8JA 5LOQA 1Y4ZB 2DHXA 2XGPA 3BV8A 5ETRA 2VL1A 3IBWA 4USUA 5IC4B 3T1HJ 3QWUA 4CYUA 1S4FA 3E01B 5F3TA 4ES3A 2DCUB 3DDKA 3I9ZA 3J80Y 1WHXA 4LBHA 2ZH9A 2XWXA 1SJQA 2DGOA 1URRA 1VMBA 1ZBTA 4O0IA 1S0NA 2OH2A 1HQUA 1HW8A 4QOTA 5L9XA 2HQDA 3EZ5A 2UUCJ 3JSMB 4DR3J 5HLFB 3MMJA 4KGXB 2H1YA 3DRYA 3UN2A 4E2FB 3MMAA 4EYIB 2AD9A 4B3RF 2OP5A 2E5IA 4OX9J 3D0IE 1AFJA 2A6MA 1RYSA 2RHSB 1HQEA 2ZH4A 1E6VB 2AT1B 1IBMF 2B9EA 2GVDA 2V8PA 3H5SA 1SXLA 5DZ7A 3GONA 2IFXA 4C0OC 1I3OB 1YLXA 3TRGA 5HMXA 4C8YA 3QGIA 1HARA 2AZ3A 4PABA 1GK8A 2ZZNA 3KYLA 4LF7J 3D3CJ 3AJDA 2Q6BA 1WSRA 2J7KA 4RO0A 3OXLA 4G1PA 4ZS6A 3MEGA 2IYIA 3L7OA 3PKYA 2R8HA 1Q81T 4WKRA 1FXRA 1H3DA 1RWWB 2W4CA 2C22A 3SV4A 1WUUA 1Q1KA 1XBWA 5DLGA 3NMRA 3GP9A 2W2MP 1NKCA 3MM7A 1APSA 2RF2B 3CVKA 3QFHA 4YEAA 4J9VA 4X62J 2U1AA 3VAJA 2UU9F 3RRGA 2EVZA 3P4UB 2XI2A 3PHEA 4OV6A 1RJJA 4OZ1A 4RW4A 4DQSA 5B09A 2KJWA 3POTA 3P6YC 3VVTA 1KLNA 1RTIA 2FLNA 3THPA 1KVKA 1R7IA 2ILYA 1AFIA 2DT9A 2FUG9 3R7NB 4KPYA 2XB2D 2BX6A 5M2RA 4ZN3A 2FC8A 5C2GA 1HFEL 1N5VA 4HL9A 2NR0A 4LR7A 3V6DB 2HBQB 3TO8A 1RZMA 3IWXA 4DUTA 4F0KA 3BQ0A 3R5DA 2JDJA 4JI0J 5GAHU 1WNEA 2CJQA 2MKJA 4M5JA 5T7LA 1FJGJ 2FVRA 3DNCA 4QR1A 2V4JB 5H9FJ 2HS4A 4IOBA 4ES2A 2G9OA 1IKXA 4A8SA 2GFFA 4IFVA 3FQKA 4ZLPA 3FC9A 4ZVFA 4OZLA 2D41A 4R0EA 1IKVA 1GQEA 4L72B 2M5YA 1YITS 4NXNJ 4K4UA 1TL7A 1WF2A 3NKYA 4RKUC 4XPCA 1HBNB 2AJ4A 4ZCIA 3TI0A 4CTAB 2R8IA 1UETA 4J9KA 1PJ5A 4DV7F 1VHFA 1Q8LA 2G2YA 3J81U 5EUHA 3J7YU 1EHWA 2WK4A 4ZVGA 1JLBB 3CJKA 4R8UA 4AXJA 3IM9A 1M5OC 4C8ZA 1YHQS 5KFTA 5IC6B 1CJTA 3ZZZA 4YR0A 5EHHA 4C8OA 2HHVA 3PKMA 1FJCA 2CUYA 1F3VA 1WJ9A 1VQSA 5DGAA 1DARA 3CIMA 4LUBA 4GVLA 2KRBA 1U2CA 2ZUAA 3NWGA 4CH0S 4CYUB 3HHLA 3Q24A 2WW8A 3FFIA 3IWNC 3M8QB 3S6EA 4XK8C 2LP4A 4NEYA 3UN5A 3AD8C 2BRLA 3SDEB 3N6MA 1HNXJ 2OD6A 3TA0A 4ZVQB 3KLFA 2G4BA 5IV3A 4HHHA 2E7VA 2HVEA 3UVJA 2OSRA 2W24A 4P2SA 4F50A 1S6UA 3GQCA 1P8GA 2RNEA 4NXMF 5F8GA 4DS4A 1FEHA 1SC3B 3OT9A 5KFQA 3VF0B 2VQFF 2J6UA 2VONA 2CNKB 1L3VA 4B3OB 3QO9B 4K8RA 2IAJA 5A0YB 3HVRA 2AF6A 3NOGA 3TOQA 1HQEB 2LEPA 2DNMA 3TQEA 4YOEA 3L7UA 3KUEA 4YS2A 5KFPA 2R2SA 1WG4A 2B7BB 4JI7J 3VTIA 5E3PA 1BQNA 2OPRB 2XMVA 4Q2MA 3OLBA 1GAOA 2O66A 4NRUA 4NMLA 2VV5A 1R6VA 4NLRA 1G2EA 4I6YA 2B4UA 1VQKS 2W2NP 3R27A 4RNFA 2RRAA 3ZZYA 4USWA 5C25B 2CQBA 2BJ1A 4FYWB 4WU2A 3HT3A 4NZ0A 4CLUA 1BY9A 3NXZA 2HHQA 1IKWA 4IQXA 3DCAA 3PEHA 4QWDA 5KFLA 1N5QA 1QAIA 3ZZRA 3BO3A 2WSEC 3VAFA 2FJBB 2Y8WA 2P6TA 3D6HB 1B0VA 3EPIA 2P9EA 2YKMA 2X3DA 1YG0A 2RE1A 1N6QB 2MKCA 2HQ3A 1FWPA 2FZGB 3CMAS 3DLBA 2BVZA 3LP1A 5DDRC 3EXYA 2HLUA 2DGTA 4JI2F 2I5JA 2GIQA 1ZETA 1ZS6A 2DNZA 2HFSA 1NK0A 3ZZTA 2YX7A 3HP6A 1HNZJ 2XTJP 1XWLA 1S77D 1X9MA 2KHDA 3SFGA 3OXFA 3MPDA 3BS9A 1Q5VA 4NLWA 4HVZA 3TYTA 1HWUA 2HEKA 4J9SA 1B3TA 2NQPA 4LVOP 4LFCJ 1RP5A 4WZQA 2KDOA 3BR9A 5DJBA 1FRXA 3ET6B 1P1LA 3HJVA 1ZPVA 3QRQA 3EGVA 3ZC4A 4NEZA 1L3SA 2K06A 4Y2KA 4WF9Q 1CJTB 7FD1A 3NLCA 1CULB 1HI1A 1NSPA 2V50A 1N52B 4NE9C 3T9ZA 4ETZA 1DURA 3DOKB 2KFNA 3TEGA 4ZP6A 3MM6A 1JK9B 1UWAA 3O8WA 2VG6A 3BN7A 1ZAXA 3R8YA 1T3NA 2SXLA 3TANA 1N36F 3CUNA 3D1HA 3ENAA 2IVYA 4M5MA 5KFBA 5SZTA 3BBCA 3J80U 1JJHA 3WIUA 3MOJB 2BE7D 2DKOB 4IG0A 1IKVB 2CYYA 2M0GB 5T41A 3Q8RB 4B9LA 4NYZA 4BC7A 4NLGA 5RUBA 2KXHA 1C0TB 3KJNB 3VQTA 4A8WA 3K17A 3JQMA 5A8KA 4LJMA 2DGXA 2KT5A 2OO4A 2UUWA 2WSFC 3C6TA 3LAKA 2B8PA 1YVFA 2IAJB 3OFGA 4HLBA 4MKBA 3ZZPA 2V8HA 4QIFA 4YY3J 1JXLA 4X4QA 3GV8B 4OI2A 1FK9B 1RT3A 3C2PA 4ZJQA 1X4AA 1FKPB 3M9NB 1IQTA 1BUXA 4I64A 4ID5A 4ZMMA 3CC7S 4PKDB 5CYQB 1QSYA 5KFUA 5J1NA 5CD4A 1ACMB 2RHQB 5J2MA 2N4DA 3Q86A 6AT1B 3MUTP 4DUZJ 2VJUA 2BW7A 1QVFR 4DL0C 5E5NA 3HHLB 4I2PB 4DF8A 5HVGA 3G87A 3I55S 4FXVA 1URNA 3D28A 3L3CA 4OL8A 3J81Y 5AXKA 2HBRB 2I6WA 3RB4A 3KHRA 1NK5A 1DBDA 4QCLA 3RU0A 1RT1B 2GW8A 5K8NA 1T9VA 2XM3A 2VHGA 4ECVA 3TAQA 3CJSA 1DTTB 4TYAA 3ETOA 4EYHB 2RAQA 4LRDA 4F2SA 5I3QA 1DTQB 4NLPA 4OI3A 1WWHA 4ED4A 3KLHB 4JI3F 3W3SA 2YPYA 4EWTA 1N34F 4J9LA 1KTVA 4X66F 2ZOGA 3W2VB 2MMYA 1F6TA 3B54A 2HMIB 2LVWA 4NPOA 1F9HA 1PCAA 1LKZA 3JYTA 1LFWA 1S5ZA 1FEEA 3HPOA 1RB0A 4RW8A 3JXOA 5IWAJ 2DYAA 4WBFA 2IA6A 4I7FA 4L74A 1RTDA 1ITPA 1MN7A 1AROP 1JNRB 1U26A 1T9UA 3KWMA 2NXNA 4BBYA 4KGMA 4CNZA 5DDPC 3Q2TC 1VHIA 2YY3A 1ZM3A 2J9CA 1RHJB 1W7WA 2XSJB 3MD3A 4BWJA 4DSLA 4ED8A 1RT5B 1BQMB 2LDIA 2FY1A 2CPFA 4JI8J 2P9CA 3NBPA 1CULA 4I2QB 2O5DA 1FTRA 1U1RA 3AY0A 3LAMA 5CYMA 2FVSA 2DTJA 2L9DA 3HF5A 2XBPA 2Y1LB 2ZHOA 3D5MA 3I5CA 1RI7A 3IMQJ 1UJ6A 4AT1B 5HBMB 2HNDB 5GAHI 3ZZ0A 3QT6A 4AQYF 2C2EA 3FZBA 1MU2B 3MI7X 3LP1B 2QIFA 3AD7C 4NCGA 4DR1J 1F2GA 3BKFA 3MZIA 3MTJA 4HTIA 2RUSA 2MQQA 5A2QU 1PGZA 1EQMA 1T9TA 2QT7A 4H4OB 1SV5A 2V8VA 2HVIA 1Q0NA 3GE9A 3CCVS 2GC8A 4QYZK 2ASJA 3GJSB 2ZD1A 3MF5A 3GPAA 2G0JA 2MQOA 1R8AA 3D54A 1S9GA 3H7HB 1I94F 3RTVA 4M95A 2C3YA 3W2WA 4LSLB 2BUNA 2KB2A 1CJKA 1AW0A 2JSXA 1RU1A 4TQRA 1GXUA 1RT7B 1HWIA 2PEBA 1HNVB 3MAAB 4Q2LA 5CA5A 1S6QA 1IBKF 3SCLE 3AOBA 1OSCA 4WYWA 3VZHA 5DDOC 2D3UA 3LGNA 3MMCB 1RXOB 1Q7LB 4ZVRB 4A46A 4Q5VA 1V6HA 2VG6B 4Y00A 4FBTA 3MAHA 1RBOB 2DNHA 2MQ8A 2PFDA 4QPXA 2FJWA 3UCGA 1RTJA 2E1AA 4Y2IA 2Z4PA 4C8MA 2YVSA 2DXFA 3QWPA 4HH1A 4CLTA 3KLEA 2XO7A 3GILA 5H9EJ 1FJEB 1SJRA 2CJKA 4TVAB 1LWXA 3C3LA 1YJUA 2J8AA 4TNOA 4RBUA 5A8RA 5HMWA 2ZE2A 4O4RA 3KLFB 4J9UE 3H42A 4OLOA 4LF6F 1FT8A 3KLVA 2J8SA 4S0MA 4DSEA 4PWDA 4PPZA 4AL5A 4URGA 4DR7J 2K3KA 1OO0B 2BZ2A 3M2VA 1KQFB 4JI8F 2R7XA 4L6V3 2RT3A 2A2DA 3J7YI 1RTDB 2BOPA 4C8LA 1T9XA 2F63A 3NGDA 4EO8A 2YX1A 4DL4A 5LT5A 4JV0A 2I2YA 3JQKA 5DETA 3P45B 3CCSS 4A8QA 4J9RA 3VV2B 2XY5A 2Z0GA 5KG2A 1FXLA 3MCMA 4ZCKA 4P75A 3W66A 4K4XA 1U47A 3DRRA 1B7FA 5IM0B 2A0FB 3OFEA 4NXNF 2DNLA 3AA9A 2GIFA 4I6WA 3FMWA 4ZPCA 5ETSA 5KFIA 4EGLA 1T8EA 2HHXA 1NB7A 2FHJA 3EVMA 5ETKA 1B64A 4C6AA 4X62F 3SCIE 4DS5A 3FKBA 4OQJA 2LXUA 5LMUJ 1MSWD 3N28A 5GMEA 4DV5F 2UUBJ 5HN0A 4D3GA 1I51B 2UVRA 1LV5A 4UT4A 4TKTA 5K14A 2BA9A 4FDFA 3N9UC 4B02A 3F73A 2LQBA 3K8WA 3A13A 1WKKA 4RW6B 5ETTA 4WK3A 1JLFA 2V68A 1BGXT 2CPHA 3BYRA 4OHXA 2DITA 1O8BA 5EDWA 2E9TA 3D0HE 1SJFA 1X4EA 5ADZA 3UDVA 1D8ZA 1I5OB 1Q8IA 2XZWA 1CLFA 5CAAA 5DQGA 4X4VA 1FESA 2BQUA 3RB6A 2QMUB 2HWIA 3BSOA 5K8PA 4DSJA 2YTCA 3NBPB 4HT7A 2NCKL 1IUJA 1HBOB 1TL3A 4NLSA 4B9MA 2VF3A 1S97A 4IR9A 4YB1P 3MEDB 4TLRA 2HNZB 5A76A 2UU9J 1XNRJ 2EK1A 1H72C 2GAGC 4YY3F 1S1TB 3F56A 4WPAA 4NYOA 3JTOA 3C8YA 2YKQA 1EX8A 3DLEB 4CLPA 2JEGA 3W9JA 4DSIA 4G3IA 2D3ZA 1PG5B 3DRPA 2MKSA 4NLQA 1PAEX 2A3JA 1OY6A 4X4SA 4LF8J 5IT9Y 3W61A 3CD0A 5JVGQ 1UZHA 1VLYA 2CA9A 1Q53A 5DQHA 2F40A 2DR6A 2GVZB 2MGZA 1VQLS 1JLCA 2XWYA 3B8HA 3CJ0A 2CZ4A 2VFSA 3C16B 3EZUA 2ACMA 4USTA 4YDDB 2GQQA 4DUZF 2VOOA 2KFZA 3HD1A 1MROB 3MEEA 3QBCA 5KFSA 1XNRF 3PFEA 1R0AA 1JLAB 3AJ1A 5B0EA 5DG8A 2VA2A 3R3TA 4TLQA 3K0JA 5D4LA 6FD1A 4KJIA 2I9SA 4DFKA 2AP6A 4ZVSB 4JV1A 2IM0A 1UVMA 3GTYX 2VIHA 3HULA 4JI4F 1K9MT 1E6VA 1G4CA 2DO4A 3IS9A 3R97A 1JJCB 1SH0A 1YJVA 4F0MA 4GC6A 4C9DA 1MWQA 1RT6B 2K2PA 5J2MB 1KHWA 1P9QC 4QZVB 5DM7Q 2R8JA 4I68A 5HVFA 9RUBA 2CQ0A 4U67Q 2ZOMA 4I2PA 2K7KA 2B6AB 3AB4B 4DUYF 4N77A 5A8WA 2XCAA 3WX8A 1SIWB 1N33F 1U1PA 2O01C 2QZ8A 4USKA 3EPGA 3FGVA 5EWFA 1VQNS 2KZZA 4AL7A 2ZBQA 3PTWA 2N3OA 2AKWB 1KONA 2MKIA 3G6XA 3BQ1A 3PYGA 4EFAC 1H38A 3GCXP 2XMAA 2E9ZA 1O6XA 4C3KA 5KG3A 4UOGA 3Q8QB 1PC4A 4QPTA 4WP3A 4LFAJ 4DZ6A 1UPMB 3LF0A 3LQVA 1RE1B 4QWBA 3KMSA 2GA7A 1M5PC 1ZZNA 2IBOA 1F1BB 4PG7A 4TU9A 2EBGA 3JAMY 4FKYA 4WFYA 1F0XA 1SH3A 4MAKA 4FS1A 4G65A 2YNGA 3C6UA 2DY9A 4HR2A 4AQYJ 1KDNA 2IBKA 5H1SV 4AXIA 2XLKA 2CJAA 2WOMB 1DLOA 2OMLA 2VPZB 3LO3A 3MM8B 4RJVA 4U8VA 3TARA 1X0FA 1XJWB 1QE1B 2X1GA 1V3ZA 2MJUA 1RSCA 3QGHA 2DH9A 1WEYA 3QGPA 1UVIA 3RR7A 4IQMA 1E6YB 4HEA9 4YDXA 1SB6A 2D7SA 4L73A 5G0RA 1TAQA 3BBFA 4ECXA 4QR2A 1EETB 4M5IA 5D78A 3U1LA 1HNWJ 4WZMA 2CXEA 2C2DA 1CS4A 1U6ZA 2GO9A 3D1QA 2MXYA 2M52A 4ZIVA 5KAKA 4JV5F 3V81A 2WCXA 5LSLA 4MMOA 3IN5A 2W9BB 1YBAA 2FC9A 3M8ZA 1TMJA 4OZ3A 3HXMA 3M05A 3V4IA 1GFWB 1YRXA 1VBYA 2CZVC 4GVBA 3BSCA 1HHTP 2DH8A 4LR8A 4K4VA 3PYDA 2HVZA 3EM1A 3QJLA 2ZVSA 2CG4A 3H5UA 1X7VA 4KH1B 4C98A 2EK6A 2OFHX 4L76A 3CMES 3D9BA 1KWMA 4ED7A 2QLJB 4LRCA 2FTRA 4WU3A 1I94J 1R43A 2OGUA 3IS9B 3KLGB 2XLIA 3T5LA 4LFAF 4JV5J 4DZDA 4LIWA 4TXSA 4URSA 1IBLJ 4ES1A 2L08A 1KD1T 2HS0A 1TFWA 3EGWB 4XIUA 2ROEA 4IG3A 5C42B 5GADI 3KHHA 3R5JB 1SJ4P 4ZN1A 4TY9A 4A47A 5EWGA 4TYBA 1J5EF 2YNFA 4MYTA 4M5KA 3RW7A 3SEOA 5CCMA 1XC9A 2HHWA 2NZCA 2HBZB 4L3KA 1SQFA 2QN6B 2IRXA 4O44B 3TZZA 3CD6S 4LSNA 1ZM4A 1FJ7A 3AQPA 3BDPA 3TUIC 4DUYJ 2A18A 2RDDA 3UD3P 4CLSA 5D4NA 2JFDA 3ZNJ1 1NPPA 5B0DA 2NSCA 1FTCA 4EZ9A 2J9EA 2V9KA 1H2VZ 4DV1J 5J2PB 1U8WA 4UOHA 4DV6F 1M5SA 3VHQA 4QW9A 1EKSA 1RABB 4M8LA 2AMCB 2ZHBA 4IOAQ 3OL6A 1QVGR 3G6ES 5KOXA 3FEXB 4JUZA 3C6UB 4B3SF 2AX1A 4P6QA 3I96A 1GTEA 1Y3KA 2E5JA 1GNKA 2JL9A 5KT5A 2VA3A 3OTDA 4OHVA 1FF2A 4OX7A 4F25A 1FNXH 1IKWB 2DCLA 5KFFA 2IC3A 1H7WA 1YKWA 4GO7X 5C25A 1ZA2B 3ITHB 1OMSA 2UVUA 1YGYA 3OTEA 2QV6A 4J9OA 1U4BA 4QU7A 1WACA 4JB8B 1RA7A 2FZKB 4NASA 1LXJA 1UW9A 1WG5A 3CCWA 3GYXB 4QIVA 3ZNUA 4ZITA 1U1MA 3IA0A 4Y0FA 4DPWA 3PY8A 1LQ9A 1S9EB 4KQZA 1WEXA 1TKZA 4IH5A 4N5SA 3HSDA 3ILJA 3M8WA 4JI4J 4OHYA 3DLGA 2ZH1A 2ADCA 4IKAA 3FDSA 2CVEA 4RU2A 3GR1A 3DOMB 4DG1B 3AD9C 3OFHA 1S1VB 1Z2ZA 5HVHA 1V3SA 4ID5B 3RAXA 1PAUB 1Y3JA 3SQOP 3CO0P 2UVVA 2BMBA 3EXCX 4KIAA 4ZOSA 2JJ4D 5L8RC 5J1EB 4J9MA 3TZWA 2Q43A 3MM5B 3EVWA 3H2UB 1UVJA 2ATLA 5CABA 1QE1A 2XMWA 2MJNA 5LXYA 3CMQA 2AW0A 2Y1RI 1NK9A 3ISND 1GXTA 2DNKA 2QMXA 2Z2MA 4ICLB 4RR5A 2B3TB 4DN0A 2K1RB 2OHDA 3AT1B 3HHDA 2UUCF 3S01A 1FWLA 4LF1A 4KO0A 2VPXB 2C2ZB 4OLPA 5LXRA 4NLOA 1TKXA 4PWWA 3OL9A 1UJ4A 2V69A 1RWKB 5L1JA 4JBCA 5THWA 3W2VA 5CHCB 1IBLF 1OQ3A 2E7WA 4HT5A 3GIMA 1YI2S 2EI5A 2VH7A 3HVTA 1YZ7A 1H2UX 2EKYA 4WE1A 3IXQA 2CPEA 4IG0B 3FCHA 2KG1A 1R31A 1WHWA 4I69A 3V4MA 3TUZC 2GO8A 2QC3A 4O0NA 2VFRA 2DGWA 3T5KA 2Y0SD 4CLZA 3A12A 5KFEA 2CQ3A 3OD2A 1SC4B 3TX0A 4A4JA 2ZH8A 1MMDA 1OWXA 3PV8A 4B3MJ 2W2QP 3KG1A 3PRDA 3SI8A 2ERRA 3ENWA 4I2QA 3U1MA 2ZH7A 4ED2A 1U1LA 4PQUB 5HL7Q 4H54A 3I5AA 1WTBA 2C42A 1XN9A 1SKUB 2RVJA 5HMYA 2JVOA 1ZOTA 2CJ9A 1KLMB 2B43A 2QL7B 1VK3A 5HQLA 2KT3A 2IJFA 1D9DA 5T7LB 2VFTA 4A8FA 4NCGB 4GKJF 1ZM2A 2A6OA 1H6KX 1RT2A 4DR4F 1N5SA 1IJEB 1TQLA 3DOLB 3L09A 1GTHA 4KFBB 2VBYA 1HI8A 3DLKA 2QYGA 3DI6B 2RQMA 4EI2A 2LKZA 3V6HA 3NS7B 4MKYA 1PSDA 2HZAA 1FKOB 2M4MA 4OYMA 5DM6Q 3DXBA 4YHHJ 3M9OB 3CF5Q 4F3MA 3R9LA 3CSKA 2YQ1A 2QGFB 3OW2R 2H4YB 4KH0B 2HSEB 4OI6A 3EVOA 3LUYA 4X4UA 3W2WB 5IV4A 5T14A 2BJ7A 4USIA 2IJRA 5KFKA 1IBCB 2OIHA 4U96A 3VAKA 3QJJA 3K8VA 1JX4A 2ZZTA 1NH7A 3DDNA 3VAMA 2FGCA 4HACB 1EJ7L 2LU1A 4DHVA 1SI9A 4Y2MA 4YUDA 2OPQB 4OZ0A 3CCUS 1T3OA 2JX2A 3Q8VA 5AE2A 4DQPA 4ZVEA 5AXLA 2XQCA 2Q3PA 3V2UC 3PXGa 4DR7F 2QFIA 2RRNA 3AOCA 3FEYB 4OYAA 4RBTA 4BHQA 4MFBA 1S72S 1WSVA 3GJQB 1BC6A 4CO3A 4XDCA 1HLWA 3ITHA 1T94A 2DPIA 1Y5IB 5K20B 1WC0A 1UFWA 5ETQA 5MLCV 3IP0A 2KYZA 3FRZA 3F0NA 3HHLC 1RAEB 2FDNA 2WB4A 3VQSA 3TQ1A 2C28A 4DR5J 2QG9B 2D69A 4ELUA 1VLOA 1NCLA 3UQSA 1YQHA 3MPUB 4X4TA 1WC5A 4M63A 1KS2A 1TVRA 4B3OA 2EG1A 2CWXA 2FJAB 3W62A 1BMQB 5EX0A 1IQZA 1VBKA 1WF0A 3VGSA 4F04B 3KOAA 2N7YA 3HKWA 3NOCA 5HSPA 4IDKB 4FXWA 4XTTA 3KK3A 2MEWA 4CT8A 5DLFA 2ASLA 5E3RA 5HQ8A 5D0RA 2HQCA 4LBIA 1R89A 4LSLA 3NAHA 1VISA 3PW7A 1V9OA 3HJFA 1HBMA 1U09A 1FFGB 2B7CB 2C1EB 3A8EA 4DN9A 4QR0A 3ILIA 4YHHF 2KU7A 2V4QA 4OI1A 4F02A 1KVJA 1U2FA 2IIHA 3UPFA 1QUVA 4H4MA 3BGRA 4CT9A 3QT7A 2L9WA 1YSJA 3T1YF 1TKXB 2H5EA 2RUGA 2VASA 4HI1A 5GMDA 1ZAVA 2KM8B 4Z2XA 5MAOA 2XO6A 5D3GA 3MMBA 5KG7A 2W9AA 1SPBP 1UW4A 5AXNA 4X64J 1NK7A 4LF5J 1PJ7A 3MUMP 1R3NA 3R5CA 2R3VA 3CD7A 4H4KA 2X1BA 5J2NA 3H98A 3IC1A 4RW6A 1X5OA 3K5OA 4FF3A 3LWLA 4A8KA 1FVSA 2X1FA 5CQGA 2BM1A 4WFNQ 1OIAA 3LW5C 3J7ZT 3HLUA 1REGX 5D8HB 2YWFA 2V63A 4UOFA 1S6OA 2CDRB 5HMZA 2ZBRA 2OELA 2CDQA 4Q8FA 2KG0A 1D8YA 3DMJB 1TMMA 1OJ4A 1RTHB 1J5OA 1CEZA 3PACA 1TV6B 3OR2A 1NSQA 2XHCA 3RUBL 3WC0A 5F8LA 2HIQA 5IM0A 4DMZA 4BDPA 2VD3A 2IY5B 1CC8A 1BWVA 2JEJA 3BH6B 2YWHA 5AJ3F 3N5FA 4PCQA 4OX9F 1VQ8S 2JVRA 1RDRA 2QMWA 1HHSA 4KRWA 1XTZA 2DH7A 3UR0A 3KKFA 4CLKA 2VBZA 2X1AA 2AWZA 4KHRA 4NLTA 4ILLA 2W7AA 2EC0A 2BACA 2HHHF 5KOWA 4PPDA 3V6DA 2RDIA 4P2MA 2XMKA 1OY9A 3H20A 3LA0A 4P9SA 3I32A 1KQKA 5K5MA 2MB0B 1VQOS 4WYLA 3JQJA 4M5DB 5F3ZA 2ZJRQ 1S9EA 1Q8BA 1EIYB 3HSJA 2C2RA 2ZKTA 3HSZA 3LALA 5C2CA 1EB0A 2UV8G 1RADB 2AJ2A 3HHEA 4ZP8A 2MZTA 2PE8A 4YN3B 4EK2A 2AHOB 4WXOA 3ZTRA 5EGYA 5DGBA 3CCJS 4V1Ak 4R8UB 5CZVA 4KC5A 5ETVA 3WC2A 4B9UA 2MKKA 2BABA 1MWZA 1VR6A 4W4MA 1YJTA 5GAEI 4DFMA 3TX8A 3POTB 2F9DA 3R6LB 5E7OB 2VG5B 3OR1A 2UV8A 1HMVB 3O5TB 4ZPDA 3W65A 5FLXY 2F65A 1YZ6A 2W25A 4I4BA 5HK4A 2RS2A 4ECTA 3M8SA 3KUHA 5FJ4A 4ECRA 2FD2A 1FDAA 2XHWA 4QIGA 2ZFHA 3HHKA 1NK8A 1X9WA 4X65J 2B4OA 2JLFA 3DYAA 4ICLA 2Z2YB 3D66A 3SDEA 3DM2A 1HBUB 2G1DA 1RA6A 3W5ZA 1SJ3P 3QQCD 2KN4A 2MPUA 4XDDA 2DPJA 1RTZA 3B78A 2EWHA 4CDIA 4K4ZA 3NNCA 4GKKJ 3BM7A 4PZVA 1H74A 1H7XA 2CPYA 2VC1A 3LP2A 4RW8B 3JSRA 3MR2A 2ALZA 3GG0A 1C4CA 1C1BB 3R7BB 1VIOA 1RAOA 2HGMA 5E3AA 2LA4A 3F44A 5GADU 1WKJA 3GV7B 4RUAA 2KT2A 2CWKA 1TU0B 2GHPA 3HSGA 1NJWA 3CNQP 1WOSA 2F5GA 2LQ9A 4J90A 5HJYA 2W9CB 5E2QA 3MEEB 1ZPWX 1JLQA 1BQNB 4BWMA 5CYJA 1ZAWA 3L95X 4DL2A 1XNQJ 4K50A 1HBNA 3NRBA 2GHWA 1TR0A 4ZHRB 2HHHJ 1HNIA 2RKIA 3I4PA 5CYQA 2B9XA 2L48A 1BHNA 3I5BA 2C2NA 2FVQA 3MOZA 3FUYA 3U27A 5L38A 2UUAF 5I3UB 1GMUA 2XNRA 3QZ8A 4EBCA 3OJUA 5CH7B 3RGIA 4BLGA 4MIWA 3KLIB 1YBTA 3O44A 3JSYA 3K57A 1U0HB 3CDWA 3M8QA 4B3SJ 2HAFA 2XG8A 3MFHA 3KJVA 2EFVA 4O4GB 2LFVA 3OHAA 3CPWR 3FSIA 2F8MA 3WX4A 2J76E 1PC5A 2IYGA 1NPRA 3CCMS 3BO4A 2DD8S 1MMNA 2PD1A 1S1UA 1F9FA 2OPSA 4OJ1A 1WHYA 2FHJD 4DV2J 2E7XA 3G96A 3VAHA 3RBXA 3H2VE 3G8SA 3T41A 1AZSB 2Z2ZA 3PEJA 2MZSA 2OSQA 1C4AA 1HQ2A 1LWEA 2B56A 2KFYA 5LM7E 1OQ6A 1KOOA 1S1XA 1FRMA 1WC1A 2CQPA 3DOKA 2WOMA 5KT4A 2EXUA 2AGOA 2UXBJ 4PYAA 4MK9A 1N5TA 1QM9A 3PIPQ 2CPIA 2IRUA 2AQ4A 1J2VA 2AEMA 3OVBA 3QLHA 3DHWC 2VICA 2MZ1A 1CQNA 1SC6A 2ZWOA 4NRTA 2GMLA 4ZPBA 1BQXA 1QJHA 1UVKA 1EAYC 1VYAA 5IT0A 2H48B 3D7SB 2MKHA 5KFYA 5C24B 2ASDA 3R5GA 3SCKE 1T03B 1UP1A 4NCBA 1C1BA 4KBIA 2HFOA 4NLUA 3GYGA 1F3FA 4Q44A 4WFAQ 2J6TA 4QJVA 4K0KJ 4QU6A 2XCPA 4WIIA 1XMQJ 5IXUA 4OJGA 3A8IA 4F4XA 1FCAA 2EFGA 1K1QA 3MPWA 4UW2A 5BYRA 2IM1A 2H4WB 3ENVA 3GJTB 3TUJC 3O3LA 2H3EB 3ENQA 1L3UA 4Q7AA 2AZ1A 1B7YB 2IVFB 4KB7A 1S6QB 2XI3A 2V67A 3TEHB 2IMWP 1UCNA 3AA8A 4PAAA 5GAGU 4QWEA 1R8BA 2VU5A 5JMNA 2VPYB 2FVPA 2FPHX 3K89A 4DQRA 1G7CB 4DQQA 4KYZA 3AXMA 1T05A 1JXEA 3MECB 4N8OA 4RX6A 3TA1A 4W98A 3RYLA 5JUMA 4J9QA 1ZTWA 3BGFA 5KT7A 2I0XA 2V6AA 3GIKA 2H51B 2K7JA 1GX6A 1HPZA 2GMHA 2KM8C 1IBKJ 4X2BA 1ROFA 2BEFA 2EG2A 2M3DA 3B4MA 4NLVA 1TL1A 4YFUA 2YKAA 2CZ9A 1TKTA 4ZJOA 1SUQB 3KDOA 1K0TA 4B3MF 1LNQA 5IZHA 5KFRA 1OSDA 5KT6A 1U48A 3IG1A 1DZ5A 3O2IA 3CWJA 4ETXA 2F7VA 3MMAB 3I9V9 4KAIA 2QA2A 1YJNS 3DLJA 4DR2J 5DS7A 3ZZUA 2HRYA 2EW9A 1WI8A 2E1MC 4C0HA 5B0GA 8AT1B 2YQ0A 3JYTB 3M7VA 4NLDA 3X3UA 4DR1F 2NZ4A 4IFYB 2MYFA 1SIZA 2QL5B 3SBMA 4X66J 3GZ7A 3QSIA 3OUYB 4CM2A 2BQRA 4PXBA 1N48A 2VOPA 4B3RJ 1CG2A 4N41A 3O1LA 4GRSA 3TZXA 3D2WA 2ZH3A 2C3MA 4MTPA 1VI7A 4CP5A 3QLHB 5DG9A 4HYKA 2W7OA 4EZ6A 4AE5A 1NEEA 3ADAC 1LW0A 3M1VB 2WAQD 2LMIA 3MR7A 3IRWP 2V4JA 4RW9B 5CZXA 1JQGA 1RHRB 1TL7B 1SCJB 4LF7F 4NX9A 1RAHB 2KXFA 3P5TL 1W2IA 1WC4A 1X4HA 2GQ2A 3LGMA 3VR1A 1NRKA 5B0FA 2B5JA 3MFIA 3TAPA 3SIPB 2XMJA 1IKXB 6FDRA 2HMIA 1JLGB 1JNZB 4M5LA 2PI4A 3UNGC 2IVMA 3A8JA 2EC2A 2RRBA 3DLGB 4IRCA 2XYPB 3LPYA 3P3DA 3TVZA 3IBCB 3NMAA 4USJC 2J0QD 2JNJA 2RS8A 2WVBA 1K1SA 4DCJB 7AT1B 5BR8F 1HW9A 4X4RA 2XY7A 3N6LA 1BD6A 4ECWA 1HYSB 5GMKa 3E2EA 2BXJA 4DCOB 2J9DE 1C2PA 1KFDA 2EFOA 2K3IA 2CADA 4ANCA 2MLZA 2RQCA 1WC6A 2FLOA 1V3RA 2RSQA 3HKZD 2MZRA 5K9FA 1G1XA 3DRSA 5A2QY 3HM9A 1A7GE 1T02A 2ZKUA 1GMVA 1BWEA 1PJ6A 5DRKA 3RBZA 5A6PA 1Q82T 2YKNB 2G0CA 3CDEA 2M9KA 1WI6A 4PXCA 4UUWA 2ZE2B 1U45A 4PG5A 3CDUA 4MYUA 2HVDA 1TL1B 3R1HA 2J0WA 3M8PA 2IRYA 4Y28C 2UXCF 4OYXA 1T0TV 3G4SS 3KLEB 2IJNA 1DQAA 3UI3A 3CTRA 1WDDA 2QL9B 2BKNA 1IBMJ 1FRLA 3CIZA 2CVIA 2QA1A 5KG6A 2UXDF 1FFSB 4OJHA 4RLEA 1U49A 1HR0F 4MKVA 2QLFB 2DNGA 2Z8QA 3M2RA 2WBMA 1RQ0A 4WP8A 1S76D 1FNOA 2D9OA 4Y65A 5ETLA 1NAQA 1HA1A 1WOOA 2BJ3A 1IWGA 1WHVA 2DNYA 5HI7A 2PIIA 4DLEA 2HFZA 4LF6J 2BANA 2KVQE 4NXMJ 4DEZA 4ZLJA 3OL8A 3JSBA 1MN9A 2WONB 2B8QA 4YP3A 3R6GB 4P2XA 1WOPA 2ZOFA 3OTBA 5AXMA 4CQ1A 3E8OA 2M70A 1CJUB 1XMOJ 4DV3J 3R2DJ 5I3PA 1NB2A 4X65F 2E9RX 4DSFA 1ICEB 3RR8A 2EPIA 4DCPB 3V5RA 2B51A 2EFPA 4FS2A 1U1KA 4LFCF 3QIDA 4F36A 2DGQA 1AXQA 1U0HA 4ALZA 4R25A 3KJVB 3GV5B 3PYEA 1VQ7S 1SH2A 2HIYA 2YWWA 3TJ9A 1RWUA 2FGOA 4J91A 1FXDA 4P74A 4Y34A 3CB4A 2PDAA 2HK2A 1LW2A 2CQGA 4RUHA 1NKEA 2NXEA 4OFZA 1EP4B 2FLPA 4NMXA 1JKHB 5L46A 1S79A 4ILMA 2QSFA 5JJBA 2WVCA 4B08A 2MQMA 2RB7A 3RB3A 2XZTB 1TL5A 2MZQA 4LRBA 2OPPA 4ZCLA 9ATCB 4AYBD 3OBIA 2PSZA 1U0SA 3PW0A 2BKOA 3E51A 1HNWF 2HAIA 1SKSA 2G13A 2OUGA 2V0NA 3CE8A 1NZ8A 3SQGA 1SC1B 2N7CA 2DR9A 1VC6A 1S1XB 2DGUA 2HK3A 2IM2A 2MHNA 1VQ9S 3CJ5A 4JI5J 3EUNA 4CZCA 1UWBB 5U47A 1O51A 5F8NA 2BQ3A 3SFUA 3WDOA 1QLNA 2MGZB 1SL1A 1JLCB 2DEJA 2DVIA 1FDBA 3FBCA 1UVNA 4USHA 3FCVA 4RZRA 4PWUA 1KFSA 1NSKL 2Z2LA 2NYIA 3ELHA 1FERA 2NSBA 3GB0A 3Q8UA 4OMFG 1DRZA 2HRTA 4K7QA 2GVZA 2MSSA 4FPRA 1M5VC 1YRUA 3CGIA 1RTHA 2GCFA 1J5OB 3TP2A 4IUFA 3WIVA 4DX7A 3KHLA 4RW7B 2WTFA 2CNOB 2YNHB 4OX8A 1KQSR 1FKPA 3GIRA 4IO9Q 2W2OP 2ADBA 2DHHA 2CPJA 4P71A 2Q1LA 1DTTA 3OLAA 1TL3B 2FHMA 3MR6A 2QX0A 1IR1A 2WONA 4F8RA 2DY1A 1YBUA 4MIAA 5HANA 2D3OR 3T5HA 2FLLA 3RJMB 4WCEQ 1RLCL 5HP1A 1CSJA 4P7TA 3QAEA 2DRDA 4LBPA 2R2UA 5F0UA 2F8EX 3V6JA 4XO0A 3CJ3A 4DV7J 2BJ9A 1NK4A 4PUOB 4F4WA 3NNAA 2KVIA 4NZ7A 1S0VA 1C0TA 4CO1A 5LSRA 3A4TA 4NLXA 3NP5A 4LR9A 1LWFB 1NJIT 1FVQA 2OI2A 2R7OA 4I0WA 1YWXA 3K7RA 1MROA 5HQMA 2W8KA 2OMOA 1LFPA 1VJWA 3HD2A 4DDFA 5GAGI 2DIUA 4K4TA 4U7UD 3OR2B 4ZK7M 2XS7A 4F4YA 3PRBA 3MEKA 2RU3A 5KFXA 2HGNA 2IA0A 2LXIA 1FRKA 1Q78A 3WQPA 2HQFA 5F9NA 2APOA 1NJYA 4MKAA 1E6YA 2LEAA 3I4HX 1RT6A 2E1RA 4F67A 2XYGB 3D1OA 3EMTA 2H65B 3OSPA 4ZPAA 4E0DA 1KN6A 2Q6CA 4OHWA 4H4OA 3QIPA 2CQ4A 3I0SB 1KEKA 1TUVA 4JP8A 4NLYA 2GHVC 5BYSA 2PGCA 5HO4A 1TK0A 3ZO7A 3QSYB 1U1OA 5KFWA 4CNYA 1VRUB 1GH8A 1IKYB 3EDQB 4YB5A 1JJ2R 3W9IA 3GFYA 4UOCA 4CM0A 2BW2A 1NKBA 4TY8A 1RT5A 2AGQA 1RISA 3FBBA 4CH1A 1RT7A 2Q79A 3D6TB 3OVAA 3BB5A 2WVEA 4KGZB 1NHUA 2JOQA 2CG8A 3MMCA 1RYRA 1NDPA 1K44A 3JS9A 1HD0A 3OJSA 2KKHA 1S7IA 1N5YA 3NS6A 3KLGA 4ZVHA 3CC4S 1PKUA 4PQAA 3VGVA 1YJWS 2VFUA 3MEGB 2GV1A 3SXLA 3TR5A 1UA1A 1M1KT 1QAYA 1HBUA 2RJZA 3DHXA 3RRKA 5KFMA 1FHTA 2MTLA 3QO9A 5A0YA 1WC3A 3E01A 3LOUA 2ABYA 3BKTA 4ZP9A 4HDGA 4E8UA 1PBAA 2GS8A 2AYEA 1RWOB 2LU2A 1O5JA 1S1WA 2C2KB 3DFEA 3W64A 5B7WA 1TFYA 1Y11A 3JB9k 2UZAA 3Q89A 2NPFA 2HS3A 4ECSA 3G9CA 2YNIB 1S0MA 3QYYA 1B70B 3A8KA 3R1LA 3RG6A 4DV5J 2HLTA 3W1YC 4KGVB 1X4CA 3KK2B 3NWRA 3QAUA 4CO4A 2R7QA 3BR8A 2VG7A 2VQFJ 3T1HF 1NSAA 4QYRA 3DU5A 3BQ2A 2V2ZA 2E29A 2G1HA 3BH7B 3SMZA 3US5A 2HQIA 5BYQA 1NLKL 5KTQA 3PVXA 1QTMA 2XMMA 3HI9A 4B9TA 1F5CA 1N32F 4DL6A 4KHMA 4ECZA 1K8AT 1D0EA 4FYXB 3M8RA 3RAQA 2BDPA 3CDBA 4E98A 1IVZA 4IG3B 5C42A 2AYBA 8ATCB 4K4WA 2IC3B 3A3NB 5K14B 1AT1B 3TAMB 1MWYA 2MDAA 3KLIA 3KK3B 5LMNF 2Z58B 1R8CA 2W8LA 1U6BA 1TTHB 4JI6F 4NI2A 1UL3A 3UCZP 3PX6A 2NUHA 1S1UB 4IFVB 1YRTA 3FVYA 4ZA1A 2UXDJ 3RRHA 2OEMA 2OD4A 4OV1A 3MM7B 5IFMA 3ET6A 1Y5NB 2ZBIA 4C0BA 4ENOA 4FVMA 3PR5B 1N88A 1SKWA 4OX6A 4QIEA 2EKNA 1V5VA 4L75A 3MEDA 5DDQC 1SL0A 4RNHA 4NWBA 4UF4A 3SSSA 4UZCA 1KNZA 1VS3A 1Y00A 2CPXA 4DG1A 3DLEA 4HI2A 4RU9A 4DI6A 2KH9A 2HFNA 4MFBB 5D15A 7FDRA 3AB2B 5D3GB 3M30A 5K8OA 3KTQA 2BYCA 4LREA 4LRAA 1RTIB 1RT4B 4ITSA 4CH7A 2EBEA 3TJ8A 1W25A 1B99A 3IWLA 3BO2A 3FRYA 3D3BJ 1UWBA 3WZ0A 3KMQA 3AAWB 1B4SA 2COLA 2K8GA 1PBUA 1R0AB 2OAUA 5D6GA 3P5BP 3NY0A 2WZ1A 3PJXA 5FDLA 4B3TF 1S6PA 3C15B 3NGUA 1HD1A 5M2PA 3M2UA 4Y6IA 1UFKA 3G6YA 1D09B 1NJXA 3NEKA 4LFBF 1YX2A 3HZGA 2HGLA 3QT8A 1JLEA 3ZZOA 4DOZA 3N4WA 4F4AA 1G3OA 5B0CA 1FX4A 4WJBA 5DZ6A 1U1QA 2R7TA 4OYIA 4N56A 2JZ5A 4JI1J 1N33J 4DPXA 3D4JA 4JI3J 1KTQA 5A8WB 2C2MB 3CEDA 1L3KA 1C1CB 1UEUA 4DR3F 2QE5A 1NDLA 3HHLD 5HROA 4OZ2A 2PA3A 3CXCR 2CQIA 1QSLA 1PYOB 3DLKB 4TN2A 4FBUA 2BRKA 2H54B 1UTAA 2VFVA 5D4PA 3SV3A 3FFIB 2B6AA 1Q86T 4QWAA 3K59A 1N6QA 1A9NB 1RCOB 1S4EA 1KKHA 1U02A 4M94A 3A1YG 1N34J 2B5JB 4M1KA 4CLLA 1Q4RA 1X4FA 2I5JB 2QSWA 4NA3A 4U8YA 3NAIA 1FFWB 1FKOA 2P2CB 5C7PA 2XSJA 3H0PA 3PJWA 3BYPA 3IR5B 5KFGA 3GFHA 3N6NA 3ZTQA 3CJTA 4DPYA 1K73T 2DNRA 2FJXA 3D6FB 3IRXB 4ED0A 1GMWD 3EE3A 3UW1A 1IXKA 4O3PA 4I6AA 4RWWA 2DR7A 2DK2A 2CRLA 2QA4S 4DX8H 1N56A 3KNAA 2Z57B 4FF1A 4WXWA 2JLGA 2OPRA 2ZH2A 1HNZF 2WVFA 1JIHA 5G0RB 3W63A 1VIXA 2XSFA 4C3MA 1MU2A 3UO0A 4F3QA 4F4ZA 4RUBA 2RILA 2X51A 4WFZA 3UE2A 3GIIA 1PIEA 3Q8SB 2V9WA 2RU9A 5AE1A 3HCXA 3KK1B 4DBQA 1R0BG 3DGPB 1EETA 1I6JA 2FHOB 1W26A 2YH1A 2N4CA 1Q79A 3TZYA 4R5PB 1L5UA 3FZ2A 2NXJA 4KFBA 5HLFA 2I8EA 3NGKA 1RUSA 5J2QA 1U8SA 2E66A 1S9GB 3D67A 3QIPB 4AD6A 4XAKA 1ZYQA 1FX2A 2OTLS 2HVHA 1VFJA 3MDFA 4H4KC 4KKOB 5F8MA 2PT0A 3CULA 1RU2A 4XPEA 1SQEA 1RK8A 2ACYA 3LGHA 4K2JA 4PXDA 3H59A 1RBAA 3CJQA 3IGVA 3M2RB 2ZEJA 1HNIB 4C8KA 1TP7A 1JMTA 1JJ4A 4B9SA 4BCAA 2MKYA 3CCES 1OYDA 2CNNB 2OEKA 1UEKA 4LF5F 2GZOA 1X5TA 3OFFA 1N36J 1R6YA 1XR6A 4B9VA 2QA4G 5HAOA 4Q8EA 4LQ9A 3J7A1 1LK7A 2OPQA 3B6BA 4Z37A 2R9LA 3MM8A 3Q2SC 4BC9A 1NM2A 2J5AA 5HROB 2DR5A 4KHPJ 4I56A 2YXLA 1RWNB 3HFKA 2FJVA 2WB1D 3AXKA 4DX6A 3T6JA 3PFOA 2KTQA 3PNIA 2AJ0A 2YPZA 5KFDA 3CCLS 2UUTA 2KXNB 3MM9B 4LT6A 4RNMA 3PW5A 2L3MA 4PWDB 1FE4A 1FA0A 4B9NA 2PI5A 1CS4B 2FZCB 2V8GA 3BPDA 3PDNA 2CPDA 3L4BC 4Y2AA 4ZVPB 3QGGA 2ZZMA 4MK7A 1R0CB 5K8MA 4DV4J 3NL0A 3CJ2A 4O3OA 1QTNB 5ETOA 3I6PA 2R7SA 2DHSA 3PRVA 3LANA 2JHEA 1RGVA 1S1WB 3BKUA 1H73A 1S9FA 4NA2A 2CFXA 4WK1A 2F3JA 3GIJA 2ZDPA 1U25A 2HHTA 3W8GA 4ANDA 4MH8A 2E5LJ 4DWIA 5KG4A 2RKIB 3CCZA 3OTCA 1YK9A 1XEZA 5ETNA 3H5YA 4ECYA 1VBXA 3NGTA 1SKRA 2Z56B 2EFQA 2GVDB 3V4IB 1CPZA 1RT3B 2DEIA 4UZBA 2WSCC 1HBMB 2P5VA 1L3TA 1TAUA 5H9EK 1JWWA 1KHVA 1H0HB 3UR3C 1CJVB 3PHTA 4LF9F 4N76A 3OQ2A 2A10A 2E44A 4FKXA 4FYDA 2XMUA 4A8OA 1U1NA 2LLZA 5CD4H 4WFXA 2HYIB 4ILRA 4IOCQ 2ALYB 3GG1A 3DGVA 2QRRA 4F26A 5F8HA 3PW4A 5SUHA 3EGNA 5D0EA 3JTNA 2DJWA 3FJ2A 1QSSA 4CO0A 2FJEB 4NL5A 1AUSL 2BR0A 4QQBA 5KFNA 3GYNA 2F9JA 2AYMA 1IWAA 1NXIA 3BBBA 2MZJA 4NI2B 2YH0A 5L1IA 4DLGA 1AUDA 2AYGA 4DV0J 2KZMA 5EWEA 2CKWA 3BGUA 1KP6A 2DISA 4HTJA 5J1EA 4DL3A 3NG8A 1RACB 4NYPA 4TU7A 4M5DA 1K47A 2OFGX 2DIVA 3C14A 1S1VA 4K59A 4DPTA 4YMEA 4ANEA 1HNXF 3SSRA 1RLDA 2BE9B 3LH2S 5L39A 4KPCA 4UQGA 2WBRA 1M5HA 4CRJA 2R42A 3FK4A 1Z2LA 4DFJA 2FQQB 3SQGB 2HG4A 4YQWA 1RAIB 1C0UA 1VBZA 2NXUA 2HWTA 2YNGB 4OYPA 2DRAA 1XIQA 3LP0B 2MLXA 5IQQA 4DV2F 2V8DA 4ZPWR 2VUGA 1UMJA 2C3OA 2ROGA 2HNDA 3QPIA 3R5AA 2W1BA 2F1FA 3ZTOA 2CIMA 1HWJA 1S49A 3DYAB 3G82B 3H4DA 3PIOQ 4NCAA 3M6UA 2E5HA 3QMQA 2ZWPA 4USVA 1FD2A 4UY8T 3G8TA 2E5LF 4G1QB 1WELA 2FB0A 4C4WA 2DB1A 3FCWA 3QFWA 5KFHA 2JFKA 4MIBA 5J1PA 3NNHA 5E3QA 3GSIA 4ER8A 4RBVA 4CTAA 1FO1A 1YDLA
chains in the Genus database with same CATH topology
1KLMA 2ZHAA 2HNYB 3MM5A 5JVHQ 2B4VA 3DXSX 4MJKA 4HKQA 3S7RA 2JEIA 3M6WA 2OKQA 4ID8A 2RQKA 4FN5A 3CDAA 1UKUA 3DOLA 4ERDA 3KG4A 5LJ3Y 3FMBA 5LJ5Y 4U7UK 3QZ7A 4GO5X 4C3LA 4J9PA 1T05B 4CO5A 3DLHA 4RW9A 2XLJA 4NOHA 4X84A 4FF4A 3MGJA 4OHZA 4X4OA 4KT0C 1RTJB 2LCWA 2OPSB 3R5BA 3CC2S 2P6SA 1XR7A 4WE1B 3MURP 2JC0A 2HHPA 2VBXA 2Y1IA 2RF2A 3OSNA 4IH6A 5KG0A 1VQ5S 1LWEB 5D4OA 1LWFA 1QAJA 2JEFA 3OHBA 3BSAA 1B0PA 3IRXA 4PG4A 4C8NA 2ZDOA 4IFYA 4GC7A 4TU8A 4LQ3A 4ED3A 1FRJA 3DRSB 4DL7A 2VKZG 4HDHA 3GSDA 1S0OA 2P9GA 1K0VA 3RAMA 1ZTTA 4V19X 2U2FA 1NHVA 4ZCMA 5IQ6A 5I3UA 3BZQA 2R7VA 3BJYA 2OJ3A 1SBRA 5EN1A 2PFFB 4Q45A 3VZIA 2CQ2A 3THTA 2PC6A 2R2RA 2NREA 3IAM9 2RIJA 1WD6A 1LK5A 1X0PA 1OPZA 3I0SA 5IT4A 4AUKA 4JV2A 1VRUA 4OJ3A 3RW6A 4FNIA 5E3CA 3KK2A 1I1GA 2NLWA 2UUBF 1IM4A 2ZC3A 3GFXA 4PRFA 2DNQA 5E33A 3PM9A 4TY8B 4O3NA 4H4MB 1T95A 3EGZA 3KNGA 1N8RT 2J7UA 1HBOA 1KRPA 4QIWD 2A2CA 5GAEU 5F9LA 1H98A 2O3DA 4AL6A 3HHNB 1G6BA 1S1TA 2AJFE 2CQDA 1VRTA 3CJ4A 5I42B 4C11A 2R8GA 2E1CA 2HNZA 2UXDF 1F60B 4GMKA 3I31A 3MM6B 1SUQA 3I87A 1OPIA 3BEGB 3DRPB 4DFPA 5J2NB 4ELVA 2BJDA 3CT9A 2J0SD 2I1RA 2ZH5A 3HX9A 5JXSA 1HPZB 1FK9A 5IS2A 2L41A 2BV3A 5FD1A 2VZ9A 2PEHA 2JLEA 4JI5F 4W92B 1TV6A 3M32B 2YNIA 3I0RA 4DV3F 4OI0A 5DG7A 1CVJA 3RBEA 1HL6A 1UEVA 1M5KC 1U6FA 3G8QA 1TL4A 1IBLF 1BQMA 1UJ5A 1S99A 2NS1B 2EFNA 5B0AA 1JLAA 2AX0A 3M6XA 4U9RA 1ZM9A 3G6VA 3M30B 2BBEA 2C3PA 4HH0A 4PR6A 4UUXA 2Q66A 1DLOB 4KR0B 3DC2A 4FZVA 3U1NA 2DGSA 1B0TA 2IMOA 1NK6A 3PZPA 2M8HA 2ZNZA 3MMBB 3T5JA 2PO4A 2LYVA 1RT1A 1YJRA 2Y1JA 1R8HA 1LOUA 3W7BA 3CCQS 3FEZA 1CC7A 1WTFA 4DR6F 3HK2A 2N3LA 1DAXA 2LDYA 3MPVA 4A48A 1DTQA 4MK8A 4G1IA 3ZFVA 3KLHA 4ILMA 3M9MB 2XEXA 2W9BA 1DFDA 5DQIA 2QLWA 3K58A 2XS5A 1Y9OA 4ATNA 3ISNC 4IH7A 3DRXA 2M2BA 2UP1A 1Z4UA 2IM3A 4Y3CA 1FJGF 2E5GA 2YWEA 2VC0A 2ZJPQ 3IR7B 3IO1A 1LXNA 4X4PA 2K1RA 1O0PA 3OVSA 2AU0A 3K2YA 3H40A 4QBUA 2CQ1A 4IO1A 2RDJA 4DF4A 1KSPA 3N0VA 1FD8A 2B0GA 1XMBA 1TZ0A 2XNQA 3LP2B 3OV7A 1XNQF 4IRKA 2L9NA 1VQPS 3WBZA 4C11B 1X8DA 1LW0B 4Q0BB 4CCHA 2OTJS 3UFCX 4F3OA 3JSMA 2KRRA 3UWTA 2PMZD 4J9NA 2QYCA 1HQUB 2ZM6F 2RMLA 3TA2A 5KT3A 1VOMA 5FDLB 4KSEB 2JRSA 3IAS9 3M32A 3M8PB 1KC8T 4G1QA 5KFJA 2ZD1B 4JI0F 1JLGA 3MTKA 4PQUA 1U2RA 4DJBA 3J7Z5 1VQ4S 3CD5A 2ZUGA 2KJVA 4DV4F 2DNNA 4KGKA 5BJRA 2J9DA 2FIUA 3VAIA 4ZHRA 1S10A 2OLWA 1RKJA 2UVWA 2CJBA 2HRUA 1N54B 4NZ6A 3M6VA 4K4YA 5KFVA 1VRTB 3H2LA 3K5LA 3AHPA 4X64F 3KG0A 4QWCA 1HYSA 5A8RB 2M88A 2J0XA 3H4BA 2VBWA 2I38A 3L7PA 1FKAF 3SSQA 5IWAF 4N47A 3Q0AA 5D77A 4U6PA 1VQ6S 1PO6A 4WTYA 3MHYA 2ZJQQ 2J7WA 2XC9A 2W4PA 2MSTA 1JLFB 1Q7YT 1D3WA 1QUPA 3GR0A 2XULA 3P96A 4RW4B 1VQMS 4I67A 4A8MP 4LSNB 4WFBQ 1RAJA 5F0WA 5FIIA 2MQPA 4Q43A 5KT2A 3PO4A 1F5AA 1X4GA 3SCJE 3B4DA 4UY85 2NUUG 4CI0B 5AE3A 5M2UA 1VC0A 4FF2A 2XGQA 3SYZA 5J2PA 3E3XA 4ECQA 3DMJA 4LVNP 3S8SA 3G86A 1IJFB 1N0UA 4PG8A 4RWXA 3AQOA 1NNDA 1FRHA 1TVRB 3N01A 1KVIA 2JWNA 3IGNA 4KO0B 4P7VA 1Q16B 3T19A 1FNMA 4EU0A 2X3GA 3VALA 5J2QB 4K5SA 1VQYA 4QW8A 1FRIA 3V6KA 4R5PA 2HZCA 3C46A 2H9ZA 1R27B 1S48A 1FDNA 3HVTB 1X9SA 2DO0A 3F41A 4YR3A 4EEYA 1D9AA 5LMUF 4J5OA 1P1TA 3O6QA 1WEZA 4A8YA 1TKZB 3U7JA 4RW7A 5L9NA 1NH8A 1EP4A 2GIRA 4OZNA 1HNVA 3B82A 2ADCA 3MCSA 3MD1A 4I7FB 3TVKA 3AH6A 1N34F 3N79A 3MECA 1JLBA 3CJKB 3ULHA 1DQ9A 2CPZA 4JYAF 1F5BA 4OI4A 4A8XA 1N4LA 5KFCA 3Q23A 1UFLA 2WRMA 4DV1F 2N82B 2LEBA 2QO3A 1XMQF 1OS5A 1M0SA 4HHJA 4Q0BA 2JC1A 2DNPA 5I42A 4DQIA 5L1LA 5C24A 1T03A 2MHEA 3NCRA 3JTPA 3Q8PB 4JI1F 2AJQA 5KFZA 5GVQA 4O3SA 3IG1B 2V5HG 5HP1B 1T7PA 1VC5A 4DR5F 2GNKA 1JB0C 2B9YA 1H2TZ 3TNVA 3BDEA 4ZPVR 2RD5C 3I0RB 1WG1A 4K2XA 2HHUA 3OUYA 4KE5A 1MW7A 4U7CA 2W9CA 3QJPA 2JH3A 1P27B 3K5PA 4G6VB 2YNHA 3M1VA 1C0UB 3FSXA 4BS2A 3EX7B 5A6WA 4K0KF 1XERA 3LP0A 3CO9A 4O3QA 4O3RA 2XMTA 1U24A 3MPYA 2PA8D 2KO1A 5B08A 2M7SA 2HPUA 4ECUA 1QY7A 4O23A 4C2MA 2MQLA 5I4MA 2D74B 1UAWA 1RT2B 2YWKA 1IN0A 3I82A 3LWMA 1TKTB 3H5XA 1N0VC 4W90B 4AFFA 4KHPF 2UXBF 3DI6A 2QEXS 1DJ0A 1REVB 5DO2A 2DR8A 4V19J 5B0BA 2LA6A 4OZJA 1XR5A 2YKPA 2ILZA 3M4XA 3OL7A 2VB6A 2MY8A 3U02A 4EBDA 3RB0A 1UVLA 1ULRA 2LECA 3PW2A 3OPKA 1FE0A 1ZZFA 1GXLA 2GGPB 2HHSA 3IFEA 2GJ2A 3TVYA 3HZEA 1QAXA 2YNFB 4ZDNA 5KFAA 1KQGB 3V81B 4ED5A 3K5NA 2CQHA 5KG5A 4X4NA 2YKNA 2R8KA 2VPWB 3BSNA 1NZAA 4DL5A 3THVA 2ZBCA 1PILA 3BREA 5A8KB 3C6TB 1S6PB 3K5MA 5ITHA 1Y0HA 3G71S 1VGYA 2VODA 2R7UA 1Y5LB 3FQLA 2F8HA 2KI2A 3ONQA 2BM0A 4LIRA 4R0JA 3HMJG 1A6LA 4F4KA 1X5PA 1Z1ZA 2GJIA 2R4FA 4UQTA 2BANB 1HI0P 2BJEA 1IKYA 2W4DA 3TW0A 2PN6A 2HNYA 4I1TA 5KFOA 3PR4A 1KR4A 3OTOF 3T3FA 4DFMA 2DRBA 4CO2A 3UD4P 4YB6A 4L3NA 4TQSA 2O1PA 1X4DA 3NS5A 3BF4A 3DN9A 4AL7A 2R7RA 2VG7B 1KN6A 3KFWX 4KV8B 3CCRS 4Y2CA 4DR2F 3X1LB 5F8IA 2GQCA 2GMJA 2GX8A 3GFZA 4F2RA 4ED1A 4LF4F 3ISZA 3UDCA 3BGRB 1LW2B 3C66A 4N8NA 1KOHA 4C7QA 4NA1A 1LWCB 4FVCA 2DHGA 5LL6d 2DGVA 3UCUP 1SL2A 3TAMA 1YIJS 4ZKAA 2R2TA 1BLUA 5CCLA 2R7WA 3SZ2A 2KHCA 1M90T 1D9FA 1FDDA 2V4RA 4C97A 2ZH6A 2ZC4A 1X5SA 1YTYA 3VCDA 3I56S 1CQMA 3FNNA 4DV0F 2VG5A 3OR1B 4PG6A 3RBDA 1NO8A 2MQNA 4J37A 4ED6A 1XK8A 4FNHA 4OZ5A 2GGPA 3MAQA 3NCPA 1TK8A 1Y7PA 5HBMA 4WKYA 2XS2A 3H25A 2FHKA 2FJDB 4PXEA 3HVAA 2W7PA 4FXDA 3NCQA 3N5BA 1RT4A 3ICLA 2YKOA 3T6BA 1IR0A 3DOMA 5G4DA 1GT8A 1TK5A 2VKRA 4QYZJ 2CQCA 4KKOA 1UA0A 3MR3A 2ASYA 2M8DB 3Q22A 5E41A 2ROPA 3HVWA 2V94A 3HO1A 5E0OA 3M2UB 1MNEA 2QLXA 2B9WA 3MR5A 2FVCA 2IHR1 1YJ9S 4RUCA 2MY7A 2LQ5A 4ZP7A 3GWCA 2POKA 2LXFA 2YWGA 5KG1A 1JLEB 3AJ2A 3HDSA 2AJ1A 5F41A 2RH3A 1W2BR 4K4SA 2HWHA 4JI7F 2BE2B 3FSYA 4KV8A 1MMLA 1NU4A 2ZNYA 5CYMB 2C3UA 3IR6B 1HMVA 3EYZA 4YB7A 1DQ8A 3MM9A 1C1CA 1P6TA 4URQU 3T9NA 5C5JA 4IR1A 3DM2B 4PUOA 4O44A 4ZPTR 3PX4A 3P49B 2HW3A 4EO6A 2KYXA 2NPIA 3S1TA 2LQJA 2YQ3A 3T1AA 4RNNA 2WHOA 1LWCA 1U7LA 4D3HA 3GMGA 1SV5B 2VQEF 1ZH5A 1VK8A 1JLQB 3BN4A 3M2VB 4DPOA 1SJ1A 5L1KA 3BGLA 1RKIA 1DHMA 4OIXA 3KHGA 2F4VF 5EX3A 2ZITA 2D1CA 3D0GE 5CXTA 1S7HA 3H8YA 2J6SA 4JOUA 3MWBA 3RZAA 3DRRB 1NJZA 2YX4A 4K5RA 4DSKA 2D9PA 2DBBA 4RNOA 4ELTA 2YKMB 2DNOA 4YR2A 3DU6A 1X4BA 4IRDA 4LMZA 4EBEA 3MUVP 2B4PA 1WF1A 4B17A 1HWLA 4IDKA 4EUVA 3DGPA 3MXHP 3UDLA 2A1BA 4O4GA 2V2KA 3DLLQ 2O67A 1REVA 3PX0A 3OXGA 1HWKA 5LSOA 3CCTA 1TKDA 3VAGA 2PMHA 4LF8F 2DHAA 2RQ4A 1XMOF 1D1UA 3PO5A 1JKHA 4CIOA 4IYQA 2XY6A 1R8PA 3VWSA 2AV5A 4FP9A 1ELOA 2OPPB 1N5YB 2QFJA 2BE2A 1GX5A 5F8JA 1Y4ZB 2DHXA 2XGPA 2VL1A 3IBWA 3QWUA 1S4FA 3E01B 5F3TA 4ES3A 2DCUB 3DDKA 3I9ZA 3J80Y 1WHXA 2ZH9A 2XWXA 1SJQA 2DGOA 1URRA 1VMBA 1ZBTA 4O0IA 1S0NA 2OH2A 1HQUA 1HW8A 4QOTA 5L9XA 3EZ5A 3JSMB 5HLFB 3MMJA 3DRYA 4EYIB 2AD9A 3MMAA 4B3RF 2OP5A 2E5IA 3D0IE 1AFJA 1RYSA 1HQEA 2ZH4A 1E6VB 1IBMF 3H5SA 3V4IA 1SXLA 4C8YA 4C0OC 2IFXA 3TRGA 5HMXA 3QGIA 1HARA 2ZZNA 3KYLA 2Q6BA 2J7KA 3OXLA 4G1PA 4ZS6A 3MEGA 2IYIA 3L7OA 3PKYA 2R8HA 1Q81T 4WKRA 1FXRA 1H3DA 2W4CA 2C22A 3SV4A 1Q1KA 1XBWA 5DLGA 3NMRA 1NKCA 3MM7A 1APSA 2RF2B 3CVKA 4YEAA 3VAJA 2UU9F 2U1AA 3RRGA 2EVZA 4OZ1A 2XI2A 3PHEA 4RW4A 1RJJA 4DQSA 5B09A 2KJWA 3POTA 3P6YC 1KLNA 1RTIA 2FLNA 3THPA 1R7IA 2ILYA 1AFIA 2DT9A 2FUG9 4KPYA 5M2RA 2FC8A 1N5VA 1HFEL 4HL9A 2NR0A 3V6DB 3TO8A 3IWXA 3BQ0A 3R5DA 2JDJA 1WNEA 5GAHU 2CJQA 2MKJA 5T7LA 2FVRA 3DNCA 4QR1A 2V4JB 5H9FJ 2HS4A 4IOBA 4ES2A 2G9OA 1IKXA 4A8SA 2GFFA 4IFVA 3FQKA 4ZLPA 4ZVFA 4OZLA 2D41A 4R0EA 1IKVA 1GQEA 4L72B 2M5YA 1YITS 4K4UA 1WF2A 3NKYA 4RKUC 4XPCA 1HBNB 2AJ4A 4ZCIA 3TI0A 4CTAB 2R8IA 1UETA 4J9KA 4DV7F 1VHFA 1Q8LA 5EUHA 3J7YU 2WK4A 4ZVGA 1JLBB 3CJKA 4R8UA 4AXJA 1M5OC 4C8ZA 1YHQS 5KFTA 3ZZZA 4YR0A 5EHHA 4C8OA 2HHVA 3PKMA 1FJCA 2AGPA 5DGAA 1VQSA 1DARA 3CIMA 4LUBA 4ECSA 2KRBA 4CH0S 3NWGA 3Q24A 3IWNC 3HHLA 2WW8A 3FFIA 3M8QB 3S6EA 4XK8C 2BRLA 3SDEB 3N6MA 2OD6A 3TA0A 3KLFA 2G4BA 2OSRA 2W24A 4P2SA 4F50A 1S6UA 3GQCA 1P8GA 2RNEA 4NXMF 5F8GA 4DS4A 1FEHA 5KFQA 2VONA 3VF0B 2VQFF 2J6UA 1L3VA 4B3OB 3QO9B 5A0YB 2IAJA 3HVRA 4YOEA 2AF6A 3TOQA 1HQEB 2LEPA 2DNMA 5KFPA 2R2SA 1WG4A 2B7BB 3VTIA 5E3PA 1BQNA 2OPRB 2XMVA 4Q2MA 3OLBA 1GAOA 2O66A 4NRUA 4NMLA 2VV5A 4NLRA 1G2EA 4I6YA 2B4UA 1VQKS 2RRAA 3R27A 4RNFA 3ZZYA 5C25B 2CQBA 4WU2A 2HHQA 3HT3A 4NZ0A 1BY9A 1IKWA 4IQXA 3DCAA 3PEHA 4QWDA 5KFLA 1N5QA 1QAIA 3ZZRA 3BO3A 2WSEC 3VAFA 2FJBB 2P6TA 1B0VA 3EPIA 2P9EA 2YKMA 1YG0A 2RE1A 1N6QB 2MKCA 2HQ3A 3DLBA 3CMAS 2BVZA 3LP1A 5DDRC 3EXYA 2HLUA 2DGTA 4JI2F 2I5JA 2GIQA 1ZETA 2DNZA 1NK0A 3ZZTA 2YX7A 3HP6A 1XWLA 1S77D 1X9MA 2KHDA 3SFGA 3OXFA 4NLWA 3BS9A 4HVZA