2I99A

Crystal structure of human mu_crystallin at 2.6 angstrom
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
312
Chain Sequence
SRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human {micro}-crystallin complexed with NADPH
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Mu-crystallin homolog
total genus 107
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.5.1.25: Thiomorpholine-carboxylate dehydrogenase.
pdb deposition date 2006-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 2i99A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i99A02
2PZJA 3LLSA 1U2GA 4UEKA 1ZZEA 3WBFA 1YGYA 4CPDA 5AXCA 2JL1A 4HFMA 3GUYA 2HMSA 4NU5A 5GMOA 5A9TA 2A9FA 4B4WA 2GSDA 1LRJA 3X2EA 5F21A 3JV7A 3CTMA 3PYLA 1PJBA 3BTSA 1B2LA 4EBFA 1BGVA 2ZTUA 2AQ8A 3AUSA 3E82A 3EMKA 5DF1A 4NBTA 1K3TA 1C0IA 4LVUA 1W4ZA 1FDUA 4R5MA 3VVCA 4BO1A 1LUAA 2IYOA 4WLVA 2QHXA 5HS6A 4BNTA 1OFGA 2NSDA 4ALKA 1Y5RA 2ZB7A 2WMDA 1AGNA 1FF9A 4GL4A 4JNKA 4DPKA 3TQHA 3FNFA 3M2PA 3GC6A 4HFNA 1PS0A 4R5HA 4D44A 2NTVA 4B3JA 1GQQA 3MZ0A 1JLLA 1PQWA 4LVCA 5TT0A 2DBZA 4UUMA 3AI3A 1E6UA 1HF3A 3GN2A 3BHJA 2OBNA 4XEHA 1HDZA 2JFGA 2V65A 3JD0A 3QW2A 5ICMA 1YOVA 4IDGA 3DBHA 1X0VA 3GEMA 4IS3A 1ID1A 1VPDA 2J5RA 5L4LA 1JKJA 3AUTA 3AFMA 1EMDA 1ZK4A 4L0QA 2H63A 1NHWA 3GOHA 3U49A 2PH3A 3HSKA 2RIRA 3O03A 2R00A 3G3EA 3PPIA 1Y9EA 2GZ2A 5DN9A 5IJZA 1QLHA 1OZAA 2C5AA 3Q3CA 1I0ZA 4W7IA 4CLRB 2E6UX 3ZCXA 4HKTA 4WPGA 4XYLA 2ZJ1A 5IAAA 1NVGA 3VDRA 1T2DA 2NV6A 4IDFA 1E3IA 4ZN6A 1P1KA 1BTOA 3AFNA 3DHYA 1PJCA 3RIHA 1NPYA 4TZKA 3CPSA 3HG7A 5ADHA 2XXJA 2B69A 2ZQYA 3JQEA 2FR1A 5A05A 2JFHA 4CQMA 4E5KA 1PWXA 2JCYA 5JBIA 1U4SA 1QYXA 1ZFNA 5CEEA 5A4DA 3RUFA 3QWFA 1V3UA 1BRMA 5G0WA 1W0CA 3GRKA 3U09A 1QYVA 1KOLA 1X0XA 4Z9FA 4D3SA 1KC3A 1DBVO 1RM3A 3F3SA 1YO6A 3GFGA 3BMNA 1DSSG 3OA0A 1Y8RA 4M87A 1HZJA 3ETDA 3QSGA 3PQEA 3U3XA 4MVJP 2UV8A 1J49A 2PD6A 1GZ4A 1U3VA 1RM5A 3AY3A 3ICPA 5TT1A 3ORFA 4Z9YA 5JPIA 1ADGA 1LQUA 1PGQA 1QORA 1EK5A 2WYVA 5DCYA 1IY8A 3GUCA 3JD1A 4M8SA 2HRZA 5DZSA 3PGXA 1QSGA 3AW9A 2C7VA 4JCOA 5A9SB 3EY4A 4RVFA 1UDAA 5COAA 2ZTVA 1MP0A 1R0LA 3FNEA 3RKUA 1GR0A 1Y5MA 1Q7GA 5KJCA 3ITDA 3TFQA 3GDFA 1PL7A 1N5DA 2OP0A 3I5MA 4W9NA 3ANMA 5EQDA 1F06A 1DLJA 4B3IA 4I5FA 5KCZA 3TZCA 4BO7A 4XX0A 3E48A 5CDGA 1CIVA 3EVNA 5FWNA 1LEHA 2YHIB 4AJIA 4CM5A 3HE3A 4E3ZA 1LLQA 3TPCA 2J3IA 1B8VA 1GCUA 1VL0A 2HU2A 2PZKA 4YJFB 3IMFA 4FB5A 2O2YA 1W8DA 4TWRA 4NJMA 2V7PA 4J43A 3ANLA 4Y6RA 4ZA2A 3RUDA 2HRBA 4RCVA 4BGVA 4AL4A 4GKVA 1IHYA 1U4OA 4BO8A 4E5PA 3NV9A 2Z1MA 3BTOA 4DYDA 4IDCA 1P1RA 1E7QA 4IQ0A 3QHAA 1DIRA 2DTDA 4J4HA 5EL0A 4E2ZA 3O9ZA 4IIVA 4LCEA 4CMIB 3VPFA 4AJOA 3WBBA 3W4IA 2PR2A 3RC7A 1LRKA 1R4MA 4XRRA 4UUPA 1XR3A 2E37A 3GVHA 1XDWA 4BO4A 1TA4A 4W4TA 5JW6A 1PJTA 2NVUB 4WK6A 1SPXA 3AWDA 3H3JA 5DOZA 3L4BC 3P5SA 1C3VA 1BSVA 4J9VA 3WGHA 2CD9A 3WIEA 4AFNA 2ZYDA 1LLUA 2DUWA 4UEOA 2RAFA 4P4LA 4R16A 1MB4A 5DT9A 1IZ0A 3VC7A 1PZFA 5C7LO 3KEQA 3I9OA 2CNBA 4FW8A 5I9NA 5L3ZA 3VH1A 1UZLA 3SX2A 3LC1O 3LC7O 3AM4A 2YJZA 4CLOA 2EJWA 4GSKA 3RFXA 3HFSA 3ZHXA 3ZWVA 4YPOA 4Y9DA 2CVQA 4D7AA 3V1TC 5JY1A 2JD2A 2C20A 4A27A 3AUUA 1LQTA 1HYEA 3FBTA 1N8KA 1H9BA 1NVTA 2YHUA 1UP4A 4QX6A 2FRDA 1I3MA 3WGGA 2VYND 1EZ4A 3I6QA 2O3JA 4YVFA 4U5QA 4I5GA 2RH8A 4UUOA 2EWMA 3AOGA 1I3KA 4R9RA 3S2EA 2ZTMA 3ZV3A 4OL9A 3ZWWA 1EUZA 3Q1LA 2FWMX 4QO7A 4WGGA 5KNLA 5HBRA 2OBYA 4BNNA 4Q3EA 5DBIA 3RFVA 3ST7A 3JQAB 1Q0LA 3JQ9C 4HUJA 1XWFA 3I52A 3L4BA 4DGSA 5K0ZA 3OA2A 1A9YA 1NAIA 1N7GA 3OFSA 1GV0A 2C07A 2IXBA 1NX6A 4E2WA 3KSUA 2VYNA 4XWYA 1LNQA 1C0PA 1H94A 1HSZA 4GX1A 1XIVA 2P5YA 2GZ3A 4CODB 4OXNA 4N18A 1X15A 5DCWA 3GGOA 2LDBA 1LTHR 4CMAA 1IZ9A 3S8MA 3D1LA 1I5RA 3G1TA 3GVCA 3H9GA 4F3YA 3OQ1A 2WSBA 5ITWA 4J9UE 2B35A 1M76A 4BNIA 4RQTA 4Z3DA 4ZGWA 4RDHA 4EEXA 3A1NA 1N92A 3FR8A 1BXGA 1EVIA 3GAFA 1H5QA 2GASA 3ON5A 1MUUA 1DJQA 4XQ9A 3DBRA 3IAHA 4J90A 3IKTA 2EXXA 2UUPA 4ZQBA 2ZKLA 3L9XA 3ZWMA 4NFSA 1ZSYA 3PTZA 4PZEA 3K5PA 3LT1A 3UW3A 1IULA 1WPQA 2XAAA 3D3WA 4EYEA 1WMAA 1P31A 3GRPA 4OH1A 3HADA 4ND4A 3DZKA 5IN4A 3QVOA 4EITA 1PR3A 1HDXA 1TT7A 2Q3EA 4JN6B 4DA9A 3MJSA 2AA3A 3FNHA 3PLRA 4DMMA 2DT5A 1HZZA 1A27A 2W98A 3DR3A 4BNKA 2GN4A 1O89A 4NFYA 3U9LA 3JCZA 3NEPX 1I3LA 3FSRA 3I4CA 3R3JA 1U7TA 4RZHA 1Z7BA 4WLUA 1E7SA 1T4BA 4D43A 1YONA 4FSHA 1JVSA 3WGIA 2VWGA 3HHPA 4I9UA 2CDCA 4BNMA 2HJSA 1GEGA 1V6AA 2V6FA 1HYHA 4DIBA 2IZZA 1PS8A 3JYNA 4L73A 4BNHA 3H65A 1QP8A 2TMGA 4I08A 2BI7A 1DLIA 4IJVA 1BVRA 1YQGA 4YJHA 1ZSVA 4BGEA 2O3SA 1WVGA 4LRSB 5F3RA 3EGOA 3WNVA 4EJ0A 1KS9A 1LRLA 2UAGA 4PLCA 5IDQA 1P1FA 5A9RA 2AHRA 4PZDA 4XR4A 3BHMA 2PGDA 4Q3BA 3H4VA 3K8ZA 3WNQA 4EI2A 2YV1A 4YA6A 3H3FA 1HRDA 4NBUA 3BZUA 4RQUA 3LLVA 1DC4A 3HDYA 3GG2A 2ILTA 5IF3A 4E13A 2UDPA 4A26A 1WW8A 3GDGA 3EHEA 3I9JA 3H5RA 1BMDA 1HE3A 2B5WA 4NMHA 1CDOA 3L07A 4ND1A 1BXGB 2EGGA 2QQ5A 5I8ZA 3CIFA 1GTMA 2D1YA 2JAPA 2X0IA 4E30A 4DQXA 5L53A 2X5KO 3GVPA 3DMTC 1PGOA 1PJ2A 5JDIC 1F8FA 4IZIA 3OJEA 2ZTLA 1MXFA 3FTPA 3PFFA 3SC4A 4DVJA 1F0YA 5JC1A 1P3DA 3AY7A 3LYLA 3D3WB 2BELA 2D5AA 4ZQGA 3UCXA 1I32A 3KZVA 3JQ9A 3HB4X 3WLEA 1SCUA 3KVOA 1R4NA 4QFDA 4E4YA 5L4SA 1GZ3A 2O48X 2OZPA 5T8KA 2Z5LA 1KIFA 2JHGA 4Z9XA 1AXEA 5L51A 4I5DA 5ES3A 3I83A 5GZ3A 1WLYA 2D59A 2GGSA 3KBOA 5GY7A 3GZ4A 2PGLA 5FI3A 4BKRA 2R2GA 1C1DA 1QMGA 4BVAA 3D3EA 1KVRA 5L95A 5G2OA 4RO0A 5A5EA 1LLDA 2BI8A 5JE8A 3T4XA 1Q7BA 4MKZA 4ND5A 2I66A 5T57A 5CG2A 1K6XA 3VPXA 1ZJZA 1GQ2A 1R6DA 2QRLA 3TNLA 4HNHA 4DLLA 3QWBA 3CMMA 3OM9A 4BKOA 4KTTE 5G4KA 1E7MA 5L40A 2OHXA 4YJHB 1C1XB 2UUOA 4A5OA 4CV0A 5L45A 3MJCA 1YVEI 1BG6A 1I10A 3AK4A 2NVUA 3KTDA 4QECA 3ZV4A 4O0LA 3PHJA 4I9HA 4UAGA 2C5EA 4DREA 1GY8A 2NACA 3D4NA 3VZRA 4L76A 3WFIA 3DZFA 4MIOA 1YKFA 3HWRA 4HX5A 1E3SA 1U1IA 3G0OA 1GYPA 4MOWA 4Q3AA 5IN5A 3VH3A 3W4KA 3W8EA 1ADFA 1E3JA 5JC8A 2BGLA 1R37A 3FNGA 4PRKA 3UH1A 4CJXA 3GY0A 3TOXA 5GZ1A 5DDIP 4BUCA 1JQBA 2G76A 3GT0A 5CEJA 4Y6SA 4KDEA 3EW7A 3RAJA 4D42A 5JYDA 4YT4A 2P4HX 4FOSA 1OC2A 4O59O 3PJFA 1WDKA 4P4GA 5JMPA 3DBLB 3WQRA 1AUPA 4AJKA 1ONPA 1Y81A 1ORRA 3H9JA 2EJVA 1ZMOA 2HSDA 5F5LA 3DMYA 2Y0DA 3S2FA 3D4OA 3MOIA 4ROSA 4CLDA 2P4QA 1A4IA 3BTUA 1LSUA 3U4DA 1CWUA 3VKUA 1HDCA 4L74A 3G79A 4LSWA 3FF4A 3PP8A 2Q99A 4YAGA 1MX3A 3BMNB 1X7GA 3ZHYA 3PI7A 1U8FO 5JLAA 4Z6KA 4Z0HO 3F46A 2ZB3A 1PL6A 3BMQB 3ZNPA 4L9RA 1SEVA 3JSAA 3KEOA 2CY0A 2CZCA 3KHUA 5KTKA 4PGFA 3W1VA 3ENKA 3N58A 4BNUA 4BO5A 1CYDA 1YBVA 4Q9NA 5C7IO 2ZYAA 3VZSA 3DFUA 2VRCD 1WXDA 1K6IA 2PD3A 3C7DB 5H83A 1K6JA 1XG5A 2I3GA 1LXCA 3C8MA 4CR6A 5C37A 3JQAD 4BNXA 3ZHZA 1LDMA 3UHAA 4JBGA 2GD1O 1VL8A 1Z6ZA 3V2HA 3A06A 4S3MA 4FJ1A 2O7QA 2HMWA 1QV7A 3HDJA 4CMJA 2I65A 1XLTA 3I6IA 2DC1A 2NM0A 4DBZA 3GPIA 3IOYA 4M55A 1KVUA 1TT5A 3D4PA 3WYEA 4ALMA 3AM5A 1ZH8A 1X14A 2OMEA 5CDSA 4R3NA 2EKPA 3FN4A 4QFCA 7MDHA 2O2SA 3IS3A 1NAHA 5F1OA 4ESOA 3DOOA 4B7XA 1SO8A 1GYRA 1Z7EA 3EC7A 2X9GA 1XU7A 3ONEA 5AXDA 4GMGA 1MA0A 4MVJA 1DAOA 2IZ1A 1E0DA 4J2HA 4MIYA 3GVXA 4B7UA 4PVDA 2VTDA 1Q2XA 2GYYA 2C0CA 4I1IA 1H6CA 3H5NA 4KUGA 1H2BA 3DDNA 2OOSA 4D0SA 3ASUA 1U7HA 1L7EA 1G6KA 3LC2O 3OP4A 4AJLA 2I3AA 1U2DA 3OJOA 1Y8RB 4UVIA 1B7GO 3UKOA 3WGZA 4AJ1A 5HS4A 5L4NA 2WDZA 2WTBA 1B15A 2YV3A 1DC3A 5ENVA 4AVYA 3R6DA 4GVXA 2TMDA 2J6IA 1J5PA 1E1NA 4OGWA 1ZUD1 4YT8A 5TGDA 4IBOA 3E5RA 4H15A 3DZJA 4Y98A 4BL5A 3GFBA 1G0OA 1NNUA 2JD0A 1NR1A 2FHSA 3QVXA 4GLOA 3KYDB 2HAEA 1FDTA 4GWGA 2BH9A 3ZWYA 2P5UA 2Q1SA 2J3HA 4ZD6A 2Y1FA 2Q1WA 3IIEA 5B37A 1BVUA 1FDVA 4CM8A 4XGNA 3ROMA 4BO3A 3IP1A 1UP6A 1JAXA 3Q2KA 4IMRA 2C7GA 4WCFA 2E82A 4GGOA 1ZK0A 1IL0A 1I3NA 1GYQA 1B0AA 4I9NA 4OM8A 4KMSA 3C3XA 5DNAA 2VOJA 4NI5A 4CM3A 2NUAA 5C3MA 1ZK1A 4W82A 4ALJA 3GNTA 1I33A 1O0SA 1HXHA 4LGVA 5I7FA 5KJFA 3RBXA 4UVEA 4JIGA 1H9AA 1O6ZA 1LLCA 1Q1NA 2CFCA 3GPDG 4B79A 4CMGA 3TFOA 4WNIA 3ZI0A 4WEOA 5TLSA 3CH6A 3NDIA 3B1FA 2IDZA 2ZCUA 4MVJH 1LI4A 4W7HA 1A4UA 1LSSA 1WAMA 1LX6A 1K2WA 2PY6A 2VYVA 1Z74A 1U3TA 4R51A 3TN7A 3GG9A 4YRDA 1EUCA 1FMCA 1BXKA 4QEDA 1VKOA 3ZWPA 4YQZA 3RUHA 3JQFC 2EP5A 1XELA 2OORA 5HRUA 2D3TA 2VT3A 1P74A 1XGKA 3RKRA 5JO9A 4E5NA 2F1KA 4TZTA 4XYEA 4CM9D 3LZ6A 3CZMA 4MVJD 4XA8A 5B4VA 2PK3A 4YWJA 1EQUA 4XCVA 1X1TA 1NASA 3TRIA 2HMVA 3PDUA 2XOXA 3QVWA 4ZJUA 1NFRA 2VHVA 1B26A 4URFA 1XA0A 2I6TA 2AMFA 4CUJA 5A1TA 5CDTA 1I01A 3OICA 2CF5A 1Q0QA 3A9WA 3OBBA 3A28A 1DAPA 3OQ6A 4OOFA 3TZ6A 3EZYA 5U1PA 2YFHA 3W4JA 1XCBA 4Q3NA 3DZIA 1E7RA 3HN2A 3OEWA 1NQ5A 3RUEA 1XEAA 2G5CA 3NJ4A 4AJ2A 3VDQA 4FN4A 4CUKA 3LQFA 1MC5A 1NHGA 2CSUA 3LSYA 4FFNA 3AU9A 1A7KA 4OJNA 4BNGA 2P9CA 1CJCA 1HLDA 2G1UA 1NBOA 2JCXA 4XYMA 4N5MA 1J0XO 4IZHA 1A5ZA 4XYBA 5IDWA 1F12A 2A35A 3ICCA 5EESA 2E48A 3B1JA 4R54A 4BO2A 1SNYA 3PWSA 4IJWA 4N5LA 2Y68A 2X0JA 2G82A 3DEYX 2EGHA 4Q39A 2VNSA 4BO9A 4BB6A 3ANNA 3DQPA 4INAA 4B8WA 4DLAA 1NQOA 1ULUA 3DBHB 3OIGA 1NYTA 2B4RO 2EW2A 3I9LA 3M6IA 3TZKA 4P4NA 3RFTA 2HQ1A 3I1JA 4WCDA 1GV1A 3SVTA 3MEQA 4DPLA 1NTOA 5I8WA 3RBVA 2EV9A 1WDMA 1B8UA 3BMOB 4AG3A 3U5TA 8ADHA 4PLZA 1L7DA 3PRJA 3ZV5A 1CERA 4RPKA 4WLEA 3MJ4A 4DTIA 3NTRA 4TRMA 2AE1A 1H2HA 3VZQA 1ADCA 3QLJA 2Q1TA 2BFPA 5KVSA 4YB8A 2PKRA 4FFMA 1I2CA 5B4TA 3F47A 3QVTA 4FIZA 4CM4A 4TMFA 2VHWA 3STHA 3OF2A 1ISGA 1DDOA 4TKLA 5IXYA 4MO2A 4CQMB 4XR9A 2YV2A 3NGXA 4RGBA 2GR9A 1T2FA 2EEZA 1FK8A 3S55A 3ZU4A 2VCYA 3RJ5A 5BSEA 3WTBA 4BKUA 2O3RA 5HWSA 1U9JA 4M54A 5DP1A 1WDLA 3F6YA 5MDHA 2EHDA 4C7JA 4GGPA 4EW6A 2WWRA 1CEQA 4MVJF 3Q6IA 3DBLA 1BWSA 1Z75A 5AOVA 4J1NA 3VVBA 3KUXA 2AG5A 4MIEA 2Y1OA 3TOZA 4DPMA 1MC4A 4YJGA 4YT5A 4HBGA 3ZNQA 2AXQA 3U4HA 4UVGA 3R3SA 4BNFA 2NQTA 5KIAA 1SBYA 3I23A 5ENDA 2OUIA 2YQ4A 2XXBA 5A3VA 3BXXA 3ONFA 1ULSA 3KV3O 1NQTA 4W6ZA 1YXMA 2RH4A 1V8BA 1WZEA 3ZWNA 4YT2A 8LDHA 1KEVA 4YJDA 1UZMA 3RQSA 1E1KA 4GKBA 2D0IA 2GO1A 1T4DA 1Y6JA 1E3WB 1VC2A 1LBEA 1RJWA 3K31A 1ISHA 4F45A 4MP8A 3JQ8B 1T25A 5JFOA 4RPJA 4CL8A 2JKVA 1PGJA 4NBRA 1QV6A 4EEZA 3DOJA 2FP4A 3HZZA 4CLEA 3NGLA 3B70A 1O94A 1E7YA 2IRWA 1R66A 2WD8A 3MCVA 3GZNA 3W6UA 4O63O 1DIBA 3HDHA 5JAIA 3RD5A 3RUIA 3F1KA 1N1GA 4P22A 4WLFA 4XQGA 1P1JA 3C7AA 3VAZA 1LU9A 4EUFA 4U0KA 1KEWA 5F1KA 3AM3A 3HB5X 2CDAA 4RVGA 1P1HA 4FC7A 1PJSA 3ZHBA 2Y66A 3DMTA 3DOCA 2BFOA 3GNSA 4XZ3A 4RPHA 1ISIA 2J3JA 4WCFC 3SC6A 2VZ0A 3W6ZA 1GEEA 1PX0A 2CMDA 3I9KA 2FSSA 3NX4A 3ROPA 2ZB4A 3B6ZA 1T1SA 2PZMA 1QG6A 4IDEA 2BKAA 1VKNA 3DB2A 4IDAA 3AUAA 2DU8A 1YE3A 1IHXA 2Y1GA 4NJMB 3UFXA 4BMNA 5CG1A 2DM6A 3JQGA 2DQ4A 4WOJA 3RI3A 2VZ8A 1T2EA 3PDJA 4OKIA 4BB5A 4EJ6A 5JCXA 1RPNA 1KEPA 3VPSA 2JJYA 3E18A 3SJ7A 1RKXA 2FR0A 3K2BA 3KLPX 3CUKA 4QTZA 3TJRA 3D64A 4R3WA 1CRWG 4RVDA 1PU2A 3K2EA 5COQA 3V8BA 4QSMA 4OQZA 3WTCA 3GEGA 4ZQFA 3M1AA 3TZHA 4OHUA 5JDCA 2POQX 3BMCA 4CUZA 3GQVA 4CQLB 1PTJA 5HM8A 4MP3A 1PL8A 3E5MA 4U6SA 5ICSA 1ZJYA 2C54A 3WWZA 3VPHA 5G4KB 3U62A 4E0BA 2UVDA 2AEMA 3JTMA 3WYBA 5EN4A 1GCOA 3OMLA 4OKNA 1TI7A 2V6BA 1AE1A 4FD3A 3DZBA 3F5SA 1NM5A 1V3VA 5T67A 3UVEA 2HDHA 3JQ8A 5TSDA 4CM1A 2W90A 5TS3A 4R1TA 1JA9A 2GN6A 3LF2A 3MJTA 5A06A 3FI9A 5TC4A 1YB4A 2QRKA 1ONNA 1C14A 4BV9A 3WICA 1KC1A 3O8QB 1PWZA 2YW9A 4OMUA 3QY9A 4J1QA 1DC5A 3GMDA 3H9EO 1I36A 3UOGA 2PD4A 5B12A 4K26A 3IUSA 4W99A 3RC9A 3DC2A 2DBQA 5FYDA 1VM6A 3PK0A 5I7VA 4R9SA 4JJFA 5ITVA 3DBVO 5EIOA 2IE0A 4DYVA 3HJAA 3ADOA 3E6AA 4PLVA 2O4CA 2RCYA 1X13A 2Q1UA 3EDMA 3Q9NA 1V0JA 3UCFA 3RROA 3DTYA 3PHLA 2F00A 2Q49A 5F1PA 1GPDG 4NIMA 1YQDA 1YWGO 4IQGA 5H82A 1U28A 2IODA 3KO8A 1MGOA 1GAEO 3HN7A 4P38A 1IUKA 4N54A 3FBGA 2PNFA 3CMCO 5JXWA 4BGUA 1D1SA 2H9IA 5K9ZA 4E5YA 4RPGA 2G0TA 1ZKMA 4YCAA 3WGQA 3L4SO 3PWKA 5EERA 5KVQA 4AJJA 4CR7A 4X54A 5G0VA 2ZQZA 5CPFA 3GH3A 1DB3A 1U3UA 3HFGA 4IGFA 4MJLA 1B3BA 1MFPA 1XSEA 5B4UA 3INTA 4R69A 2O23A 3ZV6A 4YBZA 3F4LA 4ILKA 4B3HA 5G4LA 1LJ8A 2CVOA 3LF1A 3PWZA 9LDTA 1EK6A 1B14A 3GNQA 4WJZA 2DTEA 2CDBA 1YH3A 3M2TA 1ISMA 4U6QA 4PG8A 5CAEA 2YDYA 3EZLA 4ZHSA 1JVBA 4FPXA 2IYPA 3WB9A 2WE8A 3INRA 4BNWA 5L7YA 1Q7CA 3IP3A 2X8LA 5CPBA 1C1XA 2PH5A 5C5IA 1QYWA 3F4BA 2BFAA 3NJ8A 2Q2VA 3GDOA 5K6AA 1E5QA 1FDWA 1OAAA 2I9PA 2P9GA 1J4AA 4WOKA 4BNZA 4O1MA 1ZXBA 1XHLA 3OJLA 3H6KA 3WGOA 3CINA 1QYDA 4ZU3A 3C1TA 5ILGA 1JWBB 4RVSA 2GUGA 1JWAB 2VN8A 5ER9A 2IZ0A 2WD7A 2DTXA 2GCGA 4N5NA 4B4OA 5DP2A 4CM4B 3WGYA 2B5VA 4D46A 3HDQA 5IDYA 1GUZA 4II3A 5CDYA 3GHYA 1S7CA 4NU6A 4FGWA 1ZO8A 3DZHA 4XB1A 4YACA 1E7WA 3K9QO 2P91A 2WJPA 3KYCB 1D7OA 2QYTA 3SLKA 4F46A 2AW5A 4YRBA 3V2UA 1P0FA 1ISJA 3SBOA 1TVEA 4BO0A 4ITUA 4CM9A 4BS9A 3D7LA 5JCJD 5G0UA 4LK3A 4YQYA 1BHSA 2NVBA 3QVSA 1JKIA 1E92A 1N9GB 3NTQA 4JROA 5A5FA 4A7PA 4RPLA 4RVHA 4B7CA 3SLGA 2Y1CA 2Q4EA 3C85A 3RU9A 1OOEA 4AJ4A 3V2GA 4BQPA 3JD2A 3PXXA 2ZK7A 4WE3A 1E6WA 3ZWOA 2QRJA 4CM6A 4YDRA 1DRWA 5JAMA 5MGBA 3PIDA 3PJEA 5A3JA 1VE9A 1MFZA 4B4UA 2EP7A 4PG4A 4UULA 1N7HA 1KVSA 1O95A 3NRCA 2QYSA 5FFFA 2GDZA 1E3LA 4RORA 3RC1A 3UF0A 1VJ0A 4DUPA 3Q11A 3OIDA 1SAYA 5TX7A 1T1RA 5KJEA 1R4MB 2Z1NA 2O7SA 2B4QA 4TSKA 4P8RA 4D41A 4E2XA 1E6EA 5L9AA 5BSHA 2BGMA 1OMOA 1R15A 2EW8A 4PVCA 3WOHA 2VUSA 4CV2A 3E03A 1NQAO 1UR5A 2X23A 3PFWO 4IMPA 4AJPA 4CLXA 3CE6A 5FEUA 3ZWCA 5JSFA 2O4UX 4MKXA 2VTEA 3BYZA 1DEHA 4LISA 5A03A 4JJGA 4RDIA 4D3DA 2NLOA 4RZIA 1DC6A 4FS3A 1YJ8A 2J5QA 2PKQP 2PV7A 2C82A 2Y0CA 5CP8A 3VHRA 4DQUA 1DIAA 4C4OA 2O3UA 1K89A 1N9GA 1O9BA 4NDNE 1GD1O 3VH2A 4JGBA 3ZWBA 5CEFA 1EE9A 1JAYA 1C0KA 4CR8A 4PLPA 1HWYA 3JYLA 3AU8A 2JD1A 4II2A 2Y1EA 3PHIA 4IINA 3NUGA 3WSVA 3V1YA 2B36A 2E49A 3G17A 3RUCA 1PIWA 1ZBQA 1YRLA 1JTVA 5EPOA 3TDKA 5IZCC 1XYGA 3PHGA 2H5LA 1PJQA 2C2YA 4QQRA 1BDBA 1DOHA 1HE2A 3EAGA 4CQLA 3DTTA 4IJUA 2VHYA 1EVYA 1I30A 4Z0PA 1DFGA 1ZEMA 4FCCA 3UN1A 4PN3A 1A71A 1O8CA 1YL5A 3WLFA 3VKVA 4YXFA 1LDYA 2Y0EA 3CZRA 3ZWXA 2E4AA 3K96A 1SOWA 4A0SA 4KQWA 2B0JA 4BNYA 4GX0A 4M49A 4CLHA 3WSWA 2GF2A 5F5NA 5U4QA 2NU9A 2I5PO 2IXAA 2W4QA 3PQFA 1HDGO 2FPGA 3X2FA 3JYPA 4E32A 4ZQEA 3I3OA 1KVQA 3VOSA 2BD0A 4A73A 1PZGA 1YL6A 4MINA 5BNTA 3DONA 3RSHA 4ONEA 4MPDA 3VTZA 3IJRA 3PVZA 3DXFA 2C59A 3UAGA 3JQBC 4WEQA 1A7AA 4PLWA 1DRUA 3LT2A 2G17A 1F17A 4OSOA 1RYDA 4O6VA 4ND2A 4DBVO 4JJIA 5CDUA 1BW9A 1VLLA 1EVZA 1N2SA 1J6UA 4WECA 4BHTA 1ZK3A 4RLHA 2DAPA 2H6EA 2YFQA 1M6WA 2WYUA 4A10A 3VTFA 5AXAA 1ENOA 1ENYA 4PLTA 4BMSA 4BV8A 1EBUA 1NVMB 3AI1A 2Y1DA 1FJHA 1DIGA 2X9NA 3EYWA 3OECA 4HADA 4IDDA 3V5NA 4DWVA 3KRTA 1WZIA 1HKUA 1ADBA 3AOEC 4CV1A 2AEJA 2SCUA 2ZCVA 5IZ4A 5FF9A 1AHIA 4O5OA 4DXHA 4TROA 3GEDA 4R01A 1GADO 2BRUA 2HJRA 4GVLA 3H2ZA 4E31A 3JYQA 3QE3A 4XQCA 1NR7A 4KUHA 3GGPA 5DULA 3O38A 1O5IA 4R1NA 3GHHA 1HDOA 1BDMA 1LSJA 1LC0A 3ETEA 4IIUA 4BNVA 2D8AA 1JKFA 4J6FA 4KTVE 3BTVA 3N7UA 3JYOA 1E1MA 3FPCA 2NU8A 3GZNB 4J16A 1R4NB 2GLXA 3K73O 2BMAA 5T6BA 1JU9A 2Q2WA 4B8ZA 4ZRNA 2XF8A 1R0KA 3OSUA 4YAKA 1SZJG 1P0CA 4D3FA 3FWZA 1E1LA 1NFQA 4PLFA 4RJTA 1HEUA 3O26A 1DFIA 2VT2A 4NJOA 3QJ5A 4UREA 3OH8A 5KVVA 3FHLA 2QZZA 2W8ZA 3PLNA 4CMKA 4K6CA 4FJ0A 1SB8A 2W2LA 3DAPA 4KZPA 4BKQA 1DJNA 5J23A 3U0BA 1PZEA 4MVJM 1KVTA 3HQ4O 4M1QA 1OC4A 3GF4A 3OQBA 3ZDFA 4DIFA 1LDEA 1ZSNA 2VOEA 3UCEA 4J4BA 2VUTA 2Q4BA 2X6TA 3TWOA 3C1AA 3ZN2A 4M89A 3ROKA 3WFJA 3PJDA 3Q9UA 5G0SA 3I9MA 3WX0A 1DPGA 1KEUA 2D2IA 4PG5A 1PGPA 3MWEB 3TL3A 3C7CB 3QA9A 2XPCA 2WD7B 4NFHA 3PZRA 1UDCA 2YUTA 5B1YA 2BLLA 1IPEA 4OOEA 2ZYGA 4GMFA 4AJEA 4IXTA 3UGKA 3D5QA 4UEJA 2A4KA 2EIHA 4MVJI 1H6BA 4WCFB 5KKCA 2PWZA 5DBFA 3WDSA 1EQ2A 4XJSA 3NDJA 1RM0A 2VWPA 2X0NA 1CF2O 2QG4A 4GAEA 4HWKA 4CV3A 4KOAA 4A2CA 2NQ8A 3JQFA 1PZHA 3T4EA 2RBEA 2VRCA 5A02A 3MOGA 5EJ2A 1Q0HA 2D4AA 3GAZA 1MV8A 5T5QA 1TXGA 4FFOA 4TKMA 4RV9A 1WP4A 2J8ZA 4RF5A 3OETA 3MTGA 1E3WA 3O8QA 1V3TA 2UYYA 1NXQA 1I2BA 1VL6A 1YBMA 4MVJE 2OXIA 1EUDA 4FFPA 1M67A 5EQFA 4L75A 3WMWA 4K28A 2Q2QA 3L0DA 2GN9A 3QIVA 3IJPA 2OGUA 5TRTA 4U0JA 3H7AA 4XB2A 1YDWA 1VJTA 1NPTO 4E21A 2PTGA 3NKLA 4IPTA 2I76A 3G1UA 4HXYA 1NWCA 3P2YA 2HK7A 2HK8A 5THKA 4U7WA 4AICA 1M6HA 1PQUA 4Q3CA 4JXKA 4RF4A 3WYCA 1GFSA 5I7EA 3D5TA 3RU7A 3DFZA 2I99A 1W73A 1VI2A 4XIJA 5BR7A 3FR7A 9LDBA 1PR9A 2P9EA 6ADHA 1HLPA 5JAQA 4D0RA 2Z95A 4EJMA 1JW9B 3AY6A 3DAFA 2FSVA 4G65A 3CXRA 3SEFA 3A4VA 3IQDB 1OI7A 1ENZA 3QWAA 4DL9A 1PJ3A 3NDRA 4ZVVA 3DHNA 2JHFA 4HV4A 1IE3A 3QWIA 3AOEA 1JDJA 1I2ZA 2Y67A 3TL2A 2AQHA 2YZ7A 1FDSA 2Q45A 3WQQA 3PQDA 1E3EA 2HUNA 4CQMD 1UXKA 2QZ9A 3KB6A 5ER6A 4PRLA 4KWHA 3BMQA 4R1SA 3ZZNA 1XU9A 4OXKA 5U9CA 1IPFA 4YAJA 3KSZO 1KETA 2EKQA 5IDXA 1ISFA 3DHEA 4R68A 1IOLA 2IEDA 2A92A 2GN8A 3TF5A 1V35A 2WEKA 4KQXA 4NHEA 2O3QA 4TVBA 3BIOA 2YHIA 1HE5A 4N7RA 5BT9A 1SEPA 4ND3A 4LSMA 5BSGA 4K1LA 4R41A 4OYRA 1YL7A 3EVTA 3ETGA 5TJ9A 4GQAA 3MWDB 4YR9A 3QRWA 4BOYA 2PA3A 1SB9A 1TT5B 2DFVA 2HCTA 4CL3A 4PLGA 2NWQA 1B8PA 2NVWA 4BNLA 3ZW8A 4H3VA 1X7DA 1HDRA 1TLTA 1UAGA 3RJ9A 4PLYA 2AEFA 1ZIDA 2NU7A 1G0NA 4Q3DA 4TRNA 3GR6A 4FFLA 4DC0A 3N74A 3UUWA 4DC1A 4IDBA 1KYQA 2BFMA 5T8KC 1LC3A 1ARZA 3WGTA 4LMRA 4D79A 3P19A 4GH5A 1TB4A 5L7TA 4J91A 3OEYA 1YOVB 2VQ3A 5ILOA 1VSUA 4JK3A 1VJ1A 1UZNA 4OO3A 2X9VA 5DCUA 1ZVMA 1D4FA 3OJ0A 4UVHA 4K6FA 2AG8A 4CMEA 4E5MA 5BNFA 4NH4A 2GNAA 3W8FA 1CQJA 3R0IA 4ALIA 1EEHA 2VHZA 3DWFA 4LW8A 5HA5A 1PJLA 4YYZA 3GVIA 3LDHA 4J4TA 1K0UA 1YB5A 3KSDO 1MG0A 2JAHA 3DO5A 4LCJA 2W2KA 4HFJA 5AYVA 1D3AA 5KKAA 2EKLA 2OO5A 3PIIA 4L8VA 1DFHA 4F6LA 4Z3KA 2C2XA 1LDNA 1MG5A 5L7WA 4MDHA 2X5JO 1MLDA 3RWBA 1CQIA 3H9QA 4WKGA 4J2OA 4YEDA 3WQSB 3JQBA 1SC6A 1U8XX 2V6GA 5KJ1A 4TRRA 3IUPA 3ZWAA 2B4TO 3AJRA 1GZ6A 1MXHA 2DLDA 3IC5A 1ZNQO 1LDGA 1KBZA 5JCJA 3UXYA 4FDAA 4B4VA 2LDXA 1P33A 2R6JA 3KYCA 5DOVA 3F9IA 3RBZA 1UP7A 4I8XA 1NFFA 2RHRA 1T2CA 6LDHA 1QXSA 1D8AA 2PKQO 2GERA 4GX2A 4A03A 4CM7A 3WMXA 4J49A 4PG6A 1UH5A 4BO6A 5LDHA 4KWIA 4NZ9A 4R4JA 4CM8B 5A04A 4JLWA 1R12A 1VRWA 2NNLD 1YJQA 2OFPA 5LC1A 5AQ1A 4DLBA 3RVDA 3QP9A 1X7HA 4DIOA 3PGJA 3JQ7A 1Z45A 4IJKA 4ALNA 2VUUA 3BA1A 5COBA 5JO0A 4NBVA 1UJMA 1QKIA 1T24A 2NU6A 2VYVD 1WWKA 3FRJA 1DXYA 4JBHA 4Z0TA 1E77A 1EE2A 2PGJA 2QX7A 3L6EA 4D45A 2GZ1A 2QIOA 1KY5A 3CKYA 1LDBA 1Y8QB 4WNCA 3P7MA 3Q0EA 2FPIA 2NADA 3F1LA 1P1IA 4G81A 4J1TA 3RUAA 5IG2A 3ITKA 1DRVA 1GDHA 1EDOA 4GWKA 3OJFA 2AQKA 2HK9A 2RHCA 3JQDA 3SXPA 4EUEA 3FD8A 2GPTA 3BMOA 3IDSA 3LVFO 4BIIA 4YAEA 2W2KB 5I9MA 1EFLA 2FMUA 4GI2A 1JN0A 1M75A 5KWEA 1PS9A 1ZK2A 3WXBA 1EVJA 2ET6A 4HY3A 3JQCA 3DL2A 3BHIA 1HT0A 3O4RA 4XGKA 5IZCA 1Y9AA 1GQYA 5JY6A 3C1OA 3ZNOA 1F14A 4BNJA 5KJ6A 5I9LA 1R0SA 4Y8VA 4NK4A 2X4GA 3NT2A 3WIDA 2C29D 2V6MA 2FN7A 4BKPA 3H8VA 3B1KA 4CMCA 3LU1A 2YYYA 3R1IA 2BF7A 1A72A 1G1AA 4XKJA 3AI2A 1ZEJA 4CMHA 1C0LA 1Y8QA 2FPPA 4XJTA 2B37A 4J7UA 3WG9A 2J3KA 4W9NC 4JQCA 4YRAA 4GSLA 1Y1PA 2ZJ0A 1PQPA 7ADHA 2ZIZA 4E33A 3L6DA 2YQ5A 1RM4A 4H16A 5LDGA 4FJ2A 4GBJA 4CMEC 2WE7A 1P45A 2D5CA 3JQ7B 4C7KA 4E6PA 2ZB8A 1CETA 3NTOA 3ENNA 3FCOA 1UXHA 4J7CA 5CFZA 3W8DA 1PJ4A 3IKVA 1TEHA 1YQXA 4J1SA 4L4RA 3T7CA 5TJHA 5TQVA 4CMIA 5KVCA 2AQIA 2X0RA 1NP3A 1P77A 1UAYA 1DO8A 5AXBA 1LA2A 1UXJA 4H7PA 4XD2A 3INGA 3NT5A 3IL2A 4NG5A 4JBIA 4ZICA 1M2WA 5T64A 1R16A 5HTOA 1GU7A 1FXSA 2HLPA 2PZLA 1D1TA 3PZBA 2DUUA 4ZRMA 3ZU3A 1XQ1A 5BNIA 3V1UA 3F5QA 3HUDA 4BQRA 3S1LA 2X22A 4F6CA 5JMWA 2DBRA 3WS7A 1U5AA 1GUFA 3NT4A 2HKIA 2VWHA 4NNJA 1QR6A 3GA0A 2AE2A 4XYGA 2B83A 1VSVA 4FQ8A 1DHRA 1UXIA 4MP6A 4MKRA 1YDEA 3ABIA 3FPLA 4G2NA 3JQAA 1EDZA 2OP1A 2FY8A 4NPCA 1YS4A 2EERA 1U3WA 4RF2A 4QT0A 3DZGA 3EK2A 3MJVA 3OIFA 4YJGB 1H6DA 3ZH2A 1IYZA 4PCVA 4DMLA 2PLAA 3DAGA 3LK7A 3U4IA 4WASA 1PSDA 5C7OO 4ID9A 4PFJA 1ENPA 3GK3A 3E9NA 1SOVA 3D0OA 4OIMA 4L4SA 3QV1A 4KUEA 4PLHA 2P2SA 4CLRA 5CHEA 2OL4A 1L1FA 2BGKA 5TNXA 3B20A 4FC6A 3L9WA 3KLMX 3ZW9A 2CF6A 5BQFA 3E8XA 4FR5A 3BAZA 4WUVA 4KP7A 5TIIA 3LT0A 3E9MA 3MTJA 3PJGA 4FOOA 4RF3A 1C1DB 1WMBA 4GPD1 1ZMTA 4JP3A 4PZCA 4NBWA 1KERA 4CLOB 4OXYA 4IS2A 4IQ8A 4JX8A 5KOIA 1YBAA 2WYWA 3JQGB 3I9NA 4QXMA 4U8GA 3JD3A 3ZNNA 3GN1A 2YY7A 4FGSA 1PGNA 3PYMA 4ZQHA 3TZQA 5LCXA 3M1LA 2ZATA 3S2GA 1QRRA 4UVDA 4PIVA 1HYGA 2O3TA 3L6OO 5IXSA 1HTBA 3ZU2A 4JP2A 1H0KA 4TRJA 1WNTA 2VNAA 4HFRA 1T2AA 4K9DA 5JS6A 1AN9A 4RVUA 3QQPA 4LRTB 3BMCB 4RL6A 3ZU5A 4NQZA 3TSCA 4HNGA 3RCBA 3KETA 2Y99A 4J3FA 2A94A 1A9ZA 1EFKA 2FZEA 1KY4A 1SMKA 4TQGA 4IM7A 2FZWA 1ZW1A 4FBGA 1I8TA 3ONDA 1X1EA 3VPGA 2X58A 4Y67A 5A9SA 2X5OA 5TF4A 1B16A 2DFDA 2X1HA 5EINA 2JFFA 1M66A 2VHXA 3K6JA 4OAQA 5FI5A 4IUYA 3GLQA 1NPDA 2HMTA 5H81A 1Z82A 2Y93A 4TVOA 1UUFA 1S6YA 2WM3A 2VRBA 2EG9A 3H2SA 5EMHA 1DIHA 4XRGA 3NAQA 1P44A 4NR0A 2VZ9A 3PYXA 4NK5A 1I24A 2CVZA 3EUWA 3FTNA 1OBFO 1GUYA 3KYBA 3CSDA 3PHHA 1ONOA 1PEDA 1RWBA 2HMUA 3E1KA 1P9LA 2DBVO 4FFRA 3G49A 4L4XA 3Q2IA 4UUNA 4YJFA 1N1EA 2VWQA 1ML3A 3DBRB 1QLJA 3VZPA 3FWNA 4J7XA 5JDIA 3MJEA 5AVOA 2DKNA 1AXGA 4ALLA 3T7EA 1Y7TA 4S1VA 2X7HA 2Q46A 2GRAA 2DVMA 3C24A 1HETA 4KDFA 3ROQA 3WR5A 4CMBA 1DHTA 3P2OA 1B3RA 4XGIA 1W6UA 2X86A 1U5CA 4XIYA 5JNLA 3KXDA 4J0EA 4AJNA 3I4FA 3E9QA 4RLSA 3NYWA 2FR8A 2YDXA 4IXWA 4MVJG 1AHHA 1V9LA 2R00C 4YTEA 3RASA 4AJHA 2Q50A 4E2YA 5IFLA 3H9UA 3ADPA 5DBGA 2NTNA 3K92A 5BSFA 2DPGA 2PFGA 2IEBA 3ULKA 2HO5A 4GX5A 5G0TA 4I5EA 4DQVA 1XQ6A 1QYCA 4WLOA 3SJUA 2DPHA 4R1UA 3K30A 4Y6PA 1H93A 4E12A 5THQA 4YAIA 2H1SA 3GMSA 2I67A 1T26A 1GPJA 4WLNA 4M86A 3KM0A 2JCVA 5I7SA 4EDFA 1IB6A 4EGFA 2O50A 3JD4A 3VH4A 4OSPA 2NTJA 1Z73A 3COSA 3S2IA 3H5AA 2Y05A 1HDYA 4LN1A 5JYEA 4OQYA 4DRYA 3ZGYA 4QO8A 3HNPA 4XDYA 3RC2A 1UDBA 3U4CA 3KOUA 3L77A 1HSOA 1RYEA 1UXGA 1H6AA 3A14A 3GGGA 2W2LD 3CEAA 3QWHA 3UICA 1HL3A 3WWYA 2QW8A 4XDZA 4HP8A 1EBFA 3JQ6A 4GLLA 2FOIA 1BXZA 4EZBA 3WJ7A 1YB1A 4LMPA 2P68A 3KYDA 4BGIA 1BW9B 1HE4A 4G5HA 2BHLA 1F8GA 5GZ6A 3PEFA 4IY1A 1GL3A 1NWHA 1ZCJA 4IGEA 3LT4A 2J5KA 5JDCC 3ASVA 1XKQA 4PG7A 4EUHA 5K6AC 4BMVA 2EF1A 4QUKA 1K5HA 1LSOA 3WJAA 1E5LA 4J0FA 5JAZA 4XQEA 3OHSX 2CUKA 1ZXLA
chains in the Genus database with same CATH superfamily
4HLCA 3TQSA 1U2GA 3UBMA 4UEKA 2QTCA 3WBFA 3RVLA 1Q6YA 3NUQA 3QHPA 2HMSA 1ZRSA 2IY8A 4TYMA 6REQB 2A9FA 5JAOA 4JJ8A 4A2QA 1LRJA 2AK2A 2W93A 4FIDA 1F0PA 1FFDA 4OUKX 1IJEA 1PJBA 4IHQA 3UTDA 2IF2A 5A1JA 5AUPB 2I7XA 3WHLA 1I7SB 4YPVA 1JBKA 2AQ8A 4IAOA 3FJYA 2BAGA 3N5CA 2QI9C 4QAJA 5DF1A 5J4YA 1NSYA 5CA0F 4LVUA 4R5MA 3KWJA 1FDUA 4FYXA 4YV1A 1GGHA 4NDZA 4IH9A 1CUUA 4HPJB 4MVWA 2ACKA 3VVCA 5BXYA 2IYOA 5CLGA 3S44A 4EKNB 2QHXA 3V7WA 3VZBA 1O03A 1R0WA 8ATCA 2ST1A 3VYWA 2A5JA 1YRAA 1Y5RA 4CF4A 2J46A 4JNKA 3V3TA 1BCSB 2QLFA 3ORQA 4RA6A 3TQHA 2O2GA 3M2PA 5ALSA 4HFNA 1L5NA 4D44A 5EZ5A 2ZJ5A 3SD7A 2W2OA 1IAVA 3MZ0A 4K1XA 4PY2A 5HQ3A 4X41A 4P2BA 1AQUA 2BL4A 5I9IA 3DGEC 2WOOA 1E6UA 1HF3A 1U8TA 1X92A 2OBNA 3DM5A 3GN2A 4OXIA 4XEHA 2C1EA 2DFNA 4DCSA 1RPJA 2V65A 3JD0A 3QW2A 1GOTA 5K3FB 1G3QA 4IDGA 1LVGA 1A7JA 2EJCA 3GEMA 3I04M 3NOVA 2XQFA 3C39A 3ZXYA 5HCUA 4YCSA 5BR4A 5F9FA 4MV8A 4EZEA 3AUTA 2EIXA 1QUEA 2QT1A 3G6WA 4KWCA 4IRMA 1EMDA 1ZK4A 4OPMA 5I8PA 1Q0ZA 3OVMA 4MUGA 3OOEA 1KR5A 3G7SA 3RQIA 3GOHA 5CIWA 4WSOA 1OHHA 2C3YA 5AJYA 3U49A 4QDZA 3GRRA 1NATA 3O03A 3C8HA 1SUWA 2R00A 3D02A 3N2NA 4JOSA 2R47A 3PSHA 4B9AA 3IHTA 1L4GA 1Z62A 2Y1WA 3GBVA 1E1QA 3AW8A 3Q3CA 4NYIQ 4F4IA 2QRVA 4HGNA 1QFSA 1F0NA 2E6UX 4WNYA 3RM3A 4FXPA 2V0CA 3IXLA 4Y2UA 3CZ4A 4QREA 5F3DA 1XTJA 1PQ4A 3N7TA 4IDNA 1NVGA 3W77A 1ANKA 4G9EA 1DC8A 1T6BY 4G89A 3QU5A 5CD1A 3RIHA 3F74A 1NPYA 2I6XA 4QXAA 4NEQA 4DLVA 3ER8A 3L8HA 2PVSA 2WU1A 2ZQYA 3JQEA 2FR1A 2PYZA 5TV2A 4BJ6A 2IP2A 5SICE 2W42A 5HHTA 4AQDA 2VDJA 4E5KA 2E5WA 3NRBA 1PDWA 1ZFNA 5CEEA 4O4IF 2Z9DA 3C97A 2AOTB 1V3UA 5T41A 2JAWA 1M0SA 3GRKA 3RVMA 3U09A 1UJ2A 1QYVA 4FW9A 3CLRC 4FDVA 1WVIA 3UXMA 1PR6A 1KOLA 4D3SA 5I48A 4KCGA 2Z8YM 3IQIX 2AI1A 3QIAA 3TW8B 2YH2A 1Q57A 5E2BA 4YC7A 4BYMA 4EJFA 3ED1A 1Y8RA 2YXDA 2QRMA 3QSGA 3U3XA 4PC2A 5CB4F 2UV8A 1J8QA 2PD6A 1GZ4A 1HQCA 1U3VA 3AY3A 4NJEB 4RX1A 1E5TA 3PDWA 2OQ2A 3CB4A 5FPYA 3IXMA 1A95A 1G21E 5JPIA 1LQUA 1PGQA 3EFOA 1I7DA 2QP9X 3HBAA 4JUAA 1YCHA 5TARA 1FNDA 2VQ6A 2WIGA 4Y1FA 1IY8A 1E6MA 3IIMA 4FDMA 1XDSA 1RQLA 1M7GA 1YQEA 5DZSA 1QIMA 2YUIA 4WN3A 1KZYC 5EJ6A 2I29A 4X65B 2I3BA 3EMBA 5K20A 3EY4A 4RVFA 4RTSA 1A9OA 1XRJA 1JHZA 2B8EA 3T8YA 3NASA 1WW3A 1XCJA 2R62A 2NZ8A 1M34A 3DEAA 1V45E 1Q7GA 3AHDA 1N6OA 5HIAA 3ITDA 4NCXA 3OCUA 1NE7A 4UDOA 3VNRA 3VO1A 4YP1A 2XA1A 4W9NA 4WBXC 1FP6A 2F4NA 5F64A 1UADA 2VVTA 4AO8A 5A4KA 5EHZA 3D81A 1F38A 3NTXA 1KDZA 2F3QA 5KCZA 2R8BA 3RV3A 4FSDA 3E48A 5CDGA 4GOJA 2QJRA 3EVNA 4LKOA 2VRWA 2YHIB 4AJIA 5F7ZA 4R05A 1CIJA 1MPXA 4RTQA 3I8XA 1J2UA 3EXEB 3GOQA 4Q19A 1BE0A 2J3IA 4FBMA 1B8VA 4LUCA 3VNVA 2FTKE 3OE1A 1OLUB 1UC8A 1MENA 1NF3A 3VBCA 3D59A 3IMFA 1VRVA 1A96A 821PA 4JQOA 2G0NA 2J3EA 3H04A 4G36A 3AFHA 3IPRA 1A76A 3RTCA 5ARCA 1SIWA 2NU6B 3F4KA 1GZDA 2VPIA 4PXSA 3V6LA 1N2XA 2DJ5A 1K7EB 2XHEA 2Q5EA 3RUDA 4AZ3B 3G0HA 4GMXA 1HI9A 3G9UA 4WXYB 5GV7A 1X9IA 1F3LA 1IHYA 2GBLC 3OKFA 4R1MA 1GSHA 4HDKB 1P5RA 4A8PA 2ZJZA 1MAHA 1N2OA 2I6GA 3SKVA 1RXVA 1P1RA 3KTAA 4ZV9A 4ZYYA 1HUQA 3O4JA 5DLEA 2KI5A 2QL9A 4IIVA 1SKYB 4GZMA 3ZLBA 5CITA 3ZDBA 1KJNA 2XMZA 3RC7A 1CB7A 5SZKB 4YCNA 3IAUA 2ZRMA 1XDWA 3NWPA 3UWOA 1VGVA 2B1QA 5CFOA 1ESEA 3JQPA 1E8NA 1JJIA 1KPGA 2CNKA 3O3CA 3V34A 3HXTA 4GEGA 1X19A 1XNGA 1LH0A 1WJGA 3AWDA 2OFXA 1GLGA 2I3DA 2QNIA 1P1BA 1CEEA 4F38A 3L4BC 3P5SA 1UK8A 1C3VA 3RRXA 4HXFB 1HL7A 2RAFA 3JS5A 4QOIA 4P4LA 4JSYA 4PWZA 1Z63A 5DT9A 2FW1A 1IZ0A 1OV6A 1PZFA 3CH4B 3KXKA 5DYYA 3VC7A 2A9OA 1XVVA 2R7LA 3HHEA 3HVUA 5J63A 4Z51A 3HLKA 1T0PA 5F2OA 3TSOA 2O05A 5BYJA 5I9NA 2RHDA 4A8HA 1PZNA 2CLKB 3LC1O 2EFEB 3QYAA 5I4BA 2EOAA 4DILA 2WT4A 4ZPXA 1S3IA 1MX1A 4QLAA 3H11B 2O1XA 3ZY6A 1JIVA 4MWTA 4UDYX 1Z2EA 5IABA 1U9IA 2ETXA 4Y9DA 2H06A 1N32B 2CVQA 3F96A 3V1TC 4M0DA 1UFQA 2FH5B 2WFLB 3A31A 4WOCA 1HEIA 3CW8X 4KB5A 3DW1X 2OORC 1LQTA 1HYEA 2MSKA 1N8KA 1J56A 1VCNA 3AO0B 2A3NA 1TO6A 1RS0A 3RTAA 2OG1A 1PBTA 3GUZA 2JVKA 1EZ4A 3SAJA 2O3JA 4U5QA 3V80A 2HDWA 1YR2A 4I5GA 2RH8A 5AM0A 3RTBA 3K6SA 2WWWA 4EO9A 2AI3A 1MB0A 3AOGA 4XFJA 4YMIA 2D06A 4LBWA 1YTLA 1BDIA 4PFKA 2ZTMA 3V42A 4F9FA 4WV3A 1EUZA 3Q1LA 2FWMX 4HSEA 2L19A 4WGGA 3HEMA 5HBRA 3OU2A 4R1OA 3SR4A 2OBYA 3QFRA 3EMVA 5DBIA 1QH8B 1VYTA 4HUJA 4NABA 2ZUEA 4XXHA 3I52A 3N2KA 2XODA 4FDTA 3O47A 4UHKA 5EZYB 5CLFA 1N7GA 4M83A 3OFSA 1GV0A 4JUDX 2IXBA 4UD2A 4G4SP 4H4EA 4KOEC 2L0XA 3WJ1A 3UQZA 1ZICA 2P62A 3REOA 3IBYA 1YS2X 1SBHA 2GZ3A 1S7GA 2DCMA 3A6FA 4OY3A 4LMBA 4CODB 2E5FA 4OXNA 1TJPB 5K51A 1X15A 2XYRA 4QYSA 1JI3A 5GQSA 5CFMA 2LDBA 2PEZA 4CMAA 2GJSA 1EH5A 2X2FA 1ZI8A 1Z2CA 4PYRA 3S8MA 2XZOA 2AZ4A 2ZWAA 2XMRA 1I5RA 3QXJA 3LPLA 2QY9A 4ARVA 2OBLA 3G1TA 4RMGA 3FMIA 2PZAA 4MW0A 2BI4A 5FADA 2JH3A 3OQ1A 4H1HA 1N6LA 1TO2E 4MV5A 4RK6A 3U1VA 4J9UE 1AURA 1PDVA 4NENA 1SK8A 2O59A 5FWYB 4P4SA 5BMVF 3AXTA 4TV8F 4EHIA 4MTLA 5JZSA 1ZRHA 2VK4A 3A1NA 1J2TA 3C4JA 1SPBS 4NYMQ 4F4DA 3G88A 1GN9A 1LF0A 3F78A 5JZVA 1DJQA 2CHQA 2JK1A 2EXXA 3PRKE 5AK0A 1GKUB 2BBSA 4MUMA 1Z68A 1ZSYA 2B4AA 3PTZA 3K5PA 3LT1A 3EGIA 3RODA 5EJAA 1IULA 3UW3A 5FFMA 1RYNA 3STWA 5J4HA 1OVGA 4D8TA 2FAXA 4ENUA 1WMAA 1EP3B 4OH1A 5DXFA 2EKBA 4C2UA 1NP6A 4NARA 2UKDA 4B47A 4EITA 3TG8A 5AW4A 1N8TA 1YAHA 2GAIA 2Q3EA 2WUWE 1ZD3A 2AA3A 5MHTA 3F7NA 1SKQA 3T5AA 1K0FA 4EEKA 1S1MA 1S02A 2BZ1A 2BY4A 2P4SA 3JVVA 4C0HA 2XUAA 3U9LA 5LBTA 1E8MA 3FYSA 1X74A 2QXUA 3LDFA 1PDOA 3CNHA 3NEPX 1RJDA 4C3ZA 5C1IA 3ZZTA 4YMHA 2QQGA 1U7TA 4RZHA 4WLUA 1TCVA 2B8NA 1ZGHA 3M4ZA 4WK4B 5FOXA 3R5JA 2IEZA 1GZVA 1GGJA 3HHPA 2ZVDA 3NIBA 2Q07A 1R4ZA 2QVZX 4K46A 2HJSA 4R40A 5FTMA 1ILEA 5D8DA 3U3RA 2IITA 2ZRCA 4J16C 4DXDA 4C01A 1PS8A 1A9SA 3AB8A 5AW0A 1PCXA 4L73A 4BNHA 4DR7B 1L7QA 4F6RB 3D43A 1QF7A 2BI7A 2CMKA 5AKXA 4M8LA 4XD7D 3MVEA 4V0KA 1E3QA 3E5HA 4YJHA 2O3SA 1JQEA 2VA8A 3NLLA 2N46A 5F3RA 1K8YB 3BZBA 3EARA 1IUPA 1CUWA 1W4BA 2ONKA 3IPCA 1XDZA 3N9IA 3OD1A 1LRLA 1JB9A 2CFOA 3QUAA 4PLCA 4LQDA 2F64A 5FPPA 5IDQA 5E8JA 1Y37A 3CCFA 1LJLA 3A3PA 3LA6A 4Q03A 4UQOA 5JSYA 3AETB 3OPYB 5KYVA 4EI2A 2GPYA 1HRDA 3EA0A 3BZUA 1E9RA 4NBUA 3CRVA 2EG5A 1DC4A 1IDN1 1T5SA 4WKOA 4QU9A 4D74A 3GG2A 5BSKA 4E13A 2GEKA 2UDPA 1JDPA 3O84A 4H4DA 5JD4A 1EA7A 1ZW6A 4MQEB 1CZNA 1CDOA 5LOVB 1BXGB 2Q6LA 2QQ5A 4MXDA 2HQOA 4GLFA 2MYNA 4KRFA 4KVAA 4F9EA 2EDCA 1VSTA 2EX0A 4JLMA 4L72A 2JI7A 2GEJA 1ONBA 1QZ3A 2P9FA 1QCDA 1V8OA 4JY7A 1L4KA 4KWEA 3LS2A 2AD1A 5C3UA 3UMRA 4C0XA 4DVJA 2ZETA 2IOFA 3T3OA 4DNPA 1G19A 3ZIAD 2BELA 3SYTA 3UT0A 3KPVA 1DKUA 2PX0A 3GUHA 1DJPA 3HB4X 3JQ9A 3D6NB 2XZDA 2VDMB 2P65A 3TW0A 4TL9A 3OT4A 4UTXA 4E4YA 1GZ3A 2QM3A 3K9NA 3T52A 1IY9A 1XZ8A 1DQNA 4Z9XA 1V7ZA 5JS2A 2IHYA 1AXEA 1F2DA 3TNYA 4QBGB 4IHJA 3I83A 1OW3B 4LWPA 3LPCA 2WF7A 3TJZA 3Q7RA 1QGDA 5F7XA 1GWNA 2D59A 4G26A 5KOYA 2F1JA 5AJVB 4CKXA 3QJGA 1T9HA 4G5SA 3G9QA 4LECA 4NS4A 3LUDA 2G8LA 2R2GA 3RGGA 4OQFA 5IC5A 1XP5A 5I5EA 1RWPA 2IA5A 4V03A 5L95A 3WB0A 1D5WA 2BI8A 1TLFA 2H4WA 3T4XA 3KKNA 5M5BA 2YQZA 4M46A 1PR4A 3OJCA 3I32A 3TAHA 3MTQA 3ELWA 1CVLA 4UBIA 4X20B 2ZZMA 621PA 1JL3A 1JB1A 2QRLA 2ZBPA 3TNLA 4CF7A 3SIRA 1R6VA 2F43B 4DR6B 3QWBA 1BGXT 3USES 3I5XA 3B82A 5JS7A 4I1RA 4DMRA 5KUTA 4JP5A 5JNTA 1NUHA 3OWXA 3W78A 4TLCA 2FQQA 5EE9A 4A5OA 1G21B 4O8CA 4MW7A 4CV0A 2XKAA 3V46A 2GYVA 1P4AA 3KAPA 2K2WA 2SKDA 3KTDA 1UK9A 2EX4A 2FUKA 4X1KA 4I9HA 4DDUA 4UAGA 3THYB 3HCBA 1ESDA 3DKKA 5EIBC 5CCBA 2LP4Y 2NACA 1TW3A 2HEGA 5KNBH 2PQ0A 3WFIA 1EFVB 3DZFA 5DNUA 4GM4A 1N0IA 3TVDA 3A1EA 3ZDCA 4MIOA 1CEXA 3GRYA 2WKRA 3LC0A 2DRIA 1ECCA 3OZEA 4B81A 2FGJA 1Q3HA 2EFGA 2OHFA 1ADFA 4JS0A 5CYOA 2C1ZA 3V4VB 3UJ8A 4PRKA 4EHNA 1YASA 5IF9A 1EFPA 1GKLA 2B21A 2OV8A 2QUIA 4BUCA 4P33A 2CSXA 2G76A 5CEJA 5LUAA 3GAAA 4OA8A 1T2UA 2YWDA 2BP7A 4MMYB 5JYDA 2WJYA 1CDEA 4N40A 1K3UB 4O59O 3D6HA 1Z28A 2WIAA 3NTLA 4XGQA 2PX4A 5ALYA 3BDAA 3OT1A 1ADJA 4LJ8A 5JMPA 4MA5A 1HMYA 2J5XA 4QQNA 5D6OA 3WQRA 5A3QA 3H1TA 1E63A 3ER6A 4JHLA 5CVUA 3N39C 5CYFA 3FOZA 2H3HA 2CXTA 5F5LA 5AW9A 4HWSA 1D2HA 1E2FA 1C7FA 2Y0DA 5C8XA 3CVOA 3S2FA 3D4OA 4CLDA 5KU1A 3BD6A 3MHTA 4TV9B 1YZYA 3BTUA 1LSUA 1OXVA 4PZUA 4L9AA 3RU3A 3U4DA 1QKKA 4EPVA 4NFLA 3LPNA 4WI1A 4Q1CA 3BMNB 1X7GA 3LLCA 4NMLA 3K6SB 1V41E 2H92A 3ZHYA 1ZOOA 1DKNA 2J32A 3F46A 2ZDGA 1PL6A 1E94E 1KP2A 3HY3A 4PO1A 5H9WA 1FVFA 2H1OA 3JSAA 4HDRA 4ZCPA 3K15A 4D9GA 3N2YA 3N58A 4MAMA 1CQZA 3TXAA 1CYDA 5JZ9A 3FHOA 2ZYAA 4KR3A 4JI4B 1WLSA 2XEXA 3DFUA 5KTSA 2VJDA 4EG5A 1K6IA 2PD3A 4JA0A 5H83A 1PVDA 2ZJYA 1XG5A 5CB6A 2I3GA 3A7EA 3MD0A 1LXCA 3RAGA 4CR6A 1SXIA 4CT5A 4BNXA 5IXJA 2D8MA 2OECA 1DZ3A 3C15C 3RRJA 4ZEMA 2BTEA 4JBGA 4X84A 1OWLA 1UJ6A 1JHPA 1VBFA 1XQWA 4WKCA 4ZXFA 4HYQA 3HRHA 2YWFA 4S3MA 1C3OA 3OY2A 5KOJA 3C4QA 2ODPA 1IRIA 5DM4A 2WNHA 1UWCA 5DYTA 1QRUA 3U2QA 3UY4A 4HH1A 5JNLA 1YZVA 1XLTA 4IWYA 1H0RA 2NM0A 4UU8A 3PNPA 3WGJA 3AVOA 4B4DA 3GPIA 3PQ7A 4D4IA 4DBZA 3U56A 1QONA 2OBFA 4X00A 2AS0A 3GBSA 5LN1A 1GJRA 5LA6B 1ZH8A 2SECE 3SSAA 4A16A 5CDSA 1FRZA 3A25A 5KBYA 3ZGLA 3N0RA 5FWYA 4FTWA 2OBXA 3COPA 4QFCA 1WBJB 3IS3A 2CNOA 2HD4A 5IH3A 1SO8A 2GWRA 3EC7A 5FBVB 5M34A 2X9GA 4K86A 2DHQA 2GVDC 3JAWA 5J5CA 2JJ2A 5FAKA 1RWNA 3URKA 1HFKA 5JH7F 1Q2XA 2ADFA 2GYYA 2YIJA 3KR9A 1CQIB 1H6CA 1XX6A 4Q3KA 2WY2D 3ZC3A 1G20E 1KNXA 3G89A 4C5CA 1IU9A 2A78A 1KI2A 1ZUIA 2OOSA 3DDNA 3OP4A 4DE5A 5F2NA 3U6KA 1YI0A 4AJLA 3OJOA 2CK3A 1JXQA 4UVIA 2B5OA 4JR0A 3UKOA 3WGZA 1JQAA 1U04A 4DIUA 5L4NA 2WTBA 1B15A 1QMPA 4ZK2A 1E79D 4AVYA 1G8AA 3ML1A 1W4CA 2PVCA 3L8CA 3PC7A 4HLDA 1E1NA 5BV1A 5KYGA 4U2EA 3OO1A 5TGDA 1W59A 3E5RA 3CS3A 4ZV7A 3LQ2A 5AK5A 1D09A 1NW7A 1G0OA 1NNUA 3DP9A 5DFAA 2GEVA 5H7XA 5B7QA 4AMZA 4UBMA 2ZVJA 3KYDB 3RRBA 3CWQA 5JNRA 2BH9A 1MB9A 2CLIB 2J3HA 4QC2A 1P7CA 2Y1FA 3LYUA 2Q1WA 1BVUA 3ZBUA 1V1JA 1HQYE 2JGJA 4C20A 2VJAA 3PF8A 4CM8A 2ZI7A 3K1ZA 4EP1A 3OOJA 4J07A 1TRKA 1UP6A 4IJMA 1CNMA 1JAXA 4MW5A 3Q2KA 3U0VA 5EKXA 1ZGCA 3ZUGA 4IMRA 3GGCA 2C7GA 4K6KA 4P34A 4QEZA 1SVWA 4WCFA 2G80A 1AKWA 1ZK0A 4NVRA 2I4IA 3HJRA 4I9NA 4C22A 1NMEA 4WY2A 5K0TA 3ZLJA 1I9CA 3C3XA 5DNAA 4CM3A 3Q41A 3O1LA 5C3MA 1ZK1A 4JJAA 3VFDA 3CGWA 4M0CA 2AWOA 4HN2A 5HIJA 1AZLA 1HXHA 2P3QA 3KJEA 4HYEA 2C5LA 3D8TA 5I7FA 3GB9A 1O6ZA 1Q1NA 4X85A 1KY3A 2F48A 3U9TA 2O52A 4XTRA 3LVBA 1YJBA 2GWHA 2ZIUB 4HH3C 4WEOA 1N34B 1WO8A 4EO7A 4CI9A 5I01A 2FPGB 4UBJA 1LI4A 2ID7A 3JYHA 3QXXA 4Y1RA 4Z1MA 5JVDB 1QHFA 2WSMA 1FFXB 1IH8A 5SV2A 1LX6A 4BEBA 5DX8A 6AT1A 5TQ0B 2YYAA 2ZXUA 2P6NA 2K5UA 2IYZA 4COKA 1EUCA 3W8RA 1VFNA 2WTNA 1VKOA 3WLRA 3ZWPA 1QH1A 3LUKA 1S8FA 1MCZA 1BMFA 1XELA 2BUBA 2PLFA 3PCTA 3M34A 4TYQA 3RKRA 3TD6A 5HRUA 5BY2A 5E6SA 2ARKA 3GLHB 5HOQA 3LZ6A 4WZZA 4BRZA 2YOFA 4HXGA 1DX9A 4MVJD 2V03A 4QATA 5K8LA 1B73A 1T0UA 1T3TA 3C3JA 2WB4A 4MQEA 2IX9A 1DO0A 2QDKA 3V4FA 5DISB 3TLBA 5BQ3A 1HLGA 1SBNE 2YJ6A 3QX8A 5BT8A 2ZREA 4WMLA 3FYCA 1NFRA 3I39X 4ZJUA 4YJ3B 1XFDA 4CUJA 5T3YA 1SM4A 2WRZA 5A1TA 1RLMA 5IMBA 1Q0QA 4BWFB 4GW3A 2FX5A 4A0HA 4ZODA 1W47A 2CJYA 2FG6C 2X5XA 3TZ6A 3DLBA 4K81B 2YFHA 2CLEB 4MV1A 1E7RA 1RI2A 3I42A 3QBTA 4JJ7A 5J2TF 4JKIA 2A5LA 4C7OB 1GA1A 1J1ZA 2C5HA 4PONA 5ABPA 5ALMA 4F3TA 1MC5A 2CSUA 5JJBA 3KSMA 1L4MA 3Q1KA 3LGSA 3EBPA 4JYMA 1T29A 1Z6TA 2O8EA 1CJCA 2QSUA 4X5OA 3OSZA 2QGFA 1J0XO 4IZHA 1GTSA 1A5ZA 3OQVA 5AKIA 5IDWA 1F12A 1QAQA 3H86A 1YJAA 3OUZA 4NONA 5EESA 3FB4A 4MCAA 4R54A 3T3HA 4E5UA 2UYCA 1JR6A 2GK4A 5K4AA 4N5LA 5AUNB 5BUZA 2J9YB 3E1GA 4RFSA 5CFNA 1R10A 1W2HA 3DEYX 1KQ3A 1KJIA 4NCIA 5DLQC 4W5TA 1ORDA 2GT1A 4INAA 3IBSA 2LBPA 1AMNA 3CA8A 3EH2A 2JC3A 2XTNA 1WHTA 4DGQA 3RFTA 4Q7QA 5HGXA 4IF6A 5BURA 1KEZA 3KOOA 2J41A 3VOAA 1T1JA 5HKBA 5A0FA 3T9BA 2ZU0C 4HDNB 1L1RA 8ADHA 4JODA 1TLLA 1GZUA 1CERA 5DW0A 3WXMA 1OLXA 4DTIA 1HMPA 4NHOA 3UAOA 2GCEA 2AE1A 2F3PA 5AVSA 3QLJA 5KVCA 1Y7PA 2Q1TA 2UZ3A 1SVIA 4B6SA 3VNUA 2ZUWA 1B43A 1IXZA 2PMWB 2YWGA 4LI0A 2GQ0A 2JCGA 5LD2B 1JIQA 1I2CA 1KZGB 1L2TA 4H0NA 4CCYA 1DKPA 1L5KA 4AIIA 2G9RA 3MS2A 2O2XA 3BFXA 3EASA 3STHA 1LVUA 1PO7A 1T9KA 4G63A 3V9AA 3B3FA 5IXYA 4MO2A 5E6UB 4V0QA 4LBYA 1SXJC 3BXEA 2INGX 4BFXA 1T2FA 2EEZA 2XCIA 3ZU4A 2WQ6A 4IR7A 4EY3A 1G66A 1P72A 5BSEA 4Q16A 3WTBA 3MB5A 3V97A 4D6PA 3LK6A 3JR7A 3M6XA 5BUCA 2IH5A 2ZPAA 1YZQA 3BD7A 3FVTA 4PX9A 3A2NA 1WDLA 1FJ2A 2I2BA 2PUWA 3E7FA 1PEKE 3F6YA 4M2LA 4PX3A 2WHEA 5IWAB 1ZESA 2WKWA 3I2GA 4GGPA 3E9RA 3AZQA 3QOWA 1STOA 1VXRA 3KC2A 4J1NA 3ORRA 4G5QA 5J40A 4FNOA 5J43A 1OPXA 4QBFA 5BWMA 4KX5A 1PYDA 3K0CC 1ZDMA 3U4HA 2FDCA 5E1BA 3CUSA 2OUIA 2EL9A 1HT2E 1X94A 1CQJB 2FMIA 2YQ4A 1W6RA 3BXXA 3KALA 4ZAGA 2WJHA 4HX2A 5K09A 3GT7A 1WZEA 4YT2A 2IQ5A 3WK5A 4DEVA 1GKYA 1KEVA 2P2NA 1EI9A 4YIKA 4C4AA 1L7AA 2QAIA 3DNFA 5HQTA 2BIFA 3ELDA 4NBSA 1E59A 3U7RA 5KQGA 1SIOA 2GHQA 1E3WB 4TPKA 5J47A 5IRCD 1C9KA 1LBEA 2V6JA 4ZVNA 1ISHA 4F45A 4F60A 5A4IS 1UAAA 4WN9B 2QR5A 1T25A 1AV6A 1IWBB 1T5IA 4TV9F 4RPJA 1XJWA 5EJGA 5FQNA 4DNQA 4JBNA 1DRKA 1PGJA 2I4TA 4CU5A 2COUA 3HZZA 4Z9AA 3B70A 4GMKA 3UK0A 3RADC 3NONA 3Q8MA 2B1RA 1K97A 4GXTA 2IRWA 4KO1S 1L5FA 1LFDB 2WD8A 4KIUA 3R9KA 2IYUA 3GZNA 5M7EA 3W6UA 4W1QA 3JVIA 4O63O 4B6RA 1TIPA 4BQIA 3UJBA 1N1GA 3R0VA 3S2UA 1OX6A 3RT9A 4C6HA 5KOJB 2QIPA 2ZTSA 3OE5A 4XQGA 2I54A 4Q9JA 4U0KA 5EEHA 5ADUS 1SHJA 2XCUA 3X1ZA 3FSGD 1C3OB 3OG9A 3UWPA 2R79A 4IZ6A 2Y66A 3B2QA 3B6MA 2BFOA 2G08A 2PKYX 4RY9A 4F12A 2CMFA 1GEEA 4URUR 2QUBA 1DI0A 3ID6C 2BR4A 2MYTA 2WUEA 3NX4A 2ZB4A 4K87A 5EZSA 4DJEC 2PZMA 3T1TA 1JHVA 3U16A 2WVJA 3GLGE 2FPUA 4S1TA 2BKAA 5KTMA 4G01B 1QQTA 1YS6A 1U0FA 2COKA 1Q17A 4HQRA 4IDAA 4LJ9A 1IC6A 4OI4A 5DTRA 3RFCA 5FL7A 2I87A 5KDLA 1L5OA 3F2IA 3UFXA 4BMNA 4PYQA 3CUEF 3JQGA 3DXYA 4FFBA 1G16A 3L0ZA 3AR3A 4CCSA 2VZ8A 2PZFA 5D2CA 5CCEA 1OB5A 4HNTA 1ZIYA 4W8OA 2JF0A 4DQLA 4S2UA 1E5XA 3EDCA 4BLVA 5P21A 5FOQA 3PQ6A 4PM4A 2A67A 3ZE7A 5JSUA 3UAZA 3K0BA 2YN2A 3NH9A 1LS1A 1P0QA 1RKXA 2FR0A 4GP7A 2GEBA 3EZNA 3WZLA 5T6MA 3D64A 4R3WA 4CG1A 4MO9A 3SHTA 2FFAA 1L7RA 1XMSA 3I73A 5HE9A 3L0OA 4LDNA 3CLTD 1P60A 1HY3A 2UUCB 1XDBA 4O4JB 4JBLA 3IALA 4JFRA 5J1SB 3GEGA 4ZQFA 1JT2A 1MABA 5T4HA 2YNMA 4OHUA 2POQX 3BMCA 3GEIA 2PYIA 1NQXA 3GQVA 3MRVA 1F0KA 4MQMA 5D7NA 4CQLB 2AI2A 2YXNA 3D7SA 5ICSA 1DZIA 1OAOC 2C54A 5G4KB 2CKDA 3LHFA 4M76B 2AEMA 4RGYA 4ND7A 3U62A 3WP1B 3WYBA 5CBKA 1EJ6A 5LZ9A 4OKNA 2YV5A 1BE1A 1OFVA 3DEHA 2A1TR 4TQAA 4LXIA 1GTZA 4MR8B 4P35A 2GZMA 1DG3A 3F5SA 2GX6A 3R5XA 3GFFA 3K0SA 3UVEA 3FDFA 3JQ8A 1XMQB 2W90A 2H1VA 1PUJA 2J45A 1M8FA 4H08A 5L3QB 2GN6A 5A06A 1ECGA 2B9EA 1N3YA 4ROTA 3G2KA 4KQCA 4NV3A 3TIFA 1DDIA 4LXHA 3FVRA 3U3KA 1C3JA 1VCIA 2V8BA 1ORTA 1ZX1A 3EN0A 1PWZA 2IT1A 2GBCA 4IZOA 2X77A 1W88A 4JBXA 1NT2A 4MLPA 2YW9A 4OMUA 4J1QA 1DC5A 2J9FB 3H9EO 3NV7A 4BX2A 4HRXA 3QXHA 2RGXA 4XLLA 1Z26A 5B12A 2N1MA 1CB0A 4JP8A 2GM9A 3RC9A 3WYNA 2DBQA 5FYDA 1RXSA 1VM6A 1KJZA 1MO6A 2CMGA 5E7QA 3RSGA 4TYPA 4AKIA 4QVKA 3RABA 2J6BA 2O8CB 3Q72A 3LX8A 4XIFA 1K9SA 2FQYA 2FPPB 3FUXA 1EIZA 5ITVA 2PUEA 4Y1GA 5TMBA 1JLLB 1JFLA 4P38A 4JU8A 4C0QC 4OHZA 3ETLA 3E7PA 8OHMA 1FMTA 2A1TS 2X4DA 3AP2A 4PLVA 4QGHA 3UB3A 4F96A 1V0JA 5C80A 4QOJA 1FYDA 1MVOA 3UCFA 4RA9B 2XDYA 2GBFA 3GLVA 3B8EA 4KJXA 3R0ZA 1RQ7A 4XPZA 2ZR9A 4LV5B 3A05A 3MF4A 1GIAA 3QU9A 4FONA 1YQDA 1YWGO 4Q4CA 4IQGA 5C52B 1OT3A 1JRLA 2ZT8A 1VP3A 5EZYA 5H82A 5J2TA 1KMNA 5B36A 2PQMA 2QNBA 1IBRA 3CW9A 3K0AA 4XPIA 4IYRA 2PNFA 3DGFC 4CBVA 5JXWA 1XRPA 2H9IA 3BD9A 3WJ2A 5K9ZA 3ICQB 4YCAA 5IBQA 3MGBA 3UYLA 1T8RA 4LF5B 1Y9JA 3PWKA 1TKCA 2YWRA 4Q02A 2BM1A 4X54A 3X1MA 1CUFA 1KFCB 3OTGA 2XX3A 4K7JA 4ZI7A 4KV9A 1KARA 3HFGA 2C8VA 2ILVA 1JHUA 1MFPA 1VYVA 1QIDA 3KKEA 4P0PB 1ZUWA 3DC7A 5BVHA 2PKEA 4CKEB 2EZTA 1Z16A 3O7MA 2ZYSA 5IKOA 3AJ8A 3B6JA 4B3HA 4U7DA 4UZSA 4PAGA 3PWZA 9LDTA 2AV6A 2BFBA 2LGJA 2B8JA 1B14A 4PCLA 3TAUA 2JG3A 4ZIRA 2CDBA 4G6ZA 3DF7A 2IYVA 1N3BA 2RDMA 3BFVA 4ZHSA 5FOVA 1JVBA 4FPXA 1Y4UA 1RBQA 2IYPA 1OFTA 2WE8A 1KFBB 5D5QA 2P6RA 5L7YA 1Q1QA 4X1YB 3TFWA 3M81A 1E64A 4CDGA 1C1XA 1RZRD 3TW8A 4Z49A 4A5SA 2VPTA 1SA0B 3IUYA 4ARZB 2V98A 3OZSA 5AT1A 1XTTA 1Y8CA 5FWAA 3F4BA 1RFLA 2I8LA 3UATA 3JU3A 4OHKA 5K6AA 2H2FA 4UHCA 4OG2A 2JGMA 1E5QA 4WX2B 3V3KA 3NO4A 4BVBA 2J0UB 2QG9A 1J4AA 1XA3A 2CXNA 4DJAA 3VYUB 5AVUA 2ZW9A 3BGSA 4NMMA 2WTUA 1R9NA 3H6KA 3HXQA 1QTNA 4ZU3A 1G4UR 2F9FA 1O95C 4M1KA 3H1AA 4F4FA 1NKVA 2E1PA 3A9TA 1IEWA 2GUGA 5AJHA 3ZHRA 3VM6A 1PR5A 4LOHA 3PNKA 5ER9A 5HR5A 3DLAA 3THWA 4G25A 2QMQA 1M2NA 4E4RA 1BH6A 4FYWA 3EWSA 2P40A 5ADVA 1G3UA 3WGYA 5DI9A 4DA6A 3LIPA 2NV0A 5IDYA 2IEAA 3K0HA 4LRXA 3WMEA 3GHYA 3IE2A 3PQ3A 1MJHA 1S7CA 5JNWA 3EIEA 3R0QA 1PLLA 2IXGA 4PZLA 1AQLA 4YACA 1JVNA 1UQRA 1E7WA 3Q7IA 4CE6A 3F7MA 4DMFA 5ERYA 3HCOA 2WJPA 3K5IA 5SYMA 2H11A 2YYZA 2ZRQA 3KYCB 4V3CA 4WUTA 1CZHA 2APJA 3V2UA 4AMBA 1XMPA 5BOSB 1X86B 4WBSA 1ZBDA 4QFMA 1AKUA 1KAOA 5J58A 1OFIA 4BU1A 2JLWA 2XDWA 1CJMA 4ZOEA 1JPUA 4UHHA 3W3AD 5K2MA 4LHEA 1T6ZA 1V4BA 5C31A 4LK3A 1Z8NA 2AC7A 2WJAA 1BHSA 1JBEA 1XZDA 5K8JB 1JKIA 3NTQA 4MHTA 3QKIA 4BZWA 3HN6A 3WGMA 2OD7A 4X92A 3FFAA 5BRJA 4O5AA 3C85A 3HUFA 3WQBA 1OOEA 2WHYA 4CHTA 1SXHA 4WE3A 2BFFB 2XITA 2ZK7A 4UU7A 2FRXA 5ELMA 3NBFA 3WWEA 4EGAA 3KLBA 1WU7A 1DRWA 1MBZA 4HMQA 1DX6A 4B4UA 3GUUA 4YMGA 3QBEA 2EP7A 4H7FA 4NCKA 4UULA 1PHRA 1AO3A 2MSWA 5FFFA 4XYLA 1XTPA 4EHHA 4K3VA 1O94D 4EYKA 1E3LA 3RC1A 1ZHFA 2VSXA 3OIDA 4LGYA 3F9RA 3HKDB 1KH3A 5FYQA 1XTUA 5KJEA 4UTVA 4EM6A 1JKJB 3EE6A 3IE0A 4ZOQI 5IT9A 1PAUA 1E1CA 2CLCX 1BIFA 1VPLA 4BB9A 4D41A 1E6EA 5L9AA 1OXSC 1OMOA 1R15A 2EW8A 4PVCA 2C8JA 2FZKA 1NQAO 2XTAA 3MT0A 5FX2A 1P29A 2HA0A 3P2KA 1A77A 2HLNA 4YRGA 5JHHB 4RHFA 5CVDA 5AD1A 1AKVA 4UM9B 1IY0A 2VK8A 3TLMA 4RDIA 3ZE8A 4D3DA 3RVPA 4B44A 5IVKA 3BICA 2PKQP 2PV7A 2Y0CA 4RUKA 4DQUA 3VSAA 3VR6A 4BN4A 2O3UA 4K2AA 1JFVA 1MEJA 1N9GA 1O9BA 3AHGA 4NDNE 3ZK7A 4DV7B 3L06A 2EZUA 1BKSB 2NZWA 4G0QA 4JR1A 1XAHA 1RI4A 5LPNA 3LYHA 2KX7A 2ID4A 2A9QA 3INYA 1QH8A 4P7BA 1ITZA 4XSGA 5WRFA 3ZYCA 4ILEA 1JAYA 1FRQA 1GN8A 3DKVA 3H11A 4UUBA 3TMKA 1HWYA 3IVRA 1ACLA 1GL7A 1SQ6A 3AU8A 1KYTA 1CUVA 2GD6A 4FEAA 2Y1EA 3NBUA 1X7YA 3A1DA 1M2OB 1G60A 1X8LA 2RHJA 4XVHA 2AMYA 5FV7A 1A8UA 1M0EA 3MQFA 1S9HA 2XCQA 2Z56A 1ZBQA 4BVKA 2J85A 2OEPA 2BKLA 4FN5A 4ALIA 4KQ1A 1BWPA 1XYGA 1PNVA 3VU0A 2VP0A 3PT9A 3GFQA 3BOSA 4WERA 1FZTA 4KODA 2YWXA 1V5FA 4JYPA 3ZWKA 1PYOA 3EAGA 4CQLA 4Z4CA 3RDPA 4X7PA 3RARA 3SF8A 5F5XA 1EVYA 1MU0A 1BWQA 1GHTA 1M1YA 4L2IA 4I3HA 1KEKA 1ZUNA 3PCRB 1O8CA 3G2LA 4ZHQA 2R25B 4Q4AA 2GCNA 1GUAA 2YFYA 3OFJA 2Y0EA 3E4DA 2FR8C 5DHPA 3DHWC 3K96A 4ICIA 1PT5A 2ZUVA 2AN3A 1C50A 1SOWA 4MKHA 1DXQA 4R8LA 4BNYA 4HMOA 4EKEA 3NKFA 5J2UB 2M6LA 1V1MA 1MTOA 2FQ1A 4D02A 3KKMA 5F5NA 1JFTA 2F7SA 4TGLA 5LZ7A 2I5PO 2WAMA 2V45A 3GRZA 4HDOB 4CKYA 3SWWA 3GJ0A 1U0GA 1AS3A 1AB5A 1WV0A 4HYYA 3X2FA 3AFOA 3AP1A 2VCEA 3CVJA 3U6BA 1DQSA 2BEVB 1UKVY 3VOSA 4A73A 3IULA 4HSGA 3KAQA 1PZGA 1MQSA 4KO3S 4MINA 5GWXA 1OI4A 1U9YA 2EBWA 2FE1A 4ONEA 4IH1A 4S24A 1QH0A 2EYUA 3FJOA 3GJ3A 1QPBA 4KLNA 4XE5A 3IJRA 3DXFA 2XMBA 4G5YA 1PX2A 1KDYA 4I3GA 5B5SA 5AKEA 3ZCQA 2J9GA 2C84A 1YOBA 3DPUA 3U4QB 2WMOB 2C7PA 2DHDA 4TYYA 4PSCA 4OSOA 4O6VA 1U3FA 4ND2A 3ZIAA 1ULTA 5EI5A 4OUDA 5SY9A 3NWJA 1ADYA 5DM70 1BW9A 4GC9A 3H99A 2E9SA 3FYDA 3P9KA 2QRUA 4Z8YA 2Q7XA 3ZZUA 1GNRA 1RJ9B 2NAFA 4MW1A 2PG3A 2WJJA 4EVRA 4DUYB 4ENTA 4QRIA 4V2UA 4I6GA 5G1PA 2H6EA 1ZJ6A 4G1EB 4E6EA 5EWMB 1Y33E 1ENYA 1W9MA 4PLTA 1VSQA 3KKKA 4UBKA 1TX4B 2QVGA 4LDJA 4I1UA 5KEIA 1RDFA 1XLUA 4QHYA 4IDDA 4B8YA 1RQXA 3UB2A 1LLFA 1F51E 2LR0A 3KRTA 1AHNA 1UBCA 2GTIA 4HS4A 1WZIA 2IWRA 5DN6D 2OM2A