2I9AA

Crystal structure of the free aminoterminal fragment of urokinase type plasminogen activator (atf)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
NCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 30
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2i9aA01
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 2i9aA02
1URKA 1KLIL 4BVDA 2K2SB 1NQLB 1NT0A 2WPJE 5CKNA 3GCWE 4ZH8B 1LQDA 3HPTA 1KLJL 1TLEA 4CUEA 4ISHL 1U8CB 1W8BL 3KIVA 4A5TS 2BQWA 1EMNA 2XC4L 2J94B 2GD4A 1LMJA 1V3XB 3CA7A 3LN0A 2G00L 5EGMB 5I46L 2TGFA 1HJ7A 2Y7ZB 2AYLA 1TOZA 4MMZB 5CSQA 4RS0A 4BV7A 1B2IA 1PMLA 4CIKA 1HPKA 2J34B 2L0SA 1DDXA 2UWPB 3ELAL 4JZDL 5COXA 4RRXA 1IP0A 1F7EA 2RA0L 4O03A 1IQGL 1XDTR 4Y76B 5JBAE 2DOIA 1Z6CA 1EQGA 1EPJA 1FAKL 1NFUB 2J95B 2FEBA 1FE2A 1EPHA 1WHFA 3SP8A 1FSBA 1CVUA 2P3TA 1CEAA 3N8WB 5FDQA 5CP9A 2K2TA 2Y80B 3KK6A 1L5GB 5JBCE 5CS5A 3SOBB 1IJQA 2W2QE 2VVUL 2ADXA 4ZHAB 1EPIA 3KL6B 4TGFA 2VVCK 3KQBL 2WFTA 2Y38A 4RUTA 3SOQA 1WU1B 2WYJB 4XL1A 2J38B 1FAXL 1ZAQA 3KQCL 3MQEA 1I5KA 1P9JA 3V64C 1PK4A 4O02B 1A3PA 1IQEL 4ZXXL 1NZIA 5COEA 2XBVL 4Y79B 1LPZA 1XKAL 2H9EL 4JZFL 1KRNA 1ATDA 4C16A 1JL9A 2UWOB 2KL7A 4Y7AB 1RFNB 3H5CB 1SZBA 1BF9A 2PHBB 5L30L 5L2YL 2P28B 2W2ME 5JVZA 3N8VA 2OYUP 2PUQL 1IOEL 4OTYA 3SW2A 5CS3A 3N8WA 1QFKL 1KSNB 4Y7BB 1F0SB 1NK1A 2VH0B 2RNLA 3TH3L 1CQEA 1NL2A 2RHPA 5CT3A 3KQEL 3K9XA 4O1ZA 4X8SL 2XBWL 5JB9E 1L3YA 4CUDA 1IQLL 2P94L 3PGHA 3KRKA 1APOA 2VJ3A 3LN1A 2MGPA 1PMKA 2P95L 4XLWA 1PRHA 1TPGA 3M37L 1IGZA 4BVWA 2DOHX 2UWLB 3KQDL 2WYGB 2PF1A 1HT8A 1DX5I 1EMOA 2Q1JB 1JBUL 2MHPA 2VWOL 4NA9L 1COUA 1X7AL 1BHTA 5JVYA 5CT1A 3P5BL 1MQ5L 3LC3B 2KV4A 3BPSE 1UZKA 1EQHA 2WPKE 1LPKA 3CENL 5IKVA 2W86A 1K36A 1N1IA 1EZQB 1IQFL 1F7MA 2VH6B 4BTUA 1IQHL 2XBYL 2D1JB 2I9AA 3ZYJB 3F6UL 2Y5FL 2BOKL 2VWMK 2Y82B 1HX2A 1KI0A 3N8ZA 1XKBA 1KLOA 1J9CL 5IKRA 3LAQA 4JYVL 4DURA 4XBMA 1PFXL 2BQ7A 5CKQA 2KB9A 4RRZA 1EGFA 1FJSL 2P16L 2P3UA 1G1QA 5CS1A 1PKRA 3TGFA 3MDLA 3KCGL 1CEJA 1ADXA 3QMOA 1DIYA 2HPPP 4D3CA 5HPGA 1P0SL 4ZAEB 3K65A 3R05A 2EI7B 3MKPA 4MMXB 1GMOA 1NL1A 3HO4A 2W3IB 2W2NE 3FFGL 1NFWB 5IKTA 2WPME 2FLRL 3NTGA 2YGPA 4PH9A 2KJ4A 3C9AC 4BDWA 3ASIA 4JYUL 5KN5C 6COXA 1EBVA 2YGOA 1JV2B 5CT2A 1LPGA 4BVVA 2W2PE 1KIGL 1HRFA 1ATAA 4Z0LA 4YZUB 2FLBL 2B7DL 2VVVL 1EPGA 4Z6AL 2WG4B 1YUGA 4COXA 1ATBA 4M11A 4M10A 2KNFA 1MOXC 1N7DA 2K51A 1Q4GA 3HS7A 1PTHA 1WHEA 5CKMA 1CX2A 3EGFA 4X8TL 1HZ8A 1G2MB 2QJ4A 1PXXA 4NGAL 3LC5B 1ATEA 5JB8E 1OB1C 4OTJA 4BTIA 2DDUA 4FM5A 4X8UL 4BDXA 2PR3B 1YGCL 5L2ZL 5F1AA 1A0HA 2J2UB 1GK5A 3HS6A 3M36L 3N8XA 1NPEB 4ISIL 1G1RA 3Q3KB 1UZJA 1M1XB 1I0UA 1FFMA 4BV5A 3OLTA 1MQ6L 2Y81B 3RR3A 3HS5A 2CJIB 2Y5HL 2NPRA 4D90A 2PK4A 1G1TA 2Y5GL 2VWNL 1IQNL 1XFEA 1DVAL 1G2LB 4G1MB 4KIVA 1IVOC 4LORA 3OLUA 4MMYB 3LIWB 2WPLE 3HO5A 2P93L 2I9BA 3GISX 2XC0L 1HAFA 1PK2A 4BXSA 4BVCA 2XC5L 1YUKB 2VWLL 1UZQA 1U67A 1HREA 2JKHL 1I71A 4YT7L 3FCSB 2EI6B 3LTGD 4D0FA 3N8YA 2FLGA 4RRYA 1EAIC 3NTBA 2P26A 2BZ6L 1CCVA 3HN4A 2HPQP 3NT1A 3CFWA 4E1GA 1PGEA 4CSYA 2OYEP 2W2OE 4NZQA 1CCFA 3GCXE 1GP9A 5JBBE 2F9BL 2K4RA 1HT5A 2BMGA 2BOHA 3E6PL 3ZYIB 4Y6DB 4CUFA 4ZXYL 1APQA 3TZIA 3TK6B 3HO3A 1GMNA 1IQIL 3SOVA 4LMFA 3ENSA 2WG3C 4Y71B 3QCWA 4Z0KB 4D0EA 1Z6EL 3BT2A 1C5MF 1YO8A 5CS9A 1JFNA 1IQKL 3IITB 3QH0A 2W26B 2SPTA 2P3FL 4YT6L 3U7UG 1CEBA 4NG9L 4AQTA 2EI8B 2P3FN 4BTTA 1O5DL 2BOUA 3ZYGA 4HZHA 1DQBA 3TBDA 4JZEL 2W3KB 3Q7DA 2QJ2A 4RRWA 2Y7XB 5CISA 4BXWA 1KDUA 2FZZL 3U73A 3F1SB 3IJEB 4A7IA 2BO2A 1AUTL 1NFYB 2J4IB 1K37A 1B9WA 4IUAA 5F19A 3NXPA 1IGXA 1UZPA 1HAEA 1F0RB 1HPJA 3BT1A 1IQJL 3LTFB 2MGRA 3TK5B 2WPHE 4X8VL 1FF7A 2XBXL 1TPKA 3DEMA 2PF2A 3POYA 1G1SA 2WPIE 2BOXA 1IOXA 1YUFA 5KIRA 3NJPC 1CVWL 5K0HB 2BQ6A 3FBYA 1IQML 1NFXB 1KIVA 1HCGB 2WFXB 5JW1A 5IKQA 3V65B 1W7XL 5E8DA 3CS7L 2FD6A 3N8YB 2M74A
chains in the Genus database with same CATH superfamily
1URKA 1KLIL 4BVDA 2K2SB 1NQLB 1NT0A 2WPJE 5CKNA 3GCWE 4ZH8B 1LQDA 3HPTA 1KLJL 1TLEA 4CUEA 4ISHL 1U8CB 1W8BL 3KIVA 4A5TS 2BQWA 1EMNA 2XC4L 2J94B 2GD4A 1LMJA 1V3XB 3CA7A 3LN0A 2G00L 5EGMB 5I46L 2BSFA 2TGFA 1HJ7A 2Y7ZB 2AYLA 1TOZA 4MMZB 5CSQA 4RS0A 4BV7A 1B2IA 1PMLA 4CIKA 1HPKA 2J34B 2L0SA 1DDXA 2UWPB 3ELAL 1V1HA 4JZDL 5COXA 4RRXA 1IP0A 1F7EA 2RA0L 4O03A 1IQGL 1XDTR 4Y76B 5JBAE 2DOIA 1Z6CA 1EQGA 1EPJA 1FAKL 1NFUB 2J95B 2FEBA 1FE2A 1EPHA 1WHFA 3SP8A 1FSBA 1CVUA 2P3TA 1CEAA 4A94C 3N8WB 4GU3A 5FDQA 2BT7A 5CP9A 2K2TA 2Y80B 3KK6A 1L5GB 5JBCE 5CS5A 3SOBB 1IJQA 2W2QE 2VVUL 2ADXA 4ZHAB 1EPIA 3KL6B 4TGFA 2VVCK 3KQBL 2WFTA 2Y38A 4RUTA 3SOQA 1WU1B 2WYJB 4XL1A 2J38B 1FAXL 1ZAQA 3KQCL 3MQEA 1I5KA 1P9JA 3V64C 1PK4A 4O02B 1A3PA 1IQEL 2WZPP 1LK9A 4ZXXL 1NZIA 5COEA 2XBVL 1QIUA 1LPZA 4Y79B 1XKAL 2H9EL 4JZFL 1KRNA 1ATDA 4C16A 1KKEA 1JL9A 2UWOB 2KL7A 4Y7AB 1RFNB 3H5CB 1SZBA 1BF9A 2PHBB 5L30L 5L2YL 2P28B 2W2ME 5JVZA 3N8VA 2OYUP 2PUQL 1IOEL 4OTYA 3S6XA 3SW2A 5CS3A 3N8WA 1QFKL 1KSNB 4Y7BB 1F0SB 1NK1A 2VH0B 1V1IA 2RNLA 3TH3L 1CQEA 1NL2A 2RHPA 5CT3A 3KQEL 3K9XA 4O1ZA 4X8SL 2XBWL 5JB9E 1L3YA 4CUDA 1IQLL 2P94L 3PGHA 3KRKA 1APOA 2VJ3A 3LN1A 2MGPA 1LMMA 1PMKA 2P95L 4XLWA 1PRHA 1TPGA 3M37L 1IGZA 4BVWA 2DOHX 2UWLB 3KQDL 2WYGB 2JJLA 2PF1A 1HT8A 1DX5I 1EMOA 2Q1JB 1JBUL 2MHPA 2VWOL 4NA9L 1COUA 1X7AL 1BHTA 5JVYA 5CT1A 3P5BL 1MQ5L 3LC3B 2KV4A 3BPSE 1UZKA 1EQHA 2WPKE 1LPKA 3CENL 5IKVA 2W86A 1K36A 1N1IA 1EZQB 1IQFL 1F7MA 2VH6B 4BTUA 1IQHL 2XBYL 2D1JB 2I9AA 3ZYJB 3F6UL 2Y5FL 2BOKL 2VWMK 2Y82B 1HX2A 1KI0A 3N8ZA 1XKBA 1KLOA 1J9CL 5IKRA 3LAQA 4JYVL 4DURA 4XBMA 1PFXL 2BQ7A 5CKQA 2KB9A 4RRZA 1EGFA 1FJSL 2P16L 2P3UA 1G1QA 5CS1A 1PKRA 3TGFA 3MDLA 3KCGL 1CEJA 1ADXA 3QMOA 2BT8A 1DIYA 2HPPP 4D3CA 5HPGA 1P0SL 4ZAEB 3K65A 3R05A 2EI7B 3MKPA 4MMXB 1GMOA 1NL1A 3HO4A 2W3IB 2YGQA 2W2NE 3FFGL 1NFWB 5IKTA 2WPME 2FLRL 3NTGA 2YGPA 4PH9A 2KJ4A 3C9AC 4BDWA 3ASIA 4JYUL 5KN5C 6COXA 1EBVA 2YGOA 1JV2B 5CT2A 1LPGA 4BVVA 2W2PE 1KIGL 1HRFA 1ATAA 4Z0LA 4YZUB 2FLBL 2B7DL 2VVVL 1EPGA 4Z6AL 2WG4B 1YUGA 4COXA 1ATBA 4M11A 4M10A 2KNFA 1MOXC 1N7DA 2K51A 1Q4GA 3HS7A 1PTHA 1WHEA 5CKMA 1CX2A 3EGFA 4X8TL 1HZ8A 1G2MB 2QJ4A 1PXXA 4NGAL 3LC5B 1ATEA 5JB8E 1OB1C 4OTJA 4BTIA 2DDUA 4FM5A 4X8UL 4BDXA 2PR3B 1YGCL 5L2ZL 5F1AA 1A0HA 2J2UB 1GK5A 3HS6A 3M36L 3N8XA 1NPEB 4ISIL 1G1RA 3Q3KB 1UZJA 1M1XB 1I0UA 1FFMA 4BV5A 3OLTA 1MQ6L 2Y81B 3RR3A 3HS5A 2CJIB 2Y5HL 2NPRA 4D90A 2PK4A 1G1TA 2Y5GL 2VWNL 1IQNL 1XFEA 1DVAL 1G2LB 4G1MB 4KIVA 1IVOC 4LORA 3OLUA 4MMYB 3LIWB 2WPLE 3HO5A 2P93L 2I9BA 3GISX 2XC0L 1HAFA 1PK2A 4BXSA 4BVCA 2XC5L 1YUKB 2VWLL 1UZQA 1U67A 1HREA 2JKHL 1I71A 4YT7L 3FCSB 2EI6B 3LTGD 4D0FA 3N8YA 2FLGA 4RRYA 1EAIC 3NTBA 2P26A 2BZ6L 1CCVA 3HN4A 2HPQP 3NT1A 2HOXA 3CFWA 4E1GA 1PGEA 4CSYA 2OYEP 2W2OE 4NZQA 1CCFA 3GCXE 1GP9A 5JBBE 2F9BL 2K4RA 1HT5A 2BMGA 2BOHA 3E6PL 3ZYIB 4Y6DB 4CUFA 4ZXYL 1APQA 3TZIA 3TK6B 3HO3A 1GMNA 1IQIL 3SOVA 4LMFA 3ENSA 2WG3C 4Y71B 3QCWA 4Z0KB 4D0EA 1Z6EL 3BT2A 1C5MF 1YO8A 4GU4A 5CS9A 2KNIA 2HORA 1JFNA 1IQKL 3IITB 3QH0A 2W26B 2SPTA 2P3FL 4YT6L 2VRSA 3U7UG 4NG9L 1CEBA 4AQTA 2EI8B 2P3FN 4BTTA 1O5DL 2BOUA 3ZYGA 4HZHA 1DQBA 3TBDA 4JZEL 2W3KB 3Q7DA 2QJ2A 4RRWA 2Y7XB 5CISA 4BXWA 1KDUA 2FZZL 3U73A 3F1SB 3IJEB 4A7IA 2BO2A 1AUTL 1NFYB 2J4IB 1K37A 2H9EC 1B9WA 4IUAA 5F19A 3NXPA 1IGXA 1UZPA 1HAEA 1F0RB 1HPJA 3BT1A 1IQJL 3LTFB 2MGRA 3TK5B 2WPHE 4X8VL 1FF7A 2XBXL 1TPKA 3DEMA 2PF2A 3POYA 1G1SA 2WPIE 2BOXA 1IOXA 1YUFA 5KIRA 3NJPC 1CVWL 5K0HB 2BQ6A 3FBYA 1IQML 1NFXB 1KIVA 1HCGB 2WFXB 5JW1A 5IKQA 3V65B 1W7XL 5E8DA 3CS7L 2FD6A 3N8YB 2M74A
chains in the Genus database with same CATH topology
1URKA 1KLIL 4BVDA 2K2SB 1NQLB 1NT0A 2WPJE 5CKNA 3GCWE 4ZH8B 1LQDA 3HPTA 1KLJL 1TLEA 4CUEA 4ISHL 1U8CB 1W8BL 3KIVA 4A5TS 2BQWA 1EMNA 2XC4L 2J94B 2GD4A 1LMJA 1V3XB 3CA7A 3LN0A 2G00L 5EGMB 5I46L 2TGFA 1HJ7A 2Y7ZB 2AYLA 1TOZA 4MMZB 5CSQA 4RS0A 4BV7A 1B2IA 1PMLA 4CIKA 1HPKA 2J34B 2L0SA 1DDXA 2UWPB 3ELAL 4JZDL 5COXA 4RRXA 1IP0A 1F7EA 2RA0L 4O03A 1IQGL 1XDTR 4Y76B 5JBAE 2DOIA 1Z6CA 1EQGA 1EPJA 1FAKL 1NFUB 2J95B 2FEBA 1FE2A 1EPHA 1WHFA 3SP8A 1FSBA 1CVUA 2P3TA 1CEAA 4A94C 3N8WB 5FDQA 5CP9A 2K2TA 2Y80B 3KK6A 1L5GB 5JBCE 5CS5A 3SOBB 1IJQA 2W2QE 2VVUL 2ADXA 4ZHAB 1EPIA 3KL6B 4TGFA 2VVCK 3KQBL 2WFTA 2Y38A 4RUTA 3SOQA 1WU1B 2WYJB 4XL1A 2J38B 1FAXL 1ZAQA 3KQCL 3MQEA 1I5KA 1P9JA 3V64C 1PK4A 4O02B 1A3PA 1IQEL 2WZPP 4ZXXL 1NZIA 5COEA 2XBVL 4Y79B 1LPZA 1XKAL 2H9EL 4JZFL 1KRNA 1ATDA 4C16A 1JL9A 2UWOB 2KL7A 4Y7AB 1RFNB 3H5CB 1SZBA 1BF9A 2PHBB 5L30L 5L2YL 2P28B 2W2ME 5JVZA 3N8VA 2OYUP 2PUQL 1IOEL 4OTYA 3S6XA 3SW2A 5CS3A 3N8WA 1QFKL 1KSNB 4Y7BB 1F0SB 1NK1A 2VH0B 2RNLA 3TH3L 1CQEA 1NL2A 2RHPA 5CT3A 3KQEL 3K9XA 4O1ZA 4X8SL 2XBWL 5JB9E 1L3YA 4CUDA 1IQLL 2P94L 3PGHA 3KRKA 1APOA 2VJ3A 3LN1A 2MGPA 1LMMA 1PMKA 2P95L 4XLWA 1PRHA 1TPGA 3M37L 1IGZA 4BVWA 2DOHX 2UWLB 3KQDL 2WYGB 2PF1A 1HT8A 1DX5I 1EMOA 2Q1JB 1JBUL 2MHPA 2VWOL 4NA9L 1COUA 1X7AL 1BHTA 5JVYA 5CT1A 3P5BL 1MQ5L 3LC3B 2KV4A 3BPSE 1UZKA 1EQHA 2WPKE 1LPKA 3CENL 5IKVA 2W86A 1K36A 1N1IA 1EZQB 1IQFL 1F7MA 2VH6B 4BTUA 1IQHL 2XBYL 2D1JB 2I9AA 3ZYJB 3F6UL 2Y5FL 2BOKL 2VWMK 2Y82B 1HX2A 1KI0A 3N8ZA 1XKBA 1KLOA 1J9CL 5IKRA 3LAQA 4JYVL 4DURA 4XBMA 1PFXL 2BQ7A 5CKQA 2KB9A 4RRZA 1EGFA 1FJSL 2P16L 2P3UA 1G1QA 5CS1A 1PKRA 3TGFA 3MDLA 3KCGL 1CEJA 1ADXA 3QMOA 1DIYA 2HPPP 4D3CA 5HPGA 1P0SL 4ZAEB 3K65A 3R05A 2EI7B 3MKPA 4MMXB 1GMOA 1NL1A 3HO4A 2W3IB 2YGQA 2W2NE 3FFGL 1NFWB 5IKTA 2WPME 2FLRL 3NTGA 2YGPA 4PH9A 2KJ4A 3C9AC 4BDWA 3ASIA 4JYUL 5KN5C 6COXA 1EBVA 2YGOA 1JV2B 5CT2A 1LPGA 4BVVA 2W2PE 1KIGL 1HRFA 1ATAA 4Z0LA 4YZUB 2FLBL 2B7DL 2VVVL 1EPGA 4Z6AL 2WG4B 1YUGA 4COXA 1ATBA 4M11A 4M10A 2KNFA 1MOXC 1N7DA 2K51A 1Q4GA 3HS7A 1PTHA 1WHEA 5CKMA 1CX2A 3EGFA 4X8TL 1HZ8A 1G2MB 2QJ4A 1PXXA 4NGAL 3LC5B 1ATEA 5JB8E 1OB1C 4OTJA 4BTIA 2DDUA 4FM5A 4X8UL 4BDXA 2PR3B 1YGCL 5L2ZL 5F1AA 1A0HA 2J2UB 1GK5A 3HS6A 3M36L 3N8XA 1NPEB 4ISIL 1G1RA 3Q3KB 1UZJA 1M1XB 1I0UA 1FFMA 4BV5A 3OLTA 1MQ6L 2Y81B 3RR3A 3HS5A 2CJIB 2Y5HL 2NPRA 4D90A 2PK4A 1G1TA 2Y5GL 2VWNL 1IQNL 1XFEA 1DVAL 1G2LB 4G1MB 4KIVA 1IVOC 4LORA 3OLUA 4MMYB 3LIWB 2WPLE 3HO5A 2P93L 2I9BA 3GISX 2XC0L 1HAFA 1PK2A 4BXSA 4BVCA 2XC5L 1YUKB 2VWLL 1UZQA 1U67A 1HREA 2JKHL 1I71A 4YT7L 3FCSB 2EI6B 3LTGD 4D0FA 3N8YA 2FLGA 4RRYA 1EAIC 3NTBA 2P26A 2BZ6L 1CCVA 3HN4A 2HPQP 3NT1A 3CFWA 4E1GA 1PGEA 4CSYA 2OYEP 2W2OE 4NZQA 1CCFA 3GCXE 1GP9A 5JBBE 2F9BL 2K4RA 1HT5A 2BMGA 2BOHA 3E6PL 3ZYIB 4Y6DB 4CUFA 4ZXYL 1APQA 3TZIA 3TK6B 3HO3A 1GMNA 1IQIL 3SOVA 4LMFA 3ENSA 2WG3C 4Y71B 3QCWA 4Z0KB 4D0EA 1Z6EL 3BT2A 1C5MF 1YO8A 5CS9A 2KNIA 1JFNA 1IQKL 3IITB 3QH0A 2W26B 2SPTA 2P3FL 4YT6L 3U7UG 1CEBA 4NG9L 4AQTA 2EI8B 2P3FN 4BTTA 1O5DL 2BOUA 3ZYGA 4HZHA 1DQBA 3TBDA 4JZEL 2W3KB 3Q7DA 2QJ2A 4RRWA 2Y7XB 5CISA 4BXWA 1KDUA 2FZZL 3U73A 3F1SB 3IJEB 4A7IA 2BO2A 1AUTL 1NFYB 2J4IB 1K37A 2H9EC 1B9WA 4IUAA 5F19A 3NXPA 1IGXA 1UZPA 1HAEA 1F0RB 1HPJA 3BT1A 1IQJL 3LTFB 2MGRA 3TK5B 2WPHE 4X8VL 1FF7A 2XBXL 1TPKA 3DEMA 2PF2A 3POYA 1G1SA 2WPIE 2BOXA 1IOXA 1YUFA 5KIRA 3NJPC 1CVWL 5K0HB 2BQ6A 3FBYA 1IQML 1NFXB 1KIVA 1HCGB 2WFXB 5JW1A 5IKQA 3V65B 1W7XL 5E8DA 3CS7L 2FD6A 3N8YB 2M74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URK A;  1KLI L;  4BVD A;  2K2S B;  1NQL B;  1NT0 A;  2WPJ E;  5CKN A;  3GCW E;  4ZH8 B;  1LQD A;  3HPT A;  1KLJ L;  1TLE A;  4CUE A;  4ISH L;  1U8C B;  1W8B L;  3KIV A;  4A5T S;  2BQW A;  1EMN A;  2XC4 L;  2J94 B;  2GD4 A;  1LMJ A;  1V3X B;  3CA7 A;  3LN0 A;  2G00 L;  5EGM B;  5I46 L;  2TGF A;  1HJ7 A;  2Y7Z B;  2AYL A;  1TOZ A;  4MMZ B;  5CSQ A;  4RS0 A;  4BV7 A;  1B2I A;  1PML A;  4CIK A;  1HPK A;  2J34 B;  2L0S A;  1DDX A;  2UWP B;  3ELA L;  4JZD L;  5COX A;  4RRX A;  1IP0 A;  1F7E A;  2RA0 L;  4O03 A;  1IQG L;  1XDT R;  4Y76 B;  5JBA E;  2DOI A;  1Z6C A;  1EQG A;  1EPJ A;  1FAK L;  1NFU B;  2J95 B;  2FEB A;  1FE2 A;  1EPH A;  1WHF A;  3SP8 A;  1FSB A;  1CVU A;  2P3T A;  1CEA A;  3N8W B;  5FDQ A;  5CP9 A;  2K2T A;  2Y80 B;  3KK6 A;  1L5G B;  5JBC E;  5CS5 A;  3SOB B;  1IJQ A;  2W2Q E;  2VVU L;  2ADX A;  4ZHA B;  1EPI A;  3KL6 B;  4TGF A;  2VVC K;  3KQB L;  2WFT A;  2Y38 A;  4RUT A;  3SOQ A;  1WU1 B;  2WYJ B;  4XL1 A;  2J38 B;  1FAX L;  1ZAQ A;  3KQC L;  3MQE A;  1I5K A;  1P9J A;  3V64 C;  1PK4 A;  4O02 B;  1A3P A;  1IQE L;  4ZXX L;  1NZI A;  5COE A;  2XBV L;  4Y79 B;  1LPZ A;  1XKA L;  2H9E L;  4JZF L;  1KRN A;  1ATD A;  4C16 A;  1JL9 A;  2UWO B;  2KL7 A;  4Y7A B;  1RFN B;  3H5C B;  1SZB A;  1BF9 A;  2PHB B;  5L30 L;  5L2Y L;  2P28 B;  2W2M E;  5JVZ A;  3N8V A;  2OYU P;  2PUQ L;  1IOE L;  4OTY A;  3SW2 A;  5CS3 A;  3N8W A;  1QFK L;  1KSN B;  4Y7B B;  1F0S B;  1NK1 A;  2VH0 B;  2RNL A;  3TH3 L;  1CQE A;  1NL2 A;  2RHP A;  5CT3 A;  3KQE L;  3K9X A;  4O1Z A;  4X8S L;  2XBW L;  5JB9 E;  1L3Y A;  4CUD A;  1IQL L;  2P94 L;  3PGH A;  3KRK A;  1APO A;  2VJ3 A;  3LN1 A;  2MGP A;  1PMK A;  2P95 L;  4XLW A;  1PRH A;  1TPG A;  3M37 L;  1IGZ A;  4BVW A;  2DOH X;  2UWL B;  3KQD L;  2WYG B;  2PF1 A;  1HT8 A;  1DX5 I;  1EMO A;  2Q1J B;  1JBU L;  2MHP A;  2VWO L;  4NA9 L;  1COU A;  1X7A L;  1BHT A;  5JVY A;  5CT1 A;  3P5B L;  1MQ5 L;  3LC3 B;  2KV4 A;  3BPS E;  1UZK A;  1EQH A;  2WPK E;  1LPK A;  3CEN L;  5IKV A;  2W86 A;  1K36 A;  1N1I A;  1EZQ B;  1IQF L;  1F7M A;  2VH6 B;  4BTU A;  1IQH L;  2XBY L;  2D1J B;  2I9A A;  3ZYJ B;  3F6U L;  2Y5F L;  2BOK L;  2VWM K;  2Y82 B;  1HX2 A;  1KI0 A;  3N8Z A;  1XKB A;  1KLO A;  1J9C L;  5IKR A;  3LAQ A;  4JYV L;  4DUR A;  4XBM A;  1PFX L;  2BQ7 A;  5CKQ A;  2KB9 A;  4RRZ A;  1EGF A;  1FJS L;  2P16 L;  2P3U A;  1G1Q A;  5CS1 A;  1PKR A;  3TGF A;  3MDL A;  3KCG L;  1CEJ A;  1ADX A;  3QMO A;  1DIY A;  2HPP P;  4D3C A;  5HPG A;  1P0S L;  4ZAE B;  3K65 A;  3R05 A;  2EI7 B;  3MKP A;  4MMX B;  1GMO A;  1NL1 A;  3HO4 A;  2W3I B;  2W2N E;  3FFG L;  1NFW B;  5IKT A;  2WPM E;  2FLR L;  3NTG A;  2YGP A;  4PH9 A;  2KJ4 A;  3C9A C;  4BDW A;  3ASI A;  4JYU L;  5KN5 C;  6COX A;  1EBV A;  2YGO A;  1JV2 B;  5CT2 A;  1LPG A;  4BVV A;  2W2P E;  1KIG L;  1HRF A;  1ATA A;  4Z0L A;  4YZU B;  2FLB L;  2B7D L;  2VVV L;  1EPG A;  4Z6A L;  2WG4 B;  1YUG A;  4COX A;  1ATB A;  4M11 A;  4M10 A;  2KNF A;  1MOX C;  1N7D A;  2K51 A;  1Q4G A;  3HS7 A;  1PTH A;  1WHE A;  5CKM A;  1CX2 A;  3EGF A;  4X8T L;  1HZ8 A;  1G2M B;  2QJ4 A;  1PXX A;  4NGA L;  3LC5 B;  1ATE A;  5JB8 E;  1OB1 C;  4OTJ A;  4BTI A;  2DDU A;  4FM5 A;  4X8U L;  4BDX A;  2PR3 B;  1YGC L;  5L2Z L;  5F1A A;  1A0H A;  2J2U B;  1GK5 A;  3HS6 A;  3M36 L;  3N8X A;  1NPE B;  4ISI L;  1G1R A;  3Q3K B;  1UZJ A;  1M1X B;  1I0U A;  1FFM A;  4BV5 A;  3OLT A;  1MQ6 L;  2Y81 B;  3RR3 A;  3HS5 A;  2CJI B;  2Y5H L;  2NPR A;  4D90 A;  2PK4 A;  1G1T A;  2Y5G L;  2VWN L;  1IQN L;  1XFE A;  1DVA L;  1G2L B;  4G1M B;  4KIV A;  1IVO C;  4LOR A;  3OLU A;  4MMY B;  3LIW B;  2WPL E;  3HO5 A;  2P93 L;  2I9B A;  3GIS X;  2XC0 L;  1HAF A;  1PK2 A;  4BXS A;  4BVC A;  2XC5 L;  1YUK B;  2VWL L;  1UZQ A;  1U67 A;  1HRE A;  2JKH L;  1I71 A;  4YT7 L;  3FCS B;  2EI6 B;  3LTG D;  4D0F A;  3N8Y A;  2FLG A;  4RRY A;  1EAI C;  3NTB A;  2P26 A;  2BZ6 L;  1CCV A;  3HN4 A;  2HPQ P;  3NT1 A;  3CFW A;  4E1G A;  1PGE A;  4CSY A;  2OYE P;  2W2O E;  4NZQ A;  1CCF A;  3GCX E;  1GP9 A;  5JBB E;  2F9B L;  2K4R A;  1HT5 A;  2BMG A;  2BOH A;  3E6P L;  3ZYI B;  4Y6D B;  4CUF A;  4ZXY L;  1APQ A;  3TZI A;  3TK6 B;  3HO3 A;  1GMN A;  1IQI L;  3SOV A;  4LMF A;  3ENS A;  2WG3 C;  4Y71 B;  3QCW A;  4Z0K B;  4D0E A;  1Z6E L;  3BT2 A;  1C5M F;  1YO8 A;  5CS9 A;  1JFN A;  1IQK L;  3IIT B;  3QH0 A;  2W26 B;  2SPT A;  2P3F L;  4YT6 L;  3U7U G;  1CEB A;  4NG9 L;  4AQT A;  2EI8 B;  2P3F N;  4BTT A;  1O5D L;  2BOU A;  3ZYG A;  4HZH A;  1DQB A;  3TBD A;  4JZE L;  2W3K B;  3Q7D A;  2QJ2 A;  4RRW A;  2Y7X B;  5CIS A;  4BXW A;  1KDU A;  2FZZ L;  3U73 A;  3F1S B;  3IJE B;  4A7I A;  2BO2 A;  1AUT L;  1NFY B;  2J4I B;  1K37 A;  1B9W A;  4IUA A;  5F19 A;  3NXP A;  1IGX A;  1UZP A;  1HAE A;  1F0R B;  1HPJ A;  3BT1 A;  1IQJ L;  3LTF B;  2MGR A;  3TK5 B;  2WPH E;  4X8V L;  1FF7 A;  2XBX L;  1TPK A;  3DEM A;  2PF2 A;  3POY A;  1G1S A;  2WPI E;  2BOX A;  1IOX A;  1YUF A;  5KIR A;  3NJP C;  1CVW L;  5K0H B;  2BQ6 A;  3FBY A;  1IQM L;  1NFX B;  1KIV A;  1HCG B;  2WFX B;  5JW1 A;  5IKQ A;  3V65 B;  1W7X L;  5E8D A;  3CS7 L;  2FD6 A;  3N8Y B;  2M74 A; 
#chains in the Genus database with same CATH topology
 1URK A;  1KLI L;  4BVD A;  2K2S B;  1NQL B;  1NT0 A;  2WPJ E;  5CKN A;  3GCW E;  4ZH8 B;  1LQD A;  3HPT A;  1KLJ L;  1TLE A;  4CUE A;  4ISH L;  1U8C B;  1W8B L;  3KIV A;  4A5T S;  2BQW A;  1EMN A;  2XC4 L;  2J94 B;  2GD4 A;  1LMJ A;  1V3X B;  3CA7 A;  3LN0 A;  2G00 L;  5EGM B;  5I46 L;  2BSF A;  2TGF A;  1HJ7 A;  2Y7Z B;  2AYL A;  1TOZ A;  4MMZ B;  5CSQ A;  4RS0 A;  4BV7 A;  1B2I A;  1PML A;  4CIK A;  1HPK A;  2J34 B;  2L0S A;  1DDX A;  2UWP B;  3ELA L;  1V1H A;  4JZD L;  5COX A;  4RRX A;  1IP0 A;  1F7E A;  2RA0 L;  4O03 A;  1IQG L;  1XDT R;  4Y76 B;  5JBA E;  2DOI A;  1Z6C A;  1EQG A;  1EPJ A;  1FAK L;  1NFU B;  2J95 B;  2FEB A;  1FE2 A;  1EPH A;  1WHF A;  3SP8 A;  1FSB A;  1CVU A;  2P3T A;  1CEA A;  4A94 C;  3N8W B;  4GU3 A;  5FDQ A;  2BT7 A;  5CP9 A;  2K2T A;  2Y80 B;  3KK6 A;  1L5G B;  5JBC E;  5CS5 A;  3SOB B;  1IJQ A;  2W2Q E;  2VVU L;  2ADX A;  4ZHA B;  1EPI A;  3KL6 B;  4TGF A;  2VVC K;  3KQB L;  2WFT A;  2Y38 A;  4RUT A;  3SOQ A;  1WU1 B;  2WYJ B;  4XL1 A;  2J38 B;  1FAX L;  1ZAQ A;  3KQC L;  3MQE A;  1I5K A;  1P9J A;  3V64 C;  1PK4 A;  4O02 B;  1A3P A;  1IQE L;  2WZP P;  1LK9 A;  4ZXX L;  1NZI A;  5COE A;  2XBV L;  1QIU A;  1LPZ A;  4Y79 B;  1XKA L;  2H9E L;  4JZF L;  1KRN A;  1ATD A;  4C16 A;  1KKE A;  1JL9 A;  2UWO B;  2KL7 A;  4Y7A B;  1RFN B;  3H5C B;  1SZB A;  1BF9 A;  2PHB B;  5L30 L;  5L2Y L;  2P28 B;  2W2M E;  5JVZ A;  3N8V A;  2OYU P;  2PUQ L;  1IOE L;  4OTY A;  3S6X A;  3SW2 A;  5CS3 A;  3N8W A;  1QFK L;  1KSN B;  4Y7B B;  1F0S B;  1NK1 A;  2VH0 B;  1V1I A;  2RNL A;  3TH3 L;  1CQE A;  1NL2 A;  2RHP A;  5CT3 A;  3KQE L;  3K9X A;  4O1Z A;  4X8S L;  2XBW L;  5JB9 E;  1L3Y A;  4CUD A;  1IQL L;  2P94 L;  3PGH A;  3KRK A;  1APO A;  2VJ3 A;  3LN1 A;  2MGP A;  1LMM A;  1PMK A;  2P95 L;  4XLW A;  1PRH A;  1TPG A;  3M37 L;  1IGZ A;  4BVW A;  2DOH X;  2UWL B;  3KQD L;  2WYG B;  2JJL A;  2PF1 A;  1HT8 A;  1DX5 I;  1EMO A;  2Q1J B;  1JBU L;  2MHP A;  2VWO L;  4NA9 L;  1COU A;  1X7A L;  1BHT A;  5JVY A;  5CT1 A;  3P5B L;  1MQ5 L;  3LC3 B;  2KV4 A;  3BPS E;  1UZK A;  1EQH A;  2WPK E;  1LPK A;  3CEN L;  5IKV A;  2W86 A;  1K36 A;  1N1I A;  1EZQ B;  1IQF L;  1F7M A;  2VH6 B;  4BTU A;  1IQH L;  2XBY L;  2D1J B;  2I9A A;  3ZYJ B;  3F6U L;  2Y5F L;  2BOK L;  2VWM K;  2Y82 B;  1HX2 A;  1KI0 A;  3N8Z A;  1XKB A;  1KLO A;  1J9C L;  5IKR A;  3LAQ A;  4JYV L;  4DUR A;  4XBM A;  1PFX L;  2BQ7 A;  5CKQ A;  2KB9 A;  4RRZ A;  1EGF A;  1FJS L;  2P16 L;  2P3U A;  1G1Q A;  5CS1 A;  1PKR A;  3TGF A;  3MDL A;  3KCG L;  1CEJ A;  1ADX A;  3QMO A;  2BT8 A;  1DIY A;  2HPP P;  4D3C A;  5HPG A;  1P0S L;  4ZAE B;  3K65 A;  3R05 A;  2EI7 B;  3MKP A;  4MMX B;  1GMO A;  1NL1 A;  3HO4 A;  2W3I B;  2YGQ A;  2W2N E;  3FFG L;  1NFW B;  5IKT A;  2WPM E;  2FLR L;  3NTG A;  2YGP A;  4PH9 A;  2KJ4 A;  3C9A C;  4BDW A;  3ASI A;  4JYU L;  5KN5 C;  6COX A;  1EBV A;  2YGO A;  1JV2 B;  5CT2 A;  1LPG A;  4BVV A;  2W2P E;  1KIG L;  1HRF A;  1ATA A;  4Z0L A;  4YZU B;  2FLB L;  2B7D L;  2VVV L;  1EPG A;  4Z6A L;  2WG4 B;  1YUG A;  4COX A;  1ATB A;  4M11 A;  4M10 A;  2KNF A;  1MOX C;  1N7D A;  2K51 A;  1Q4G A;  3HS7 A;  1PTH A;  1WHE A;  5CKM A;  1CX2 A;  3EGF A;  4X8T L;  1HZ8 A;  1G2M B;  2QJ4 A;  1PXX A;  4NGA L;  3LC5 B;  1ATE A;  5JB8 E;  1OB1 C;  4OTJ A;  4BTI A;  2DDU A;  4FM5 A;  4X8U L;  4BDX A;  2PR3 B;  1YGC L;  5L2Z L;  5F1A A;  1A0H A;  2J2U B;  1GK5 A;  3HS6 A;  3M36 L;  3N8X A;  1NPE B;  4ISI L;  1G1R A;  3Q3K B;  1UZJ A;  1M1X B;  1I0U A;  1FFM A;  4BV5 A;  3OLT A;  1MQ6 L;  2Y81 B;  3RR3 A;  3HS5 A;  2CJI B;  2Y5H L;  2NPR A;  4D90 A;  2PK4 A;  1G1T A;  2Y5G L;  2VWN L;  1IQN L;  1XFE A;  1DVA L;  1G2L B;  4G1M B;  4KIV A;  1IVO C;  4LOR A;  3OLU A;  4MMY B;  3LIW B;  2WPL E;  3HO5 A;  2P93 L;  2I9B A;  3GIS X;  2XC0 L;  1HAF A;  1PK2 A;  4BXS A;  4BVC A;  2XC5 L;  1YUK B;  2VWL L;  1UZQ A;  1U67 A;  1HRE A;  2JKH L;  1I71 A;  4YT7 L;  3FCS B;  2EI6 B;  3LTG D;  4D0F A;  3N8Y A;  2FLG A;  4RRY A;  1EAI C;  3NTB A;  2P26 A;  2BZ6 L;  1CCV A;  3HN4 A;  2HPQ P;  3NT1 A;  2HOX A;  3CFW A;  4E1G A;  1PGE A;  4CSY A;  2OYE P;  2W2O E;  4NZQ A;  1CCF A;  3GCX E;  1GP9 A;  5JBB E;  2F9B L;  2K4R A;  1HT5 A;  2BMG A;  2BOH A;  3E6P L;  3ZYI B;  4Y6D B;  4CUF A;  4ZXY L;  1APQ A;  3TZI A;  3TK6 B;  3HO3 A;  1GMN A;  1IQI L;  3SOV A;  4LMF A;  3ENS A;  2WG3 C;  4Y71 B;  3QCW A;  4Z0K B;  4D0E A;  1Z6E L;  3BT2 A;  1C5M F;  1YO8 A;  4GU4 A;  5CS9 A;  2KNI A;  2HOR A;  1JFN A;  1IQK L;  3IIT B;  3QH0 A;  2W26 B;  2SPT A;  2P3F L;  4YT6 L;  2VRS A;  3U7U G;  4NG9 L;  1CEB A;  4AQT A;  2EI8 B;  2P3F N;  4BTT A;  1O5D L;  2BOU A;  3ZYG A;  4HZH A;  1DQB A;  3TBD A;  4JZE L;  2W3K B;  3Q7D A;  2QJ2 A;  4RRW A;  2Y7X B;  5CIS A;  4BXW A;  1KDU A;  2FZZ L;  3U73 A;  3F1S B;  3IJE B;  4A7I A;  2BO2 A;  1AUT L;  1NFY B;  2J4I B;  1K37 A;  2H9E C;  1B9W A;  4IUA A;  5F19 A;  3NXP A;  1IGX A;  1UZP A;  1HAE A;  1F0R B;  1HPJ A;  3BT1 A;  1IQJ L;  3LTF B;  2MGR A;  3TK5 B;  2WPH E;  4X8V L;  1FF7 A;  2XBX L;  1TPK A;  3DEM A;  2PF2 A;  3POY A;  1G1S A;  2WPI E;  2BOX A;  1IOX A;  1YUF A;  5KIR A;  3NJP C;  1CVW L;  5K0H B;  2BQ6 A;  3FBY A;  1IQM L;  1NFX B;  1KIV A;  1HCG B;  2WFX B;  5JW1 A;  5IKQ A;  3V65 B;  1W7X L;  5E8D A;  3CS7 L;  2FD6 A;  3N8Y B;  2M74 A; 
#chains in the Genus database with same CATH homology
 1URK A;  1KLI L;  4BVD A;  2K2S B;  1NQL B;  1NT0 A;  2WPJ E;  5CKN A;  3GCW E;  4ZH8 B;  1LQD A;  3HPT A;  1KLJ L;  1TLE A;  4CUE A;  4ISH L;  1U8C B;  1W8B L;  3KIV A;  4A5T S;  2BQW A;  1EMN A;  2XC4 L;  2J94 B;  2GD4 A;  1LMJ A;  1V3X B;  3CA7 A;  3LN0 A;  2G00 L;  5EGM B;  5I46 L;  2TGF A;  1HJ7 A;  2Y7Z B;  2AYL A;  1TOZ A;  4MMZ B;  5CSQ A;  4RS0 A;  4BV7 A;  1B2I A;  1PML A;  4CIK A;  1HPK A;  2J34 B;  2L0S A;  1DDX A;  2UWP B;  3ELA L;  4JZD L;  5COX A;  4RRX A;  1IP0 A;  1F7E A;  2RA0 L;  4O03 A;  1IQG L;  1XDT R;  4Y76 B;  5JBA E;  2DOI A;  1Z6C A;  1EQG A;  1EPJ A;  1FAK L;  1NFU B;  2J95 B;  2FEB A;  1FE2 A;  1EPH A;  1WHF A;  3SP8 A;  1FSB A;  1CVU A;  2P3T A;  1CEA A;  4A94 C;  3N8W B;  5FDQ A;  5CP9 A;  2K2T A;  2Y80 B;  3KK6 A;  1L5G B;  5JBC E;  5CS5 A;  3SOB B;  1IJQ A;  2W2Q E;  2VVU L;  2ADX A;  4ZHA B;  1EPI A;  3KL6 B;  4TGF A;  2VVC K;  3KQB L;  2WFT A;  2Y38 A;  4RUT A;  3SOQ A;  1WU1 B;  2WYJ B;  4XL1 A;  2J38 B;  1FAX L;  1ZAQ A;  3KQC L;  3MQE A;  1I5K A;  1P9J A;  3V64 C;  1PK4 A;  4O02 B;  1A3P A;  1IQE L;  2WZP P;  4ZXX L;  1NZI A;  5COE A;  2XBV L;  4Y79 B;  1LPZ A;  1XKA L;  2H9E L;  4JZF L;  1KRN A;  1ATD A;  4C16 A;  1JL9 A;  2UWO B;  2KL7 A;  4Y7A B;  1RFN B;  3H5C B;  1SZB A;  1BF9 A;  2PHB B;  5L30 L;  5L2Y L;  2P28 B;  2W2M E;  5JVZ A;  3N8V A;  2OYU P;  2PUQ L;  1IOE L;  4OTY A;  3S6X A;  3SW2 A;  5CS3 A;  3N8W A;  1QFK L;  1KSN B;  4Y7B B;  1F0S B;  1NK1 A;  2VH0 B;  2RNL A;  3TH3 L;  1CQE A;  1NL2 A;  2RHP A;  5CT3 A;  3KQE L;  3K9X A;  4O1Z A;  4X8S L;  2XBW L;  5JB9 E;  1L3Y A;  4CUD A;  1IQL L;  2P94 L;  3PGH A;  3KRK A;  1APO A;  2VJ3 A;  3LN1 A;  2MGP A;  1LMM A;  1PMK A;  2P95 L;  4XLW A;  1PRH A;  1TPG A;  3M37 L;  1IGZ A;  4BVW A;  2DOH X;  2UWL B;  3KQD L;  2WYG B;  2PF1 A;  1HT8 A;  1DX5 I;  1EMO A;  2Q1J B;  1JBU L;  2MHP A;  2VWO L;  4NA9 L;  1COU A;  1X7A L;  1BHT A;  5JVY A;  5CT1 A;  3P5B L;  1MQ5 L;  3LC3 B;  2KV4 A;  3BPS E;  1UZK A;  1EQH A;  2WPK E;  1LPK A;  3CEN L;  5IKV A;  2W86 A;  1K36 A;  1N1I A;  1EZQ B;  1IQF L;  1F7M A;  2VH6 B;  4BTU A;  1IQH L;  2XBY L;  2D1J B;  2I9A A;  3ZYJ B;  3F6U L;  2Y5F L;  2BOK L;  2VWM K;  2Y82 B;  1HX2 A;  1KI0 A;  3N8Z A;  1XKB A;  1KLO A;  1J9C L;  5IKR A;  3LAQ A;  4JYV L;  4DUR A;  4XBM A;  1PFX L;  2BQ7 A;  5CKQ A;  2KB9 A;  4RRZ A;  1EGF A;  1FJS L;  2P16 L;  2P3U A;  1G1Q A;  5CS1 A;  1PKR A;  3TGF A;  3MDL A;  3KCG L;  1CEJ A;  1ADX A;  3QMO A;  1DIY A;  2HPP P;  4D3C A;  5HPG A;  1P0S L;  4ZAE B;  3K65 A;  3R05 A;  2EI7 B;  3MKP A;  4MMX B;  1GMO A;  1NL1 A;  3HO4 A;  2W3I B;  2YGQ A;  2W2N E;  3FFG L;  1NFW B;  5IKT A;  2WPM E;  2FLR L;  3NTG A;  2YGP A;  4PH9 A;  2KJ4 A;  3C9A C;  4BDW A;  3ASI A;  4JYU L;  5KN5 C;  6COX A;  1EBV A;  2YGO A;  1JV2 B;  5CT2 A;  1LPG A;  4BVV A;  2W2P E;  1KIG L;  1HRF A;  1ATA A;  4Z0L A;  4YZU B;  2FLB L;  2B7D L;  2VVV L;  1EPG A;  4Z6A L;  2WG4 B;  1YUG A;  4COX A;  1ATB A;  4M11 A;  4M10 A;  2KNF A;  1MOX C;  1N7D A;  2K51 A;  1Q4G A;  3HS7 A;  1PTH A;  1WHE A;  5CKM A;  1CX2 A;  3EGF A;  4X8T L;  1HZ8 A;  1G2M B;  2QJ4 A;  1PXX A;  4NGA L;  3LC5 B;  1ATE A;  5JB8 E;  1OB1 C;  4OTJ A;  4BTI A;  2DDU A;  4FM5 A;  4X8U L;  4BDX A;  2PR3 B;  1YGC L;  5L2Z L;  5F1A A;  1A0H A;  2J2U B;  1GK5 A;  3HS6 A;  3M36 L;  3N8X A;  1NPE B;  4ISI L;  1G1R A;  3Q3K B;  1UZJ A;  1M1X B;  1I0U A;  1FFM A;  4BV5 A;  3OLT A;  1MQ6 L;  2Y81 B;  3RR3 A;  3HS5 A;  2CJI B;  2Y5H L;  2NPR A;  4D90 A;  2PK4 A;  1G1T A;  2Y5G L;  2VWN L;  1IQN L;  1XFE A;  1DVA L;  1G2L B;  4G1M B;  4KIV A;  1IVO C;  4LOR A;  3OLU A;  4MMY B;  3LIW B;  2WPL E;  3HO5 A;  2P93 L;  2I9B A;  3GIS X;  2XC0 L;  1HAF A;  1PK2 A;  4BXS A;  4BVC A;  2XC5 L;  1YUK B;  2VWL L;  1UZQ A;  1U67 A;  1HRE A;  2JKH L;  1I71 A;  4YT7 L;  3FCS B;  2EI6 B;  3LTG D;  4D0F A;  3N8Y A;  2FLG A;  4RRY A;  1EAI C;  3NTB A;  2P26 A;  2BZ6 L;  1CCV A;  3HN4 A;  2HPQ P;  3NT1 A;  3CFW A;  4E1G A;  1PGE A;  4CSY A;  2OYE P;  2W2O E;  4NZQ A;  1CCF A;  3GCX E;  1GP9 A;  5JBB E;  2F9B L;  2K4R A;  1HT5 A;  2BMG A;  2BOH A;  3E6P L;  3ZYI B;  4Y6D B;  4CUF A;  4ZXY L;  1APQ A;  3TZI A;  3TK6 B;  3HO3 A;  1GMN A;  1IQI L;  3SOV A;  4LMF A;  3ENS A;  2WG3 C;  4Y71 B;  3QCW A;  4Z0K B;  4D0E A;  1Z6E L;  3BT2 A;  1C5M F;  1YO8 A;  5CS9 A;  2KNI A;  1JFN A;  1IQK L;  3IIT B;  3QH0 A;  2W26 B;  2SPT A;  2P3F L;  4YT6 L;  3U7U G;  1CEB A;  4NG9 L;  4AQT A;  2EI8 B;  2P3F N;  4BTT A;  1O5D L;  2BOU A;  3ZYG A;  4HZH A;  1DQB A;  3TBD A;  4JZE L;  2W3K B;  3Q7D A;  2QJ2 A;  4RRW A;  2Y7X B;  5CIS A;  4BXW A;  1KDU A;  2FZZ L;  3U73 A;  3F1S B;  3IJE B;  4A7I A;  2BO2 A;  1AUT L;  1NFY B;  2J4I B;  1K37 A;  2H9E C;  1B9W A;  4IUA A;  5F19 A;  3NXP A;  1IGX A;  1UZP A;  1HAE A;  1F0R B;  1HPJ A;  3BT1 A;  1IQJ L;  3LTF B;  2MGR A;  3TK5 B;  2WPH E;  4X8V L;  1FF7 A;  2XBX L;  1TPK A;  3DEM A;  2PF2 A;  3POY A;  1G1S A;  2WPI E;  2BOX A;  1IOX A;  1YUF A;  5KIR A;  3NJP C;  1CVW L;  5K0H B;  2BQ6 A;  3FBY A;  1IQM L;  1NFX B;  1KIV A;  1HCG B;  2WFX B;  5JW1 A;  5IKQ A;  3V65 B;  1W7X L;  5E8D A;  3CS7 L;  2FD6 A;  3N8Y B;  2M74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...