2I9BA

Crystal structure of atf-urokinase receptor complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
CDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 24
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2i9bA01
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 2i9bA02
1KIVA 4Z0KB 3N8WA 2W2OE 4X8UL 2K4RA 1EPHA 1NFYB 5CS9A 2P3FN 5IKVA 3BT1A 3HO5A 2QJ4A 2Y7ZB 3Q7DA 4JYVL 3Q3KB 1IQHL 2FZZL 2OYEP 4G1MB 5CT1A 4JYUL 1FAXL 2WPJE 5JBBE 5JB9E 1U67A 1APOA 1MQ6L 1G2LB 1YGCL 5IKTA 4RS0A 1OB1C 1J9CL 1CQEA 1ADXA 2FLRL 1HPJA 2WG4B 2MHPA 1V3XB 2P93L 5HPGA 1NFWB 2P3TA 1EGFA 2NPRA 3TH3L 2J94B 5I46L 2FD6A 2WPLE 4X8TL 1IQEL 2WPHE 4CIKA 1F0RB 1G1TA 3HS7A 3SW2A 1B2IA 3TK6B 1PK4A 4YT7L 4HZHA 1PMKA 1XKAL 4OTYA 3NXPA 3CENL 1CVWL 4BDWA 2WFTA 2VWOL 1LPGA 2RA0L 3N8ZA 4O02B 3MKPA 5CP9A 5CS5A 1NZIA 5CKQA 2DOHX 1JL9A 2J34B 1DQBA 2CJIB 2W2PE 4E1GA 2J95B 1IQJL 1Z6CA 1G1QA 1FSBA 3HO4A 3V65B 3TBDA 1CCVA 3HS5A 3M37L 4RRWA 2W26B 2XBXL 1KLOA 2FLGA 4M11A 3POYA 1HAEA 2VVUL 1PTHA 5CT3A 2RNLA 3BPSE 1APQA 3KQCL 2J4IB 1PMLA 5JVYA 2P26A 3ZYGA 3N8YA 5KIRA 2PUQL 2PHBB 2HPPP 1C5MF 2H9EL 1LMJA 1HJ7A 2Y5FL 1YUFA 1YO8A 1KI0A 1HCGB 2W3KB 3TGFA 4ISHL 3HN4A 2VH6B 4PH9A 1NQLB 3QMOA 4RUTA 1ATEA 4BDXA 4ZH8B 4XBMA 3SOVA 5JVZA 1KDUA 2P28B 2SPTA 2WPIE 1UZKA 1KRNA 4ZXYL 2VWNL 1P9JA 3QCWA 2XC4L 1LPZA 4IUAA 5JW1A 3M36L 1Z6EL 2PF1A 4MMZB 4O1ZA 4NZQA 1FFMA 1DVAL 1GK5A 1N1IA 4BV7A 3KQEL 1IQNL 1BHTA 1CEBA 3F6UL 5JB8E 1WU1B 1EPIA 3P5BL 1HT5A 3RR3A 1XFEA 2TGFA 2YGPA 2WG3C 4Z6AL 1XDTR 2BQWA 4RRXA 2BOXA 3N8WB 3N8XA 3LAQA 5JBAE 2WFXB 1L3YA 1O5DL 1ZAQA 3FFGL 1MQ5L 2UWLB 1PKRA 1NPEB 2YGOA 3KQDL 4X8SL 1JBUL 1IQLL 1Q4GA 4MMYB 1N7DA 1ATBA 2KV4A 2MGRA 4BTTA 1IOEL 5CKMA 1UZPA 2Y38A 1IGXA 1HREA 5L30L 2VVVL 4BTUA 1EQGA 2Q1JB 1IGZA 1AUTL 3SOBB 3LN1A 3MQEA 5CISA 1SZBA 1TOZA 1G1SA 1HRFA 1GP9A 1QFKL 1X7AL 4TGFA 4Y76B 3GISX 1EPJA 2HPQP 2K2SB 2P95L 3ENSA 2L0SA 2DDUA 2VWMK 2BOHA 4LMFA 4O03A 2PK4A 2WPKE 3U73A 2W2ME 4BTIA 4A5TS 3KCGL 3KK6A 1FJSL 3F1SB 2KJ4A 1G2MB 1TLEA 2XBYL 2PR3B 1NFUB 4BXSA 1U8CB 1CEAA 1TPGA 1I0UA 2VJ3A 1IQKL 4A7IA 4BVDA 3KIVA 4ISIL 3FBYA 4Y7BB 3IJEB 5CS3A 4LORA 4Y7AB 6COXA 2J38B 2P3UA 5F19A 3CA7A 5FDQA 1WHEA 2BZ6L 3H5CB 3EGFA 1B9WA 1BF9A 1FF7A 3CS7L 2BO2A 1HT8A 3LTGD 1CEJA 1YUGA 1GMOA 2G00L 4YT6L 4D0FA 5IKQA 4D90A 2B7DL 2VVCK 1HX2A 4XLWA 2Y5HL 3K9XA 2AYLA 3ELAL 1UZQA 4ZAEB 1IQGL 2W2QE 1I5KA 2UWPB 2XBVL 3TZIA 1P0SL 4AQTA 5KN5C 1IQIL 3LN0A 2DOIA 3QH0A 2KL7A 4MMXB 4NA9L 3IITB 1CCFA 5CS1A 2XC0L 2Y5GL 3KL6B 2PF2A 4JZEL 1LQDA 2Y7XB 2VWLL 2MGPA 4C16A 4OTJA 3NJPC 4D3CA 3ZYIB 4JZFL 1DDXA 4BVWA 2WYJB 2Y80B 1K37A 2K2TA 4Z0LA 1L5GB 1NL1A 4RRZA 4CUDA 3HPTA 2KB9A 1EBVA 1HAFA 2W2NE 1TPKA 4XL1A 1WHFA 3ZYJB 1ATAA 2P94L 4NG9L 3OLUA 5CSQA 1JFNA 1UZJA 4Y79B 1IP0A 3LTFB 1CVUA 1LPKA 1W7XL 4COXA 2K51A 1IVOC 1ATDA 4Y71B 3OLTA 2WPME 4ZHAB 1FAKL 3LIWB 2XBWL 4BXWA 1NL2A 1KLIL 4KIVA 5E8DA 5COEA 1KLJL 1A3PA 4CUFA 4BVVA 1IJQA 1EQHA 1HZ8A 4FM5A 3PGHA 1F7EA 4Y6DB 5K0HB 1G1RA 1EPGA 3HO3A 2I9AA 2J2UB 5CT2A 2RHPA 3TK5B 2Y82B 4X8VL 2QJ2A 3N8YB 1HPKA 2XC5L 3NTBA 4BV5A 3SOQA 2FEBA 4ZXXL 1NFXB 1M1XB 1JV2B 1URKA 2GD4A 1MOXC 2D1JB 2BOKL 3K65A 1KIGL 4JZDL 5JBCE 2VH0B 1A0HA 1DIYA 1FE2A 3N8VA 2BOUA 1EMNA 3ASIA 3KRKA 1IQML 1CX2A 1K36A 3FCSB 1GMNA 2BQ7A 2BMGA 2P16L 3GCXE 1XKBA 1EMOA 3BT2A 2WYGB 5CKNA 5COXA 2W86A 2W3IB 3R05A 3CFWA 1IQFL 2EI8B 4CSYA 2EI6B 2OYUP 2M74A 5IKRA 4YZUB 1IOXA 4CUEA 1YUKB 5F1AA 4DURA 4RRYA 2JKHL 3KQBL 4BVCA 4D0EA 3U7UG 2ADXA 1PK2A 1NT0A 3V64C 1PFXL 1PXXA 1DX5I 1EZQB 5L2YL 4NGAL 3NT1A 1RFNB 2BQ6A 3HS6A 5EGMB 3LC5B 1F0SB 3E6PL 1KSNB 2UWOB 3MDLA 1NK1A 1W8BL 2F9BL 2I9BA 5L2ZL 3DEMA 1EAIC 2Y81B 2EI7B 4M10A 2P3FL 2FLBL 3NTGA 1F7MA 3LC3B 3SP8A 3C9AC 2KNFA 1I71A 1PRHA 1PGEA 1COUA 3GCWE
chains in the Genus database with same CATH superfamily
1KIVA 4Z0KB 4GU3A 3N8WA 2W2OE 4X8UL 2K4RA 1EPHA 1NFYB 5CS9A 2P3FN 5IKVA 3BT1A 3HO5A 2QJ4A 2Y7ZB 3Q7DA 4JYVL 3Q3KB 1IQHL 2FZZL 2OYEP 4G1MB 5CT1A 4JYUL 1FAXL 2WPJE 5JBBE 5JB9E 1U67A 1APOA 1MQ6L 1G2LB 1YGCL 5IKTA 4RS0A 1OB1C 1J9CL 1CQEA 1ADXA 2FLRL 1HPJA 2WG4B 2MHPA 1V3XB 2P93L 5HPGA 1NFWB 2P3TA 1EGFA 2NPRA 3TH3L 2J94B 5I46L 2FD6A 2WPLE 4X8TL 1IQEL 2WPHE 4CIKA 1F0RB 1G1TA 3HS7A 3SW2A 1B2IA 1KKEA 3TK6B 1PK4A 4YT7L 4HZHA 1PMKA 1XKAL 4OTYA 3NXPA 3CENL 1CVWL 4A94C 4BDWA 2WFTA 2VWOL 1LPGA 2RA0L 3N8ZA 4O02B 3MKPA 5CP9A 5CS5A 1NZIA 5CKQA 2DOHX 1JL9A 2J34B 1DQBA 2CJIB 2W2PE 4E1GA 2J95B 1IQJL 1Z6CA 1G1QA 1FSBA 3HO4A 3V65B 3TBDA 1CCVA 3HS5A 3M37L 4RRWA 2W26B 2XBXL 1KLOA 2FLGA 3POYA 4M11A 1HAEA 2VVUL 1PTHA 5CT3A 2RNLA 3BPSE 1APQA 3KQCL 2J4IB 1PMLA 5JVYA 2P26A 3ZYGA 3N8YA 5KIRA 2PUQL 2PHBB 2HPPP 1C5MF 2H9EL 1LMJA 1HJ7A 3S6XA 2Y5FL 1YUFA 1YO8A 1KI0A 1HCGB 2W3KB 3TGFA 4ISHL 3HN4A 2VH6B 4PH9A 1NQLB 3QMOA 4RUTA 1ATEA 4BDXA 4ZH8B 4XBMA 3SOVA 5JVZA 1KDUA 2P28B 2SPTA 2WPIE 1UZKA 1KRNA 4ZXYL 2VWNL 1P9JA 3QCWA 2XC4L 1LPZA 4IUAA 5JW1A 3M36L 1Z6EL 2PF1A 4MMZB 4O1ZA 4NZQA 1FFMA 1DVAL 1GK5A 1N1IA 4BV7A 3KQEL 2YGQA 1IQNL 1BHTA 1CEBA 3F6UL 5JB8E 1WU1B 1EPIA 3P5BL 1HT5A 3RR3A 1XFEA 2TGFA 2YGPA 2WG3C 4Z6AL 1XDTR 2BQWA 4RRXA 2BOXA 3N8WB 3N8XA 3LAQA 5JBAE 2WFXB 1L3YA 1O5DL 1ZAQA 1LMMA 1V1IA 3FFGL 1MQ5L 2UWLB 1PKRA 1NPEB 2YGOA 3KQDL 4X8SL 1JBUL 1IQLL 1Q4GA 4MMYB 1N7DA 1ATBA 2KV4A 2MGRA 4BTTA 1IOEL 5CKMA 1UZPA 2Y38A 1IGXA 1HREA 5L30L 2VVVL 4BTUA 1EQGA 2Q1JB 1IGZA 1AUTL 3SOBB 3LN1A 3MQEA 5CISA 1SZBA 1TOZA 1G1SA 1HRFA 1GP9A 2HORA 1QFKL 1X7AL 4TGFA 4Y76B 3GISX 1EPJA 2HPQP 2K2SB 2P95L 3ENSA 2L0SA 2DDUA 2VWMK 2BOHA 4LMFA 4O03A 2PK4A 1QIUA 2WPKE 3U73A 2W2ME 4BTIA 4A5TS 3KCGL 3KK6A 1FJSL 3F1SB 2KJ4A 1G2MB 2BT8A 1TLEA 2H9EC 2PR3B 1NFUB 2XBYL 4BXSA 1U8CB 1CEAA 1TPGA 1I0UA 2VJ3A 1IQKL 4A7IA 4BVDA 3KIVA 2JJLA 4ISIL 3FBYA 4Y7BB 3IJEB 5CS3A 4LORA 4Y7AB 6COXA 2J38B 2P3UA 5F19A 3CA7A 5FDQA 1WHEA 2BZ6L 3H5CB 3EGFA 1B9WA 1BF9A 1FF7A 3CS7L 2BO2A 1HT8A 3LTGD 1CEJA 1YUGA 1GMOA 2G00L 4YT6L 4D0FA 2WZPP 5IKQA 4D90A 4GU4A 2B7DL 2VVCK 1HX2A 4XLWA 2Y5HL 3K9XA 2AYLA 3ELAL 1UZQA 4ZAEB 1IQGL 2W2QE 1I5KA 2UWPB 2XBVL 3TZIA 1P0SL 4AQTA 5KN5C 1IQIL 3LN0A 2DOIA 3QH0A 2KL7A 4MMXB 4NA9L 3IITB 1CCFA 5CS1A 2XC0L 2BT7A 2Y5GL 3KL6B 2PF2A 4JZEL 1LQDA 2Y7XB 2VWLL 2MGPA 4C16A 4OTJA 3NJPC 4D3CA 3ZYIB 4JZFL 1DDXA 4BVWA 2WYJB 2Y80B 1K37A 2K2TA 4Z0LA 1L5GB 1NL1A 4RRZA 4CUDA 3HPTA 2KB9A 1EBVA 1HAFA 2W2NE 1TPKA 4XL1A 1WHFA 3ZYJB 1ATAA 2P94L 4NG9L 3OLUA 5CSQA 1JFNA 1UZJA 4Y79B 1IP0A 3LTFB 1CVUA 1LPKA 1W7XL 4COXA 2K51A 1IVOC 1ATDA 4Y71B 3OLTA 2WPME 4ZHAB 1FAKL 3LIWB 2XBWL 4BXWA 1NL2A 1KLIL 4KIVA 5E8DA 5COEA 1KLJL 1A3PA 4CUFA 4BVVA 1IJQA 1EQHA 1HZ8A 4FM5A 3PGHA 1LK9A 1F7EA 4Y6DB 5K0HB 1G1RA 1EPGA 2BSFA 3HO3A 2I9AA 2J2UB 5CT2A 2RHPA 3TK5B 2Y82B 4X8VL 2QJ2A 3N8YB 1HPKA 2XC5L 1V1HA 3NTBA 4BV5A 3SOQA 2FEBA 4ZXXL 1NFXB 1M1XB 1JV2B 1URKA 2KNIA 2GD4A 1MOXC 2D1JB 2BOKL 3K65A 1KIGL 4JZDL 5JBCE 2VH0B 1A0HA 1DIYA 1FE2A 3N8VA 2BOUA 1EMNA 3ASIA 3KRKA 1IQML 1CX2A 1K36A 3FCSB 1GMNA 2BQ7A 2BMGA 2P16L 3GCXE 1XKBA 1EMOA 3BT2A 2WYGB 5CKNA 5COXA 2W86A 2W3IB 3R05A 3CFWA 1IQFL 2EI8B 4CSYA 2EI6B 2OYUP 2M74A 5IKRA 4YZUB 1IOXA 4CUEA 1YUKB 5F1AA 4DURA 4RRYA 2JKHL 3KQBL 4BVCA 4D0EA 3U7UG 2ADXA 2VRSA 1PK2A 1NT0A 3V64C 1PFXL 1PXXA 1DX5I 1EZQB 5L2YL 4NGAL 3NT1A 2HOXA 1RFNB 2BQ6A 3HS6A 5EGMB 3LC5B 1F0SB 3E6PL 1KSNB 2UWOB 3MDLA 1NK1A 1W8BL 2F9BL 2I9BA 5L2ZL 3DEMA 1EAIC 2Y81B 2EI7B 4M10A 2P3FL 2FLBL 3NTGA 1F7MA 3LC3B 3SP8A 3C9AC 2KNFA 1I71A 1PRHA 1PGEA 1COUA 3GCWE
chains in the Genus database with same CATH topology
1KIVA 4Z0KB 3N8WA 2W2OE 4X8UL 2K4RA 1EPHA 1NFYB 5CS9A 2P3FN 5IKVA 3BT1A 3HO5A 2QJ4A 2Y7ZB 3Q7DA 4JYVL 3Q3KB 1IQHL 2FZZL 2OYEP 4G1MB 5CT1A 4JYUL 1FAXL 2WPJE 5JBBE 5JB9E 1U67A 1APOA 1MQ6L 1G2LB 1YGCL 5IKTA 4RS0A 1OB1C 1J9CL 1CQEA 1ADXA 2FLRL 1HPJA 2WG4B 2MHPA 1V3XB 2P93L 5HPGA 1NFWB 2P3TA 1EGFA 2NPRA 3TH3L 2J94B 5I46L 2FD6A 2WPLE 4X8TL 1IQEL 2WPHE 4CIKA 1F0RB 1G1TA 3HS7A 3SW2A 1B2IA 3TK6B 1PK4A 4YT7L 4HZHA 1PMKA 1XKAL 4OTYA 3NXPA 3CENL 1CVWL 4A94C 4BDWA 2WFTA 2VWOL 1LPGA 2RA0L 3N8ZA 4O02B 3MKPA 5CP9A 5CS5A 1NZIA 5CKQA 2DOHX 1JL9A 2J34B 1DQBA 2CJIB 2W2PE 4E1GA 2J95B 1IQJL 1Z6CA 1G1QA 1FSBA 3HO4A 3V65B 3TBDA 1CCVA 3HS5A 3M37L 4RRWA 2W26B 2XBXL 1KLOA 2FLGA 4M11A 3POYA 1HAEA 2VVUL 1PTHA 5CT3A 2RNLA 3BPSE 1APQA 3KQCL 2J4IB 1PMLA 5JVYA 2P26A 3ZYGA 3N8YA 5KIRA 2PUQL 2PHBB 2HPPP 1C5MF 2H9EL 1LMJA 1HJ7A 3S6XA 2Y5FL 1YUFA 1YO8A 1KI0A 1HCGB 2W3KB 3TGFA 4ISHL 3HN4A 2VH6B 4PH9A 1NQLB 3QMOA 4RUTA 1ATEA 4BDXA 4ZH8B 4XBMA 3SOVA 5JVZA 1KDUA 2P28B 2SPTA 2WPIE 1UZKA 1KRNA 4ZXYL 2VWNL 1P9JA 3QCWA 2XC4L 1LPZA 4IUAA 5JW1A 3M36L 1Z6EL 2PF1A 4MMZB 4O1ZA 4NZQA 1FFMA 1DVAL 1GK5A 1N1IA 4BV7A 3KQEL 2YGQA 1IQNL 1BHTA 1CEBA 3F6UL 5JB8E 1WU1B 1EPIA 3P5BL 1HT5A 3RR3A 1XFEA 2TGFA 2YGPA 2WG3C 4Z6AL 1XDTR 2BQWA 4RRXA 2BOXA 3N8WB 3N8XA 3LAQA 5JBAE 2WFXB 1L3YA 1O5DL 1ZAQA 1LMMA 3FFGL 1MQ5L 2UWLB 1PKRA 1NPEB 2YGOA 3KQDL 4X8SL 1JBUL 1IQLL 1Q4GA 4MMYB 1N7DA 1ATBA 2KV4A 2MGRA 4BTTA 1IOEL 5CKMA 1UZPA 2Y38A 1IGXA 1HREA 5L30L 2VVVL 4BTUA 1EQGA 2Q1JB 1IGZA 1AUTL 3SOBB 3LN1A 3MQEA 5CISA 1SZBA 1TOZA 1G1SA 1HRFA 1GP9A 1QFKL 1X7AL 4TGFA 4Y76B 3GISX 1EPJA 2HPQP 2K2SB 2P95L 3ENSA 2L0SA 2DDUA 2VWMK 2BOHA 4LMFA 4O03A 2PK4A 2WPKE 3U73A 2W2ME 4BTIA 4A5TS 3KCGL 3KK6A 1FJSL 3F1SB 2KJ4A 1G2MB 1TLEA 2H9EC 2PR3B 1NFUB 2XBYL 4BXSA 1U8CB 1CEAA 1TPGA 1I0UA 2VJ3A 1IQKL 4A7IA 4BVDA 3KIVA 4ISIL 3FBYA 4Y7BB 3IJEB 5CS3A 4LORA 4Y7AB 6COXA 2J38B 2P3UA 5F19A 3CA7A 5FDQA 1WHEA 2BZ6L 3H5CB 3EGFA 1B9WA 1BF9A 1FF7A 3CS7L 2BO2A 1HT8A 3LTGD 1CEJA 1YUGA 1GMOA 2G00L 4YT6L 4D0FA 2WZPP 5IKQA 4D90A 2B7DL 2VVCK 1HX2A 4XLWA 2Y5HL 3K9XA 2AYLA 3ELAL 1UZQA 4ZAEB 1IQGL 2W2QE 1I5KA 2UWPB 2XBVL 3TZIA 1P0SL 4AQTA 5KN5C 1IQIL 3LN0A 2DOIA 3QH0A 2KL7A 4MMXB 4NA9L 3IITB 1CCFA 5CS1A 2XC0L 2Y5GL 3KL6B 2PF2A 4JZEL 1LQDA 2Y7XB 2VWLL 2MGPA 4C16A 4OTJA 3NJPC 4D3CA 3ZYIB 4JZFL 1DDXA 4BVWA 2WYJB 2Y80B 1K37A 2K2TA 4Z0LA 1L5GB 1NL1A 4RRZA 4CUDA 3HPTA 2KB9A 1EBVA 1HAFA 2W2NE 1TPKA 4XL1A 1WHFA 3ZYJB 1ATAA 2P94L 4NG9L 3OLUA 5CSQA 1JFNA 1UZJA 4Y79B 1IP0A 3LTFB 1CVUA 1LPKA 1W7XL 4COXA 2K51A 1IVOC 1ATDA 4Y71B 3OLTA 2WPME 4ZHAB 1FAKL 3LIWB 2XBWL 4BXWA 1NL2A 1KLIL 4KIVA 5E8DA 5COEA 1KLJL 1A3PA 4CUFA 4BVVA 1IJQA 1EQHA 1HZ8A 4FM5A 3PGHA 1F7EA 4Y6DB 5K0HB 1G1RA 1EPGA 3HO3A 2I9AA 2J2UB 5CT2A 2RHPA 3TK5B 2Y82B 4X8VL 2QJ2A 3N8YB 1HPKA 2XC5L 3NTBA 4BV5A 3SOQA 2FEBA 4ZXXL 1NFXB 1M1XB 1JV2B 1URKA 2KNIA 2GD4A 1MOXC 2D1JB 2BOKL 3K65A 1KIGL 4JZDL 5JBCE 2VH0B 1A0HA 1DIYA 1FE2A 3N8VA 2BOUA 1EMNA 3ASIA 3KRKA 1IQML 1CX2A 1K36A 3FCSB 1GMNA 2BQ7A 2BMGA 2P16L 3GCXE 1XKBA 1EMOA 3BT2A 2WYGB 5CKNA 5COXA 2W86A 2W3IB 3R05A 3CFWA 1IQFL 2EI8B 4CSYA 2EI6B 2OYUP 2M74A 5IKRA 4YZUB 1IOXA 4CUEA 1YUKB 5F1AA 4DURA 4RRYA 2JKHL 3KQBL 4BVCA 4D0EA 3U7UG 2ADXA 1PK2A 1NT0A 3V64C 1PFXL 1PXXA 1DX5I 1EZQB 5L2YL 4NGAL 3NT1A 1RFNB 2BQ6A 3HS6A 5EGMB 3LC5B 1F0SB 3E6PL 1KSNB 2UWOB 3MDLA 1NK1A 1W8BL 2F9BL 2I9BA 5L2ZL 3DEMA 1EAIC 2Y81B 2EI7B 4M10A 2P3FL 2FLBL 3NTGA 1F7MA 3LC3B 3SP8A 3C9AC 2KNFA 1I71A 1PRHA 1PGEA 1COUA 3GCWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIV A;  4Z0K B;  3N8W A;  2W2O E;  4X8U L;  2K4R A;  1EPH A;  1NFY B;  5CS9 A;  2P3F N;  5IKV A;  3BT1 A;  3HO5 A;  2QJ4 A;  2Y7Z B;  3Q7D A;  4JYV L;  3Q3K B;  1IQH L;  2FZZ L;  2OYE P;  4G1M B;  5CT1 A;  4JYU L;  1FAX L;  2WPJ E;  5JBB E;  5JB9 E;  1U67 A;  1APO A;  1MQ6 L;  1G2L B;  1YGC L;  5IKT A;  4RS0 A;  1OB1 C;  1J9C L;  1CQE A;  1ADX A;  2FLR L;  1HPJ A;  2WG4 B;  2MHP A;  1V3X B;  2P93 L;  5HPG A;  1NFW B;  2P3T A;  1EGF A;  2NPR A;  3TH3 L;  2J94 B;  5I46 L;  2FD6 A;  2WPL E;  4X8T L;  1IQE L;  2WPH E;  4CIK A;  1F0R B;  1G1T A;  3HS7 A;  3SW2 A;  1B2I A;  3TK6 B;  1PK4 A;  4YT7 L;  4HZH A;  1PMK A;  1XKA L;  4OTY A;  3NXP A;  3CEN L;  1CVW L;  4BDW A;  2WFT A;  2VWO L;  1LPG A;  2RA0 L;  3N8Z A;  4O02 B;  3MKP A;  5CP9 A;  5CS5 A;  1NZI A;  5CKQ A;  2DOH X;  1JL9 A;  2J34 B;  1DQB A;  2CJI B;  2W2P E;  4E1G A;  2J95 B;  1IQJ L;  1Z6C A;  1G1Q A;  1FSB A;  3HO4 A;  3V65 B;  3TBD A;  1CCV A;  3HS5 A;  3M37 L;  4RRW A;  2W26 B;  2XBX L;  1KLO A;  2FLG A;  4M11 A;  3POY A;  1HAE A;  2VVU L;  1PTH A;  5CT3 A;  2RNL A;  3BPS E;  1APQ A;  3KQC L;  2J4I B;  1PML A;  5JVY A;  2P26 A;  3ZYG A;  3N8Y A;  5KIR A;  2PUQ L;  2PHB B;  2HPP P;  1C5M F;  2H9E L;  1LMJ A;  1HJ7 A;  2Y5F L;  1YUF A;  1YO8 A;  1KI0 A;  1HCG B;  2W3K B;  3TGF A;  4ISH L;  3HN4 A;  2VH6 B;  4PH9 A;  1NQL B;  3QMO A;  4RUT A;  1ATE A;  4BDX A;  4ZH8 B;  4XBM A;  3SOV A;  5JVZ A;  1KDU A;  2P28 B;  2SPT A;  2WPI E;  1UZK A;  1KRN A;  4ZXY L;  2VWN L;  1P9J A;  3QCW A;  2XC4 L;  1LPZ A;  4IUA A;  5JW1 A;  3M36 L;  1Z6E L;  2PF1 A;  4MMZ B;  4O1Z A;  4NZQ A;  1FFM A;  1DVA L;  1GK5 A;  1N1I A;  4BV7 A;  3KQE L;  1IQN L;  1BHT A;  1CEB A;  3F6U L;  5JB8 E;  1WU1 B;  1EPI A;  3P5B L;  1HT5 A;  3RR3 A;  1XFE A;  2TGF A;  2YGP A;  2WG3 C;  4Z6A L;  1XDT R;  2BQW A;  4RRX A;  2BOX A;  3N8W B;  3N8X A;  3LAQ A;  5JBA E;  2WFX B;  1L3Y A;  1O5D L;  1ZAQ A;  3FFG L;  1MQ5 L;  2UWL B;  1PKR A;  1NPE B;  2YGO A;  3KQD L;  4X8S L;  1JBU L;  1IQL L;  1Q4G A;  4MMY B;  1N7D A;  1ATB A;  2KV4 A;  2MGR A;  4BTT A;  1IOE L;  5CKM A;  1UZP A;  2Y38 A;  1IGX A;  1HRE A;  5L30 L;  2VVV L;  4BTU A;  1EQG A;  2Q1J B;  1IGZ A;  1AUT L;  3SOB B;  3LN1 A;  3MQE A;  5CIS A;  1SZB A;  1TOZ A;  1G1S A;  1HRF A;  1GP9 A;  1QFK L;  1X7A L;  4TGF A;  4Y76 B;  3GIS X;  1EPJ A;  2HPQ P;  2K2S B;  2P95 L;  3ENS A;  2L0S A;  2DDU A;  2VWM K;  2BOH A;  4LMF A;  4O03 A;  2PK4 A;  2WPK E;  3U73 A;  2W2M E;  4BTI A;  4A5T S;  3KCG L;  3KK6 A;  1FJS L;  3F1S B;  2KJ4 A;  1G2M B;  1TLE A;  2XBY L;  2PR3 B;  1NFU B;  4BXS A;  1U8C B;  1CEA A;  1TPG A;  1I0U A;  2VJ3 A;  1IQK L;  4A7I A;  4BVD A;  3KIV A;  4ISI L;  3FBY A;  4Y7B B;  3IJE B;  5CS3 A;  4LOR A;  4Y7A B;  6COX A;  2J38 B;  2P3U A;  5F19 A;  3CA7 A;  5FDQ A;  1WHE A;  2BZ6 L;  3H5C B;  3EGF A;  1B9W A;  1BF9 A;  1FF7 A;  3CS7 L;  2BO2 A;  1HT8 A;  3LTG D;  1CEJ A;  1YUG A;  1GMO A;  2G00 L;  4YT6 L;  4D0F A;  5IKQ A;  4D90 A;  2B7D L;  2VVC K;  1HX2 A;  4XLW A;  2Y5H L;  3K9X A;  2AYL A;  3ELA L;  1UZQ A;  4ZAE B;  1IQG L;  2W2Q E;  1I5K A;  2UWP B;  2XBV L;  3TZI A;  1P0S L;  4AQT A;  5KN5 C;  1IQI L;  3LN0 A;  2DOI A;  3QH0 A;  2KL7 A;  4MMX B;  4NA9 L;  3IIT B;  1CCF A;  5CS1 A;  2XC0 L;  2Y5G L;  3KL6 B;  2PF2 A;  4JZE L;  1LQD A;  2Y7X B;  2VWL L;  2MGP A;  4C16 A;  4OTJ A;  3NJP C;  4D3C A;  3ZYI B;  4JZF L;  1DDX A;  4BVW A;  2WYJ B;  2Y80 B;  1K37 A;  2K2T A;  4Z0L A;  1L5G B;  1NL1 A;  4RRZ A;  4CUD A;  3HPT A;  2KB9 A;  1EBV A;  1HAF A;  2W2N E;  1TPK A;  4XL1 A;  1WHF A;  3ZYJ B;  1ATA A;  2P94 L;  4NG9 L;  3OLU A;  5CSQ A;  1JFN A;  1UZJ A;  4Y79 B;  1IP0 A;  3LTF B;  1CVU A;  1LPK A;  1W7X L;  4COX A;  2K51 A;  1IVO C;  1ATD A;  4Y71 B;  3OLT A;  2WPM E;  4ZHA B;  1FAK L;  3LIW B;  2XBW L;  4BXW A;  1NL2 A;  1KLI L;  4KIV A;  5E8D A;  5COE A;  1KLJ L;  1A3P A;  4CUF A;  4BVV A;  1IJQ A;  1EQH A;  1HZ8 A;  4FM5 A;  3PGH A;  1F7E A;  4Y6D B;  5K0H B;  1G1R A;  1EPG A;  3HO3 A;  2I9A A;  2J2U B;  5CT2 A;  2RHP A;  3TK5 B;  2Y82 B;  4X8V L;  2QJ2 A;  3N8Y B;  1HPK A;  2XC5 L;  3NTB A;  4BV5 A;  3SOQ A;  2FEB A;  4ZXX L;  1NFX B;  1M1X B;  1JV2 B;  1URK A;  2GD4 A;  1MOX C;  2D1J B;  2BOK L;  3K65 A;  1KIG L;  4JZD L;  5JBC E;  2VH0 B;  1A0H A;  1DIY A;  1FE2 A;  3N8V A;  2BOU A;  1EMN A;  3ASI A;  3KRK A;  1IQM L;  1CX2 A;  1K36 A;  3FCS B;  1GMN A;  2BQ7 A;  2BMG A;  2P16 L;  3GCX E;  1XKB A;  1EMO A;  3BT2 A;  2WYG B;  5CKN A;  5COX A;  2W86 A;  2W3I B;  3R05 A;  3CFW A;  1IQF L;  2EI8 B;  4CSY A;  2EI6 B;  2OYU P;  2M74 A;  5IKR A;  4YZU B;  1IOX A;  4CUE A;  1YUK B;  5F1A A;  4DUR A;  4RRY A;  2JKH L;  3KQB L;  4BVC A;  4D0E A;  3U7U G;  2ADX A;  1PK2 A;  1NT0 A;  3V64 C;  1PFX L;  1PXX A;  1DX5 I;  1EZQ B;  5L2Y L;  4NGA L;  3NT1 A;  1RFN B;  2BQ6 A;  3HS6 A;  5EGM B;  3LC5 B;  1F0S B;  3E6P L;  1KSN B;  2UWO B;  3MDL A;  1NK1 A;  1W8B L;  2F9B L;  2I9B A;  5L2Z L;  3DEM A;  1EAI C;  2Y81 B;  2EI7 B;  4M10 A;  2P3F L;  2FLB L;  3NTG A;  1F7M A;  3LC3 B;  3SP8 A;  3C9A C;  2KNF A;  1I71 A;  1PRH A;  1PGE A;  1COU A;  3GCW E; 
#chains in the Genus database with same CATH topology
 1KIV A;  4Z0K B;  4GU3 A;  3N8W A;  2W2O E;  4X8U L;  2K4R A;  1EPH A;  1NFY B;  5CS9 A;  2P3F N;  5IKV A;  3BT1 A;  3HO5 A;  2QJ4 A;  2Y7Z B;  3Q7D A;  4JYV L;  3Q3K B;  1IQH L;  2FZZ L;  2OYE P;  4G1M B;  5CT1 A;  4JYU L;  1FAX L;  2WPJ E;  5JBB E;  5JB9 E;  1U67 A;  1APO A;  1MQ6 L;  1G2L B;  1YGC L;  5IKT A;  4RS0 A;  1OB1 C;  1J9C L;  1CQE A;  1ADX A;  2FLR L;  1HPJ A;  2WG4 B;  2MHP A;  1V3X B;  2P93 L;  5HPG A;  1NFW B;  2P3T A;  1EGF A;  2NPR A;  3TH3 L;  2J94 B;  5I46 L;  2FD6 A;  2WPL E;  4X8T L;  1IQE L;  2WPH E;  4CIK A;  1F0R B;  1G1T A;  3HS7 A;  3SW2 A;  1B2I A;  1KKE A;  3TK6 B;  1PK4 A;  4YT7 L;  4HZH A;  1PMK A;  1XKA L;  4OTY A;  3NXP A;  3CEN L;  1CVW L;  4A94 C;  4BDW A;  2WFT A;  2VWO L;  1LPG A;  2RA0 L;  3N8Z A;  4O02 B;  3MKP A;  5CP9 A;  5CS5 A;  1NZI A;  5CKQ A;  2DOH X;  1JL9 A;  2J34 B;  1DQB A;  2CJI B;  2W2P E;  4E1G A;  2J95 B;  1IQJ L;  1Z6C A;  1G1Q A;  1FSB A;  3HO4 A;  3V65 B;  3TBD A;  1CCV A;  3HS5 A;  3M37 L;  4RRW A;  2W26 B;  2XBX L;  1KLO A;  2FLG A;  3POY A;  4M11 A;  1HAE A;  2VVU L;  1PTH A;  5CT3 A;  2RNL A;  3BPS E;  1APQ A;  3KQC L;  2J4I B;  1PML A;  5JVY A;  2P26 A;  3ZYG A;  3N8Y A;  5KIR A;  2PUQ L;  2PHB B;  2HPP P;  1C5M F;  2H9E L;  1LMJ A;  1HJ7 A;  3S6X A;  2Y5F L;  1YUF A;  1YO8 A;  1KI0 A;  1HCG B;  2W3K B;  3TGF A;  4ISH L;  3HN4 A;  2VH6 B;  4PH9 A;  1NQL B;  3QMO A;  4RUT A;  1ATE A;  4BDX A;  4ZH8 B;  4XBM A;  3SOV A;  5JVZ A;  1KDU A;  2P28 B;  2SPT A;  2WPI E;  1UZK A;  1KRN A;  4ZXY L;  2VWN L;  1P9J A;  3QCW A;  2XC4 L;  1LPZ A;  4IUA A;  5JW1 A;  3M36 L;  1Z6E L;  2PF1 A;  4MMZ B;  4O1Z A;  4NZQ A;  1FFM A;  1DVA L;  1GK5 A;  1N1I A;  4BV7 A;  3KQE L;  2YGQ A;  1IQN L;  1BHT A;  1CEB A;  3F6U L;  5JB8 E;  1WU1 B;  1EPI A;  3P5B L;  1HT5 A;  3RR3 A;  1XFE A;  2TGF A;  2YGP A;  2WG3 C;  4Z6A L;  1XDT R;  2BQW A;  4RRX A;  2BOX A;  3N8W B;  3N8X A;  3LAQ A;  5JBA E;  2WFX B;  1L3Y A;  1O5D L;  1ZAQ A;  1LMM A;  1V1I A;  3FFG L;  1MQ5 L;  2UWL B;  1PKR A;  1NPE B;  2YGO A;  3KQD L;  4X8S L;  1JBU L;  1IQL L;  1Q4G A;  4MMY B;  1N7D A;  1ATB A;  2KV4 A;  2MGR A;  4BTT A;  1IOE L;  5CKM A;  1UZP A;  2Y38 A;  1IGX A;  1HRE A;  5L30 L;  2VVV L;  4BTU A;  1EQG A;  2Q1J B;  1IGZ A;  1AUT L;  3SOB B;  3LN1 A;  3MQE A;  5CIS A;  1SZB A;  1TOZ A;  1G1S A;  1HRF A;  1GP9 A;  2HOR A;  1QFK L;  1X7A L;  4TGF A;  4Y76 B;  3GIS X;  1EPJ A;  2HPQ P;  2K2S B;  2P95 L;  3ENS A;  2L0S A;  2DDU A;  2VWM K;  2BOH A;  4LMF A;  4O03 A;  2PK4 A;  1QIU A;  2WPK E;  3U73 A;  2W2M E;  4BTI A;  4A5T S;  3KCG L;  3KK6 A;  1FJS L;  3F1S B;  2KJ4 A;  1G2M B;  2BT8 A;  1TLE A;  2H9E C;  2PR3 B;  1NFU B;  2XBY L;  4BXS A;  1U8C B;  1CEA A;  1TPG A;  1I0U A;  2VJ3 A;  1IQK L;  4A7I A;  4BVD A;  3KIV A;  2JJL A;  4ISI L;  3FBY A;  4Y7B B;  3IJE B;  5CS3 A;  4LOR A;  4Y7A B;  6COX A;  2J38 B;  2P3U A;  5F19 A;  3CA7 A;  5FDQ A;  1WHE A;  2BZ6 L;  3H5C B;  3EGF A;  1B9W A;  1BF9 A;  1FF7 A;  3CS7 L;  2BO2 A;  1HT8 A;  3LTG D;  1CEJ A;  1YUG A;  1GMO A;  2G00 L;  4YT6 L;  4D0F A;  2WZP P;  5IKQ A;  4D90 A;  4GU4 A;  2B7D L;  2VVC K;  1HX2 A;  4XLW A;  2Y5H L;  3K9X A;  2AYL A;  3ELA L;  1UZQ A;  4ZAE B;  1IQG L;  2W2Q E;  1I5K A;  2UWP B;  2XBV L;  3TZI A;  1P0S L;  4AQT A;  5KN5 C;  1IQI L;  3LN0 A;  2DOI A;  3QH0 A;  2KL7 A;  4MMX B;  4NA9 L;  3IIT B;  1CCF A;  5CS1 A;  2XC0 L;  2BT7 A;  2Y5G L;  3KL6 B;  2PF2 A;  4JZE L;  1LQD A;  2Y7X B;  2VWL L;  2MGP A;  4C16 A;  4OTJ A;  3NJP C;  4D3C A;  3ZYI B;  4JZF L;  1DDX A;  4BVW A;  2WYJ B;  2Y80 B;  1K37 A;  2K2T A;  4Z0L A;  1L5G B;  1NL1 A;  4RRZ A;  4CUD A;  3HPT A;  2KB9 A;  1EBV A;  1HAF A;  2W2N E;  1TPK A;  4XL1 A;  1WHF A;  3ZYJ B;  1ATA A;  2P94 L;  4NG9 L;  3OLU A;  5CSQ A;  1JFN A;  1UZJ A;  4Y79 B;  1IP0 A;  3LTF B;  1CVU A;  1LPK A;  1W7X L;  4COX A;  2K51 A;  1IVO C;  1ATD A;  4Y71 B;  3OLT A;  2WPM E;  4ZHA B;  1FAK L;  3LIW B;  2XBW L;  4BXW A;  1NL2 A;  1KLI L;  4KIV A;  5E8D A;  5COE A;  1KLJ L;  1A3P A;  4CUF A;  4BVV A;  1IJQ A;  1EQH A;  1HZ8 A;  4FM5 A;  3PGH A;  1LK9 A;  1F7E A;  4Y6D B;  5K0H B;  1G1R A;  1EPG A;  2BSF A;  3HO3 A;  2I9A A;  2J2U B;  5CT2 A;  2RHP A;  3TK5 B;  2Y82 B;  4X8V L;  2QJ2 A;  3N8Y B;  1HPK A;  2XC5 L;  1V1H A;  3NTB A;  4BV5 A;  3SOQ A;  2FEB A;  4ZXX L;  1NFX B;  1M1X B;  1JV2 B;  1URK A;  2KNI A;  2GD4 A;  1MOX C;  2D1J B;  2BOK L;  3K65 A;  1KIG L;  4JZD L;  5JBC E;  2VH0 B;  1A0H A;  1DIY A;  1FE2 A;  3N8V A;  2BOU A;  1EMN A;  3ASI A;  3KRK A;  1IQM L;  1CX2 A;  1K36 A;  3FCS B;  1GMN A;  2BQ7 A;  2BMG A;  2P16 L;  3GCX E;  1XKB A;  1EMO A;  3BT2 A;  2WYG B;  5CKN A;  5COX A;  2W86 A;  2W3I B;  3R05 A;  3CFW A;  1IQF L;  2EI8 B;  4CSY A;  2EI6 B;  2OYU P;  2M74 A;  5IKR A;  4YZU B;  1IOX A;  4CUE A;  1YUK B;  5F1A A;  4DUR A;  4RRY A;  2JKH L;  3KQB L;  4BVC A;  4D0E A;  3U7U G;  2ADX A;  2VRS A;  1PK2 A;  1NT0 A;  3V64 C;  1PFX L;  1PXX A;  1DX5 I;  1EZQ B;  5L2Y L;  4NGA L;  3NT1 A;  2HOX A;  1RFN B;  2BQ6 A;  3HS6 A;  5EGM B;  3LC5 B;  1F0S B;  3E6P L;  1KSN B;  2UWO B;  3MDL A;  1NK1 A;  1W8B L;  2F9B L;  2I9B A;  5L2Z L;  3DEM A;  1EAI C;  2Y81 B;  2EI7 B;  4M10 A;  2P3F L;  2FLB L;  3NTG A;  1F7M A;  3LC3 B;  3SP8 A;  3C9A C;  2KNF A;  1I71 A;  1PRH A;  1PGE A;  1COU A;  3GCW E; 
#chains in the Genus database with same CATH homology
 1KIV A;  4Z0K B;  3N8W A;  2W2O E;  4X8U L;  2K4R A;  1EPH A;  1NFY B;  5CS9 A;  2P3F N;  5IKV A;  3BT1 A;  3HO5 A;  2QJ4 A;  2Y7Z B;  3Q7D A;  4JYV L;  3Q3K B;  1IQH L;  2FZZ L;  2OYE P;  4G1M B;  5CT1 A;  4JYU L;  1FAX L;  2WPJ E;  5JBB E;  5JB9 E;  1U67 A;  1APO A;  1MQ6 L;  1G2L B;  1YGC L;  5IKT A;  4RS0 A;  1OB1 C;  1J9C L;  1CQE A;  1ADX A;  2FLR L;  1HPJ A;  2WG4 B;  2MHP A;  1V3X B;  2P93 L;  5HPG A;  1NFW B;  2P3T A;  1EGF A;  2NPR A;  3TH3 L;  2J94 B;  5I46 L;  2FD6 A;  2WPL E;  4X8T L;  1IQE L;  2WPH E;  4CIK A;  1F0R B;  1G1T A;  3HS7 A;  3SW2 A;  1B2I A;  3TK6 B;  1PK4 A;  4YT7 L;  4HZH A;  1PMK A;  1XKA L;  4OTY A;  3NXP A;  3CEN L;  1CVW L;  4A94 C;  4BDW A;  2WFT A;  2VWO L;  1LPG A;  2RA0 L;  3N8Z A;  4O02 B;  3MKP A;  5CP9 A;  5CS5 A;  1NZI A;  5CKQ A;  2DOH X;  1JL9 A;  2J34 B;  1DQB A;  2CJI B;  2W2P E;  4E1G A;  2J95 B;  1IQJ L;  1Z6C A;  1G1Q A;  1FSB A;  3HO4 A;  3V65 B;  3TBD A;  1CCV A;  3HS5 A;  3M37 L;  4RRW A;  2W26 B;  2XBX L;  1KLO A;  2FLG A;  4M11 A;  3POY A;  1HAE A;  2VVU L;  1PTH A;  5CT3 A;  2RNL A;  3BPS E;  1APQ A;  3KQC L;  2J4I B;  1PML A;  5JVY A;  2P26 A;  3ZYG A;  3N8Y A;  5KIR A;  2PUQ L;  2PHB B;  2HPP P;  1C5M F;  2H9E L;  1LMJ A;  1HJ7 A;  3S6X A;  2Y5F L;  1YUF A;  1YO8 A;  1KI0 A;  1HCG B;  2W3K B;  3TGF A;  4ISH L;  3HN4 A;  2VH6 B;  4PH9 A;  1NQL B;  3QMO A;  4RUT A;  1ATE A;  4BDX A;  4ZH8 B;  4XBM A;  3SOV A;  5JVZ A;  1KDU A;  2P28 B;  2SPT A;  2WPI E;  1UZK A;  1KRN A;  4ZXY L;  2VWN L;  1P9J A;  3QCW A;  2XC4 L;  1LPZ A;  4IUA A;  5JW1 A;  3M36 L;  1Z6E L;  2PF1 A;  4MMZ B;  4O1Z A;  4NZQ A;  1FFM A;  1DVA L;  1GK5 A;  1N1I A;  4BV7 A;  3KQE L;  2YGQ A;  1IQN L;  1BHT A;  1CEB A;  3F6U L;  5JB8 E;  1WU1 B;  1EPI A;  3P5B L;  1HT5 A;  3RR3 A;  1XFE A;  2TGF A;  2YGP A;  2WG3 C;  4Z6A L;  1XDT R;  2BQW A;  4RRX A;  2BOX A;  3N8W B;  3N8X A;  3LAQ A;  5JBA E;  2WFX B;  1L3Y A;  1O5D L;  1ZAQ A;  1LMM A;  3FFG L;  1MQ5 L;  2UWL B;  1PKR A;  1NPE B;  2YGO A;  3KQD L;  4X8S L;  1JBU L;  1IQL L;  1Q4G A;  4MMY B;  1N7D A;  1ATB A;  2KV4 A;  2MGR A;  4BTT A;  1IOE L;  5CKM A;  1UZP A;  2Y38 A;  1IGX A;  1HRE A;  5L30 L;  2VVV L;  4BTU A;  1EQG A;  2Q1J B;  1IGZ A;  1AUT L;  3SOB B;  3LN1 A;  3MQE A;  5CIS A;  1SZB A;  1TOZ A;  1G1S A;  1HRF A;  1GP9 A;  1QFK L;  1X7A L;  4TGF A;  4Y76 B;  3GIS X;  1EPJ A;  2HPQ P;  2K2S B;  2P95 L;  3ENS A;  2L0S A;  2DDU A;  2VWM K;  2BOH A;  4LMF A;  4O03 A;  2PK4 A;  2WPK E;  3U73 A;  2W2M E;  4BTI A;  4A5T S;  3KCG L;  3KK6 A;  1FJS L;  3F1S B;  2KJ4 A;  1G2M B;  1TLE A;  2H9E C;  2PR3 B;  1NFU B;  2XBY L;  4BXS A;  1U8C B;  1CEA A;  1TPG A;  1I0U A;  2VJ3 A;  1IQK L;  4A7I A;  4BVD A;  3KIV A;  4ISI L;  3FBY A;  4Y7B B;  3IJE B;  5CS3 A;  4LOR A;  4Y7A B;  6COX A;  2J38 B;  2P3U A;  5F19 A;  3CA7 A;  5FDQ A;  1WHE A;  2BZ6 L;  3H5C B;  3EGF A;  1B9W A;  1BF9 A;  1FF7 A;  3CS7 L;  2BO2 A;  1HT8 A;  3LTG D;  1CEJ A;  1YUG A;  1GMO A;  2G00 L;  4YT6 L;  4D0F A;  2WZP P;  5IKQ A;  4D90 A;  2B7D L;  2VVC K;  1HX2 A;  4XLW A;  2Y5H L;  3K9X A;  2AYL A;  3ELA L;  1UZQ A;  4ZAE B;  1IQG L;  2W2Q E;  1I5K A;  2UWP B;  2XBV L;  3TZI A;  1P0S L;  4AQT A;  5KN5 C;  1IQI L;  3LN0 A;  2DOI A;  3QH0 A;  2KL7 A;  4MMX B;  4NA9 L;  3IIT B;  1CCF A;  5CS1 A;  2XC0 L;  2Y5G L;  3KL6 B;  2PF2 A;  4JZE L;  1LQD A;  2Y7X B;  2VWL L;  2MGP A;  4C16 A;  4OTJ A;  3NJP C;  4D3C A;  3ZYI B;  4JZF L;  1DDX A;  4BVW A;  2WYJ B;  2Y80 B;  1K37 A;  2K2T A;  4Z0L A;  1L5G B;  1NL1 A;  4RRZ A;  4CUD A;  3HPT A;  2KB9 A;  1EBV A;  1HAF A;  2W2N E;  1TPK A;  4XL1 A;  1WHF A;  3ZYJ B;  1ATA A;  2P94 L;  4NG9 L;  3OLU A;  5CSQ A;  1JFN A;  1UZJ A;  4Y79 B;  1IP0 A;  3LTF B;  1CVU A;  1LPK A;  1W7X L;  4COX A;  2K51 A;  1IVO C;  1ATD A;  4Y71 B;  3OLT A;  2WPM E;  4ZHA B;  1FAK L;  3LIW B;  2XBW L;  4BXW A;  1NL2 A;  1KLI L;  4KIV A;  5E8D A;  5COE A;  1KLJ L;  1A3P A;  4CUF A;  4BVV A;  1IJQ A;  1EQH A;  1HZ8 A;  4FM5 A;  3PGH A;  1F7E A;  4Y6D B;  5K0H B;  1G1R A;  1EPG A;  3HO3 A;  2I9A A;  2J2U B;  5CT2 A;  2RHP A;  3TK5 B;  2Y82 B;  4X8V L;  2QJ2 A;  3N8Y B;  1HPK A;  2XC5 L;  3NTB A;  4BV5 A;  3SOQ A;  2FEB A;  4ZXX L;  1NFX B;  1M1X B;  1JV2 B;  1URK A;  2KNI A;  2GD4 A;  1MOX C;  2D1J B;  2BOK L;  3K65 A;  1KIG L;  4JZD L;  5JBC E;  2VH0 B;  1A0H A;  1DIY A;  1FE2 A;  3N8V A;  2BOU A;  1EMN A;  3ASI A;  3KRK A;  1IQM L;  1CX2 A;  1K36 A;  3FCS B;  1GMN A;  2BQ7 A;  2BMG A;  2P16 L;  3GCX E;  1XKB A;  1EMO A;  3BT2 A;  2WYG B;  5CKN A;  5COX A;  2W86 A;  2W3I B;  3R05 A;  3CFW A;  1IQF L;  2EI8 B;  4CSY A;  2EI6 B;  2OYU P;  2M74 A;  5IKR A;  4YZU B;  1IOX A;  4CUE A;  1YUK B;  5F1A A;  4DUR A;  4RRY A;  2JKH L;  3KQB L;  4BVC A;  4D0E A;  3U7U G;  2ADX A;  1PK2 A;  1NT0 A;  3V64 C;  1PFX L;  1PXX A;  1DX5 I;  1EZQ B;  5L2Y L;  4NGA L;  3NT1 A;  1RFN B;  2BQ6 A;  3HS6 A;  5EGM B;  3LC5 B;  1F0S B;  3E6P L;  1KSN B;  2UWO B;  3MDL A;  1NK1 A;  1W8B L;  2F9B L;  2I9B A;  5L2Z L;  3DEM A;  1EAI C;  2Y81 B;  2EI7 B;  4M10 A;  2P3F L;  2FLB L;  3NTG A;  1F7M A;  3LC3 B;  3SP8 A;  3C9A C;  2KNF A;  1I71 A;  1PRH A;  1PGE A;  1COU A;  3GCW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...