2I9BA

Crystal structure of atf-urokinase receptor complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
CDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 24
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2i9bA01
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 2i9bA02
3U73A 1NZIA 1HPKA 1YO8A 2TGFA 1FSBA 1EAIC 2EI7B 5L2YL 1HX2A 1EMNA 2P16L 4A5TS 2PF1A 3N8XA 1PK2A 1KLIL 2W2ME 2Y82B 1P9JA 4CUEA 1F7MA 4RUTA 1PGEA 4NA9L 1BF9A 4BDWA 2Y5GL 1Z6CA 2Q1JB 2Y7XB 5JVZA 3CENL 5EGMB 5CKQA 1EQGA 3NTBA 2DOHX 1PMLA 1IVOC 2DDUA 4ISIL 1KLJL 1LPZA 3KQBL 5CS9A 2VWOL 3OLUA 2P3FL 3N8WA 1U8CB 4X8SL 1UZKA 3LTFB 3V65B 4RS0A 2XBWL 3KCGL 1EPGA 4Y76B 1CVUA 1FF7A 1K36A 4D3CA 4IUAA 1YUFA 5I46L 2WPJE 1IJQA 1CX2A 1IQFL 2G00L 3NT1A 4YT7L 2BOHA 3TK6B 3KQEL 3GISX 2MHPA 1PMKA 1HZ8A 1PXXA 2P94L 3LC5B 4YZUB 2KNFA 2BMGA 4BVVA 3TH3L 2XC4L 2PF2A 5JBBE 1EZQB 1IQIL 5CP9A 2WYGB 4X8UL 3KRKA 3HO5A 2YGOA 1YUKB 4DURA 2AYLA 5IKVA 2XBYL 4JYUL 4ZXYL 3K9XA 4LORA 1G1QA 2GD4A 5JVYA 2EI8B 4OTJA 2SPTA 2D1JB 1GMNA 1TPGA 4BTTA 2NPRA 2WG4B 1IGZA 4OTYA 1XFEA 1CEAA 3R05A 1FFMA 3ZYIB 1ATAA 1GMOA 2M74A 3HS5A 1XDTR 3U7UG 5CS1A 2MGPA 1EGFA 5COXA 2WPLE 3HN4A 1IQLL 1UZJA 1XKBA 4BTUA 3ZYGA 1UZPA 2RA0L 1ZAQA 2HPQP 1KLOA 2WPIE 4NGAL 2ADXA 2WFXB 5HPGA 1G2LB 1CQEA 3N8VA 2CJIB 4ZH8B 5CKNA 2K51A 2P28B 1WU1B 4C16A 2K2TA 1I71A 1EPJA 4BDXA 1NL1A 3BT1A 1HAEA 1L3YA 2UWOB 1OB1C 3DEMA 2BZ6L 4M10A 1TLEA 1U67A 1JFNA 3ENSA 1IOEL 2W3KB 2WG3C 2WPME 4RRXA 3SP8A 1HPJA 1F0SB 1YUGA 2BQWA 1NL2A 4COXA 1V3XB 2BOKL 2BOXA 2VVUL 3GCWE 3E6PL 3Q3KB 4E1GA 2KL7A 3SW2A 3OLTA 3BPSE 3NXPA 4D0EA 3KQDL 2W26B 3LN1A 1NFWB 2FLRL 1LPKA 1DDXA 1F7EA 4XBMA 2XC0L 4Y71B 2VVVL 1FAKL 2PR3B 3MDLA 5F19A 2Y5HL 1PRHA 3TBDA 1PTHA 1IQML 1P0SL 1QFKL 1Z6EL 2XBVL 4M11A 4ZAEB 4Z0KB 1IQGL 4RRWA 1BHTA 2PK4A 2BOUA 1HT8A 2PUQL 1I5KA 5CT1A 2KB9A 4BVWA 1MQ5L 3NTGA 4NG9L 1IP0A 2J95B 1URKA 1EQHA 3LAQA 1IGXA 1APOA 5JB8E 2Y80B 5L2ZL 1DIYA 5IKRA 2OYEP 2FD6A 4XL1A 4D90A 2JKHL 3IJEB 2B7DL 1YGCL 3N8YA 1HRFA 2VWMK 2OYUP 5F1AA 1G1RA 4HZHA 2VWNL 3FFGL 4JZFL 5JB9E 4ZHAB 4BV7A 1TOZA 2WFTA 2W2PE 1IQHL 3HO4A 2W2NE 1DVAL 4NZQA 1N1IA 3CS7L 5CT3A 3FCSB 2UWLB 3HO3A 3KK6A 1FE2A 2RHPA 4CUDA 5L30L 3RR3A 1G2MB 3KIVA 3MKPA 4PH9A 2Y5FL 3Q7DA 2BO2A 3NJPC 4Y7AB 2W2OE 1LPGA 2J38B 1IOXA 2EI6B 2W86A 3TK5B 3N8WB 3V64C 2K4RA 4JZDL 3HS6A 2H9EL 1HCGB 4AQTA 1KDUA 1LMJA 2QJ4A 1KIVA 3ELAL 1KSNB 1NK1A 1NFUB 1TPKA 4KIVA 3LIWB 4RRZA 2P26A 4D0FA 1HAFA 1MOXC 2BQ6A 1IQJL 5IKQA 2J94B 3ASIA 1PFXL 2W2QE 3QH0A 1SZBA 1NQLB 1UZQA 3CA7A 3M36L 5CS3A 1KI0A 5IKTA 1G1SA 2VWLL 5K0HB 4Z0LA 2Y38A 3IITB 5JBAE 2KV4A 4JYVL 1JV2B 1XKAL 1A0HA 3MQEA 1A3PA 1M1XB 3F6UL 2HPPP 3BT2A 2L0SA 2F9BL 3SOBB 2WPHE 1APQA 2FLBL 5E8DA 1Q4GA 3LTGD 1NFYB 3POYA 4CIKA 3P5BL 3LC3B 4O1ZA 1CEBA 4FM5A 4CUFA 1F0RB 5CISA 1DX5I 1CCFA 4Y7BB 1C5MF 2P3UA 3CFWA 4Y6DB 4CSYA 1B9WA 1DQBA 1IQKL 1FJSL 1K37A 1KRNA 3ZYJB 2I9AA 4A7IA 1J9CL 2XBXL 3QMOA 1NPEB 3SOQA 4Z6AL 5CSQA 3FBYA 1ATBA 4X8TL 4YT6L 4O02B 4BVDA 1LQDA 1O5DL 2KJ4A 4BTIA 1COUA 3QCWA 4G1MB 1ATDA 3F1SB 3GCXE 5CKMA 1AUTL 2DOIA 2P95L 1EMOA 2FLGA 2W3IB 3M37L 5COEA 5CS5A 2VH0B 3KQCL 2K2SB 4BVCA 6COXA 1EPHA 4BV5A 1CVWL 1X7AL 2Y81B 2J4IB 1NFXB 1G1TA 4BXSA 1I0UA 1CEJA 3N8ZA 1JBUL 5JBCE 4RRYA 3EGFA 4JZEL 1ATEA 1CCVA 2WYJB 3HS7A 2VJ3A 2MGRA 1GK5A 4XLWA 2QJ2A 4O03A 2VH6B 2PHBB 2UWPB 4LMFA 2FEBA 5KN5C 1PKRA 2YGPA 2BQ7A 4ZXXL 2I9BA 1NT0A 3LN0A 3TZIA 1EPIA 2P3TA 1N7DA 4MMZB 1KIGL 1JL9A 3TGFA 1L5GB 3K65A 2VVCK 2J2UB 5KIRA 4X8VL 1W8BL 4TGFA 2FZZL 2RNLA 4BXWA 4Y79B 1HREA 3HPTA 2J34B 5FDQA 1EBVA 3C9AC 4ISHL 3KL6B 1IQEL 4MMXB 1WHEA 2P93L 1HT5A 1W7XL 2XC5L 1FAXL 3SOVA 1ADXA 3N8YB 1GP9A 5JW1A 2WPKE 3H5CB 2Y7ZB 1IQNL 1RFNB 4MMYB 1B2IA 1HJ7A 1WHFA 1MQ6L 2P3FN 3PGHA 1PK4A 5CT2A
chains in the Genus database with same CATH superfamily
3U73A 1NZIA 1HPKA 1YO8A 2TGFA 1FSBA 1EAIC 2EI7B 5L2YL 1HX2A 1EMNA 2P16L 4A5TS 2PF1A 3N8XA 1PK2A 1KLIL 2W2ME 2Y82B 1P9JA 4CUEA 1V1IA 1F7MA 4RUTA 1PGEA 4NA9L 1BF9A 4BDWA 2Y5GL 1Z6CA 2Q1JB 2Y7XB 5JVZA 3CENL 5EGMB 5CKQA 1EQGA 3NTBA 2DOHX 1PMLA 1IVOC 2DDUA 4ISIL 1KLJL 1LPZA 3KQBL 5CS9A 2VWOL 3OLUA 2WZPP 2P3FL 3N8WA 1U8CB 4X8SL 1UZKA 3LTFB 3V65B 4RS0A 2XBWL 3KCGL 1EPGA 2HOXA 4Y76B 1CVUA 1FF7A 1K36A 2BT8A 4D3CA 4IUAA 1YUFA 5I46L 2WPJE 1IJQA 1CX2A 1IQFL 2G00L 3NT1A 4YT7L 2BOHA 3TK6B 3KQEL 3GISX 2MHPA 1PMKA 1HZ8A 1PXXA 2P94L 3LC5B 4YZUB 2KNFA 2BMGA 4BVVA 3TH3L 2XC4L 2PF2A 5JBBE 1EZQB 1IQIL 5CP9A 2WYGB 4X8UL 3KRKA 3HO5A 2YGOA 1YUKB 4DURA 2AYLA 5IKVA 2XBYL 4JYUL 4ZXYL 3K9XA 4LORA 1G1QA 2GD4A 5JVYA 2EI8B 4OTJA 2SPTA 2D1JB 1GMNA 1TPGA 4BTTA 2NPRA 2WG4B 1IGZA 4OTYA 1XFEA 1CEAA 3R05A 1FFMA 3ZYIB 1ATAA 1GMOA 2M74A 3HS5A 1XDTR 3U7UG 5CS1A 2MGPA 1EGFA 5COXA 2WPLE 3HN4A 1IQLL 1UZJA 1XKBA 4BTUA 3ZYGA 1UZPA 2RA0L 1ZAQA 2HPQP 1KLOA 2WPIE 4NGAL 2ADXA 2WFXB 5HPGA 1G2LB 1CQEA 3N8VA 2CJIB 4ZH8B 5CKNA 2K51A 2P28B 1WU1B 4C16A 4GU4A 2K2TA 1I71A 1EPJA 4BDXA 1NL1A 3BT1A 1HAEA 1L3YA 2UWOB 1OB1C 3DEMA 2BZ6L 4M10A 1TLEA 1U67A 1JFNA 3ENSA 1IOEL 2W3KB 2WG3C 2WPME 4RRXA 3SP8A 1HPJA 1F0SB 1YUGA 2BQWA 1NL2A 4COXA 1V3XB 2BOKL 2BOXA 2VVUL 3GCWE 3E6PL 3Q3KB 4E1GA 2KL7A 3SW2A 3OLTA 3BPSE 3NXPA 4D0EA 3KQDL 2W26B 3LN1A 1NFWB 2FLRL 1LPKA 1DDXA 1F7EA 4XBMA 2XC0L 1KKEA 4Y71B 2VVVL 1FAKL 2PR3B 3MDLA 5F19A 2Y5HL 1PRHA 3TBDA 1PTHA 1IQML 1P0SL 1QFKL 1Z6EL 2XBVL 4M11A 4ZAEB 4Z0KB 1IQGL 4RRWA 1BHTA 2PK4A 2BOUA 1HT8A 2PUQL 1I5KA 5CT1A 2KB9A 4BVWA 1MQ5L 3NTGA 4NG9L 1IP0A 2J95B 1URKA 2BT7A 1EQHA 3LAQA 1IGXA 1APOA 1QIUA 2Y80B 5JB8E 1DIYA 5IKRA 2OYEP 2FD6A 4XL1A 4D90A 5L2ZL 2JKHL 3IJEB 2B7DL 1YGCL 3S6XA 3N8YA 1HRFA 2VWMK 2OYUP 2YGQA 5F1AA 1G1RA 4HZHA 2VWNL 3FFGL 4JZFL 5JB9E 4ZHAB 4BV7A 1TOZA 2WFTA 2W2PE 1IQHL 3HO4A 2W2NE 1DVAL 4NZQA 1N1IA 3CS7L 5CT3A 2JJLA 3FCSB 2UWLB 3HO3A 3KK6A 1FE2A 2RHPA 4CUDA 5L30L 1V1HA 2H9EC 3RR3A 1G2MB 2KNIA 3KIVA 3MKPA 4PH9A 2Y5FL 3Q7DA 2BO2A 3NJPC 4Y7AB 2W2OE 1LPGA 2J38B 1IOXA 2EI6B 2W86A 3TK5B 3N8WB 3V64C 2K4RA 4JZDL 3HS6A 2H9EL 1HCGB 4AQTA 1KDUA 1LMJA 2QJ4A 1KIVA 3ELAL 1KSNB 1NK1A 1NFUB 1TPKA 4KIVA 3LIWB 4RRZA 2P26A 4D0FA 1LK9A 1HAFA 1MOXC 2BQ6A 1IQJL 5IKQA 2J94B 3ASIA 1PFXL 2W2QE 3QH0A 1SZBA 1NQLB 1UZQA 3CA7A 3M36L 5CS3A 1KI0A 5IKTA 1G1SA 2VWLL 2BSFA 5K0HB 4Z0LA 2Y38A 3IITB 5JBAE 2KV4A 4JYVL 1JV2B 1XKAL 1A0HA 3MQEA 1A3PA 1M1XB 3F6UL 2HPPP 3BT2A 2L0SA 2F9BL 3SOBB 2WPHE 1APQA 2FLBL 5E8DA 1Q4GA 3LTGD 1NFYB 3POYA 4CIKA 3P5BL 3LC3B 4O1ZA 4A94C 1CEBA 4FM5A 4CUFA 1F0RB 5CISA 1DX5I 1CCFA 4Y7BB 1C5MF 2P3UA 3CFWA 4Y6DB 4CSYA 1B9WA 1DQBA 1IQKL 1FJSL 1K37A 1KRNA 3ZYJB 2I9AA 2HORA 4A7IA 1J9CL 2XBXL 3QMOA 1NPEB 3SOQA 4Z6AL 5CSQA 3FBYA 1ATBA 4X8TL 4YT6L 4O02B 4BVDA 1LQDA 1O5DL 2KJ4A 4BTIA 1COUA 3QCWA 4G1MB 1ATDA 3F1SB 3GCXE 5CKMA 1AUTL 2DOIA 2P95L 1EMOA 2FLGA 2W3IB 3M37L 5COEA 5CS5A 2VH0B 3KQCL 2K2SB 4BVCA 6COXA 1EPHA 4BV5A 1CVWL 1X7AL 2Y81B 2J4IB 1NFXB 1G1TA 4BXSA 1I0UA 1CEJA 3N8ZA 4GU3A 1JBUL 5JBCE 4RRYA 3EGFA 4JZEL 1ATEA 1CCVA 2WYJB 3HS7A 2VJ3A 2MGRA 1GK5A 4XLWA 2QJ2A 4O03A 2VH6B 2PHBB 2UWPB 4LMFA 2FEBA 5KN5C 1PKRA 2YGPA 2BQ7A 4ZXXL 2I9BA 1NT0A 3LN0A 3TZIA 1EPIA 2P3TA 1N7DA 4MMZB 1KIGL 1JL9A 3TGFA 1L5GB 3K65A 2VVCK 2J2UB 5KIRA 4X8VL 1W8BL 4TGFA 2FZZL 2RNLA 4BXWA 4Y79B 1HREA 3HPTA 2J34B 5FDQA 1EBVA 3C9AC 4ISHL 3KL6B 1IQEL 1LMMA 4MMXB 1WHEA 2P93L 1HT5A 1W7XL 2XC5L 1FAXL 2VRSA 3SOVA 1ADXA 3N8YB 1GP9A 5JW1A 2WPKE 3H5CB 2Y7ZB 1IQNL 1RFNB 4MMYB 1B2IA 1HJ7A 1WHFA 1MQ6L 2P3FN 3PGHA 1PK4A 5CT2A
chains in the Genus database with same CATH topology
3U73A 1NZIA 1HPKA 1YO8A 2TGFA 1FSBA 1EAIC 2EI7B 5L2YL 1HX2A 1EMNA 2P16L 4A5TS 2PF1A 3N8XA 1PK2A 1KLIL 2W2ME 2Y82B 1P9JA 4CUEA 1F7MA 4RUTA 1PGEA 4NA9L 1BF9A 4BDWA 2Y5GL 1Z6CA 2Q1JB 2Y7XB 5JVZA 3CENL 5EGMB 5CKQA 1EQGA 3NTBA 2DOHX 1PMLA 1IVOC 2DDUA 4ISIL 1KLJL 1LPZA 3KQBL 5CS9A 2VWOL 3OLUA 2WZPP 2P3FL 3N8WA 1U8CB 4X8SL 1UZKA 3LTFB 3V65B 4RS0A 2XBWL 3KCGL 1EPGA 4Y76B 1CVUA 1FF7A 1K36A 4D3CA 4IUAA 1YUFA 5I46L 2WPJE 1IJQA 1CX2A 1IQFL 2G00L 3NT1A 4YT7L 2BOHA 3TK6B 3KQEL 3GISX 2MHPA 1PMKA 1HZ8A 1PXXA 2P94L 3LC5B 4YZUB 2KNFA 2BMGA 4BVVA 3TH3L 2XC4L 2PF2A 5JBBE 1EZQB 1IQIL 5CP9A 2WYGB 4X8UL 3KRKA 3HO5A 2YGOA 1YUKB 4DURA 2AYLA 5IKVA 2XBYL 4JYUL 4ZXYL 3K9XA 4LORA 1G1QA 2GD4A 5JVYA 2EI8B 4OTJA 2SPTA 2D1JB 1GMNA 1TPGA 4BTTA 2NPRA 2WG4B 1IGZA 4OTYA 1XFEA 1CEAA 3R05A 1FFMA 3ZYIB 1ATAA 1GMOA 2M74A 3HS5A 1XDTR 3U7UG 5CS1A 2MGPA 1EGFA 5COXA 2WPLE 3HN4A 1IQLL 1UZJA 1XKBA 4BTUA 3ZYGA 1UZPA 2RA0L 1ZAQA 2HPQP 1KLOA 2WPIE 4NGAL 2ADXA 2WFXB 5HPGA 1G2LB 1CQEA 3N8VA 2CJIB 4ZH8B 5CKNA 2K51A 2P28B 1WU1B 4C16A 2K2TA 1I71A 1EPJA 4BDXA 1NL1A 3BT1A 1HAEA 1L3YA 2UWOB 1OB1C 3DEMA 2BZ6L 4M10A 1TLEA 1U67A 1JFNA 3ENSA 1IOEL 2W3KB 2WG3C 2WPME 4RRXA 3SP8A 1HPJA 1F0SB 1YUGA 2BQWA 1NL2A 4COXA 1V3XB 2BOKL 2BOXA 2VVUL 3GCWE 3E6PL 3Q3KB 4E1GA 2KL7A 3SW2A 3OLTA 3BPSE 3NXPA 4D0EA 3KQDL 2W26B 3LN1A 1NFWB 2FLRL 1LPKA 1DDXA 1F7EA 4XBMA 2XC0L 4Y71B 2VVVL 1FAKL 2PR3B 3MDLA 5F19A 2Y5HL 1PRHA 3TBDA 1PTHA 1IQML 1P0SL 1QFKL 1Z6EL 2XBVL 4M11A 4ZAEB 4Z0KB 1IQGL 4RRWA 1BHTA 2PK4A 2BOUA 1HT8A 2PUQL 1I5KA 5CT1A 2KB9A 4BVWA 1MQ5L 3NTGA 4NG9L 1IP0A 2J95B 1URKA 1EQHA 3LAQA 1IGXA 1APOA 5JB8E 2Y80B 5L2ZL 1DIYA 5IKRA 2OYEP 2FD6A 4XL1A 4D90A 2JKHL 3IJEB 2B7DL 1YGCL 3S6XA 3N8YA 1HRFA 2VWMK 2OYUP 2YGQA 5F1AA 1G1RA 4HZHA 2VWNL 3FFGL 4JZFL 5JB9E 4ZHAB 4BV7A 1TOZA 2WFTA 2W2PE 1IQHL 3HO4A 2W2NE 1DVAL 4NZQA 1N1IA 3CS7L 5CT3A 3FCSB 2UWLB 3HO3A 3KK6A 1FE2A 2RHPA 4CUDA 5L30L 2H9EC 3RR3A 1G2MB 2KNIA 3KIVA 3MKPA 4PH9A 2Y5FL 3Q7DA 2BO2A 3NJPC 4Y7AB 2W2OE 1LPGA 2J38B 1IOXA 2EI6B 2W86A 3TK5B 3N8WB 3V64C 2K4RA 4JZDL 3HS6A 2H9EL 1HCGB 4AQTA 1KDUA 1LMJA 2QJ4A 1KIVA 3ELAL 1KSNB 1NK1A 1NFUB 1TPKA 4KIVA 3LIWB 4RRZA 2P26A 4D0FA 1HAFA 1MOXC 2BQ6A 1IQJL 5IKQA 2J94B 3ASIA 1PFXL 2W2QE 3QH0A 1SZBA 1NQLB 1UZQA 3CA7A 3M36L 5CS3A 1KI0A 5IKTA 1G1SA 2VWLL 5K0HB 4Z0LA 2Y38A 3IITB 5JBAE 2KV4A 4JYVL 1JV2B 1XKAL 1A0HA 3MQEA 1A3PA 1M1XB 3F6UL 2HPPP 3BT2A 2L0SA 2F9BL 3SOBB 2WPHE 1APQA 2FLBL 5E8DA 1Q4GA 3LTGD 1NFYB 3POYA 4CIKA 3P5BL 3LC3B 4O1ZA 4A94C 1CEBA 4FM5A 4CUFA 1F0RB 5CISA 1DX5I 1CCFA 4Y7BB 1C5MF 2P3UA 3CFWA 4Y6DB 4CSYA 1B9WA 1DQBA 1IQKL 1FJSL 1K37A 1KRNA 3ZYJB 2I9AA 4A7IA 1J9CL 2XBXL 3QMOA 1NPEB 3SOQA 4Z6AL 5CSQA 3FBYA 1ATBA 4X8TL 4YT6L 4O02B 4BVDA 1LQDA 1O5DL 2KJ4A 4BTIA 1COUA 3QCWA 4G1MB 1ATDA 3F1SB 3GCXE 5CKMA 1AUTL 2DOIA 2P95L 1EMOA 2FLGA 2W3IB 3M37L 5COEA 5CS5A 2VH0B 3KQCL 2K2SB 4BVCA 6COXA 1EPHA 4BV5A 1CVWL 1X7AL 2Y81B 2J4IB 1NFXB 1G1TA 4BXSA 1I0UA 1CEJA 3N8ZA 1JBUL 5JBCE 4RRYA 3EGFA 4JZEL 1ATEA 1CCVA 2WYJB 3HS7A 2VJ3A 2MGRA 1GK5A 4XLWA 2QJ2A 4O03A 2VH6B 2PHBB 2UWPB 4LMFA 2FEBA 5KN5C 1PKRA 2YGPA 2BQ7A 4ZXXL 2I9BA 1NT0A 3LN0A 3TZIA 1EPIA 2P3TA 1N7DA 4MMZB 1KIGL 1JL9A 3TGFA 1L5GB 3K65A 2VVCK 2J2UB 5KIRA 4X8VL 1W8BL 4TGFA 2FZZL 2RNLA 4BXWA 4Y79B 1HREA 3HPTA 2J34B 5FDQA 1EBVA 3C9AC 4ISHL 3KL6B 1IQEL 1LMMA 4MMXB 1WHEA 2P93L 1HT5A 1W7XL 2XC5L 1FAXL 3SOVA 1ADXA 3N8YB 1GP9A 5JW1A 2WPKE 3H5CB 2Y7ZB 1IQNL 1RFNB 4MMYB 1B2IA 1HJ7A 1WHFA 1MQ6L 2P3FN 3PGHA 1PK4A 5CT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U73 A;  1NZI A;  1HPK A;  1YO8 A;  2TGF A;  1FSB A;  1EAI C;  2EI7 B;  5L2Y L;  1HX2 A;  1EMN A;  2P16 L;  4A5T S;  2PF1 A;  3N8X A;  1PK2 A;  1KLI L;  2W2M E;  2Y82 B;  1P9J A;  4CUE A;  1F7M A;  4RUT A;  1PGE A;  4NA9 L;  1BF9 A;  4BDW A;  2Y5G L;  1Z6C A;  2Q1J B;  2Y7X B;  5JVZ A;  3CEN L;  5EGM B;  5CKQ A;  1EQG A;  3NTB A;  2DOH X;  1PML A;  1IVO C;  2DDU A;  4ISI L;  1KLJ L;  1LPZ A;  3KQB L;  5CS9 A;  2VWO L;  3OLU A;  2P3F L;  3N8W A;  1U8C B;  4X8S L;  1UZK A;  3LTF B;  3V65 B;  4RS0 A;  2XBW L;  3KCG L;  1EPG A;  4Y76 B;  1CVU A;  1FF7 A;  1K36 A;  4D3C A;  4IUA A;  1YUF A;  5I46 L;  2WPJ E;  1IJQ A;  1CX2 A;  1IQF L;  2G00 L;  3NT1 A;  4YT7 L;  2BOH A;  3TK6 B;  3KQE L;  3GIS X;  2MHP A;  1PMK A;  1HZ8 A;  1PXX A;  2P94 L;  3LC5 B;  4YZU B;  2KNF A;  2BMG A;  4BVV A;  3TH3 L;  2XC4 L;  2PF2 A;  5JBB E;  1EZQ B;  1IQI L;  5CP9 A;  2WYG B;  4X8U L;  3KRK A;  3HO5 A;  2YGO A;  1YUK B;  4DUR A;  2AYL A;  5IKV A;  2XBY L;  4JYU L;  4ZXY L;  3K9X A;  4LOR A;  1G1Q A;  2GD4 A;  5JVY A;  2EI8 B;  4OTJ A;  2SPT A;  2D1J B;  1GMN A;  1TPG A;  4BTT A;  2NPR A;  2WG4 B;  1IGZ A;  4OTY A;  1XFE A;  1CEA A;  3R05 A;  1FFM A;  3ZYI B;  1ATA A;  1GMO A;  2M74 A;  3HS5 A;  1XDT R;  3U7U G;  5CS1 A;  2MGP A;  1EGF A;  5COX A;  2WPL E;  3HN4 A;  1IQL L;  1UZJ A;  1XKB A;  4BTU A;  3ZYG A;  1UZP A;  2RA0 L;  1ZAQ A;  2HPQ P;  1KLO A;  2WPI E;  4NGA L;  2ADX A;  2WFX B;  5HPG A;  1G2L B;  1CQE A;  3N8V A;  2CJI B;  4ZH8 B;  5CKN A;  2K51 A;  2P28 B;  1WU1 B;  4C16 A;  2K2T A;  1I71 A;  1EPJ A;  4BDX A;  1NL1 A;  3BT1 A;  1HAE A;  1L3Y A;  2UWO B;  1OB1 C;  3DEM A;  2BZ6 L;  4M10 A;  1TLE A;  1U67 A;  1JFN A;  3ENS A;  1IOE L;  2W3K B;  2WG3 C;  2WPM E;  4RRX A;  3SP8 A;  1HPJ A;  1F0S B;  1YUG A;  2BQW A;  1NL2 A;  4COX A;  1V3X B;  2BOK L;  2BOX A;  2VVU L;  3GCW E;  3E6P L;  3Q3K B;  4E1G A;  2KL7 A;  3SW2 A;  3OLT A;  3BPS E;  3NXP A;  4D0E A;  3KQD L;  2W26 B;  3LN1 A;  1NFW B;  2FLR L;  1LPK A;  1DDX A;  1F7E A;  4XBM A;  2XC0 L;  4Y71 B;  2VVV L;  1FAK L;  2PR3 B;  3MDL A;  5F19 A;  2Y5H L;  1PRH A;  3TBD A;  1PTH A;  1IQM L;  1P0S L;  1QFK L;  1Z6E L;  2XBV L;  4M11 A;  4ZAE B;  4Z0K B;  1IQG L;  4RRW A;  1BHT A;  2PK4 A;  2BOU A;  1HT8 A;  2PUQ L;  1I5K A;  5CT1 A;  2KB9 A;  4BVW A;  1MQ5 L;  3NTG A;  4NG9 L;  1IP0 A;  2J95 B;  1URK A;  1EQH A;  3LAQ A;  1IGX A;  1APO A;  5JB8 E;  2Y80 B;  5L2Z L;  1DIY A;  5IKR A;  2OYE P;  2FD6 A;  4XL1 A;  4D90 A;  2JKH L;  3IJE B;  2B7D L;  1YGC L;  3N8Y A;  1HRF A;  2VWM K;  2OYU P;  5F1A A;  1G1R A;  4HZH A;  2VWN L;  3FFG L;  4JZF L;  5JB9 E;  4ZHA B;  4BV7 A;  1TOZ A;  2WFT A;  2W2P E;  1IQH L;  3HO4 A;  2W2N E;  1DVA L;  4NZQ A;  1N1I A;  3CS7 L;  5CT3 A;  3FCS B;  2UWL B;  3HO3 A;  3KK6 A;  1FE2 A;  2RHP A;  4CUD A;  5L30 L;  3RR3 A;  1G2M B;  3KIV A;  3MKP A;  4PH9 A;  2Y5F L;  3Q7D A;  2BO2 A;  3NJP C;  4Y7A B;  2W2O E;  1LPG A;  2J38 B;  1IOX A;  2EI6 B;  2W86 A;  3TK5 B;  3N8W B;  3V64 C;  2K4R A;  4JZD L;  3HS6 A;  2H9E L;  1HCG B;  4AQT A;  1KDU A;  1LMJ A;  2QJ4 A;  1KIV A;  3ELA L;  1KSN B;  1NK1 A;  1NFU B;  1TPK A;  4KIV A;  3LIW B;  4RRZ A;  2P26 A;  4D0F A;  1HAF A;  1MOX C;  2BQ6 A;  1IQJ L;  5IKQ A;  2J94 B;  3ASI A;  1PFX L;  2W2Q E;  3QH0 A;  1SZB A;  1NQL B;  1UZQ A;  3CA7 A;  3M36 L;  5CS3 A;  1KI0 A;  5IKT A;  1G1S A;  2VWL L;  5K0H B;  4Z0L A;  2Y38 A;  3IIT B;  5JBA E;  2KV4 A;  4JYV L;  1JV2 B;  1XKA L;  1A0H A;  3MQE A;  1A3P A;  1M1X B;  3F6U L;  2HPP P;  3BT2 A;  2L0S A;  2F9B L;  3SOB B;  2WPH E;  1APQ A;  2FLB L;  5E8D A;  1Q4G A;  3LTG D;  1NFY B;  3POY A;  4CIK A;  3P5B L;  3LC3 B;  4O1Z A;  1CEB A;  4FM5 A;  4CUF A;  1F0R B;  5CIS A;  1DX5 I;  1CCF A;  4Y7B B;  1C5M F;  2P3U A;  3CFW A;  4Y6D B;  4CSY A;  1B9W A;  1DQB A;  1IQK L;  1FJS L;  1K37 A;  1KRN A;  3ZYJ B;  2I9A A;  4A7I A;  1J9C L;  2XBX L;  3QMO A;  1NPE B;  3SOQ A;  4Z6A L;  5CSQ A;  3FBY A;  1ATB A;  4X8T L;  4YT6 L;  4O02 B;  4BVD A;  1LQD A;  1O5D L;  2KJ4 A;  4BTI A;  1COU A;  3QCW A;  4G1M B;  1ATD A;  3F1S B;  3GCX E;  5CKM A;  1AUT L;  2DOI A;  2P95 L;  1EMO A;  2FLG A;  2W3I B;  3M37 L;  5COE A;  5CS5 A;  2VH0 B;  3KQC L;  2K2S B;  4BVC A;  6COX A;  1EPH A;  4BV5 A;  1CVW L;  1X7A L;  2Y81 B;  2J4I B;  1NFX B;  1G1T A;  4BXS A;  1I0U A;  1CEJ A;  3N8Z A;  1JBU L;  5JBC E;  4RRY A;  3EGF A;  4JZE L;  1ATE A;  1CCV A;  2WYJ B;  3HS7 A;  2VJ3 A;  2MGR A;  1GK5 A;  4XLW A;  2QJ2 A;  4O03 A;  2VH6 B;  2PHB B;  2UWP B;  4LMF A;  2FEB A;  5KN5 C;  1PKR A;  2YGP A;  2BQ7 A;  4ZXX L;  2I9B A;  1NT0 A;  3LN0 A;  3TZI A;  1EPI A;  2P3T A;  1N7D A;  4MMZ B;  1KIG L;  1JL9 A;  3TGF A;  1L5G B;  3K65 A;  2VVC K;  2J2U B;  5KIR A;  4X8V L;  1W8B L;  4TGF A;  2FZZ L;  2RNL A;  4BXW A;  4Y79 B;  1HRE A;  3HPT A;  2J34 B;  5FDQ A;  1EBV A;  3C9A C;  4ISH L;  3KL6 B;  1IQE L;  4MMX B;  1WHE A;  2P93 L;  1HT5 A;  1W7X L;  2XC5 L;  1FAX L;  3SOV A;  1ADX A;  3N8Y B;  1GP9 A;  5JW1 A;  2WPK E;  3H5C B;  2Y7Z B;  1IQN L;  1RFN B;  4MMY B;  1B2I A;  1HJ7 A;  1WHF A;  1MQ6 L;  2P3F N;  3PGH A;  1PK4 A;  5CT2 A; 
#chains in the Genus database with same CATH topology
 3U73 A;  1NZI A;  1HPK A;  1YO8 A;  2TGF A;  1FSB A;  1EAI C;  2EI7 B;  5L2Y L;  1HX2 A;  1EMN A;  2P16 L;  4A5T S;  2PF1 A;  3N8X A;  1PK2 A;  1KLI L;  2W2M E;  2Y82 B;  1P9J A;  4CUE A;  1V1I A;  1F7M A;  4RUT A;  1PGE A;  4NA9 L;  1BF9 A;  4BDW A;  2Y5G L;  1Z6C A;  2Q1J B;  2Y7X B;  5JVZ A;  3CEN L;  5EGM B;  5CKQ A;  1EQG A;  3NTB A;  2DOH X;  1PML A;  1IVO C;  2DDU A;  4ISI L;  1KLJ L;  1LPZ A;  3KQB L;  5CS9 A;  2VWO L;  3OLU A;  2WZP P;  2P3F L;  3N8W A;  1U8C B;  4X8S L;  1UZK A;  3LTF B;  3V65 B;  4RS0 A;  2XBW L;  3KCG L;  1EPG A;  2HOX A;  4Y76 B;  1CVU A;  1FF7 A;  1K36 A;  2BT8 A;  4D3C A;  4IUA A;  1YUF A;  5I46 L;  2WPJ E;  1IJQ A;  1CX2 A;  1IQF L;  2G00 L;  3NT1 A;  4YT7 L;  2BOH A;  3TK6 B;  3KQE L;  3GIS X;  2MHP A;  1PMK A;  1HZ8 A;  1PXX A;  2P94 L;  3LC5 B;  4YZU B;  2KNF A;  2BMG A;  4BVV A;  3TH3 L;  2XC4 L;  2PF2 A;  5JBB E;  1EZQ B;  1IQI L;  5CP9 A;  2WYG B;  4X8U L;  3KRK A;  3HO5 A;  2YGO A;  1YUK B;  4DUR A;  2AYL A;  5IKV A;  2XBY L;  4JYU L;  4ZXY L;  3K9X A;  4LOR A;  1G1Q A;  2GD4 A;  5JVY A;  2EI8 B;  4OTJ A;  2SPT A;  2D1J B;  1GMN A;  1TPG A;  4BTT A;  2NPR A;  2WG4 B;  1IGZ A;  4OTY A;  1XFE A;  1CEA A;  3R05 A;  1FFM A;  3ZYI B;  1ATA A;  1GMO A;  2M74 A;  3HS5 A;  1XDT R;  3U7U G;  5CS1 A;  2MGP A;  1EGF A;  5COX A;  2WPL E;  3HN4 A;  1IQL L;  1UZJ A;  1XKB A;  4BTU A;  3ZYG A;  1UZP A;  2RA0 L;  1ZAQ A;  2HPQ P;  1KLO A;  2WPI E;  4NGA L;  2ADX A;  2WFX B;  5HPG A;  1G2L B;  1CQE A;  3N8V A;  2CJI B;  4ZH8 B;  5CKN A;  2K51 A;  2P28 B;  1WU1 B;  4C16 A;  4GU4 A;  2K2T A;  1I71 A;  1EPJ A;  4BDX A;  1NL1 A;  3BT1 A;  1HAE A;  1L3Y A;  2UWO B;  1OB1 C;  3DEM A;  2BZ6 L;  4M10 A;  1TLE A;  1U67 A;  1JFN A;  3ENS A;  1IOE L;  2W3K B;  2WG3 C;  2WPM E;  4RRX A;  3SP8 A;  1HPJ A;  1F0S B;  1YUG A;  2BQW A;  1NL2 A;  4COX A;  1V3X B;  2BOK L;  2BOX A;  2VVU L;  3GCW E;  3E6P L;  3Q3K B;  4E1G A;  2KL7 A;  3SW2 A;  3OLT A;  3BPS E;  3NXP A;  4D0E A;  3KQD L;  2W26 B;  3LN1 A;  1NFW B;  2FLR L;  1LPK A;  1DDX A;  1F7E A;  4XBM A;  2XC0 L;  1KKE A;  4Y71 B;  2VVV L;  1FAK L;  2PR3 B;  3MDL A;  5F19 A;  2Y5H L;  1PRH A;  3TBD A;  1PTH A;  1IQM L;  1P0S L;  1QFK L;  1Z6E L;  2XBV L;  4M11 A;  4ZAE B;  4Z0K B;  1IQG L;  4RRW A;  1BHT A;  2PK4 A;  2BOU A;  1HT8 A;  2PUQ L;  1I5K A;  5CT1 A;  2KB9 A;  4BVW A;  1MQ5 L;  3NTG A;  4NG9 L;  1IP0 A;  2J95 B;  1URK A;  2BT7 A;  1EQH A;  3LAQ A;  1IGX A;  1APO A;  1QIU A;  2Y80 B;  5JB8 E;  1DIY A;  5IKR A;  2OYE P;  2FD6 A;  4XL1 A;  4D90 A;  5L2Z L;  2JKH L;  3IJE B;  2B7D L;  1YGC L;  3S6X A;  3N8Y A;  1HRF A;  2VWM K;  2OYU P;  2YGQ A;  5F1A A;  1G1R A;  4HZH A;  2VWN L;  3FFG L;  4JZF L;  5JB9 E;  4ZHA B;  4BV7 A;  1TOZ A;  2WFT A;  2W2P E;  1IQH L;  3HO4 A;  2W2N E;  1DVA L;  4NZQ A;  1N1I A;  3CS7 L;  5CT3 A;  2JJL A;  3FCS B;  2UWL B;  3HO3 A;  3KK6 A;  1FE2 A;  2RHP A;  4CUD A;  5L30 L;  1V1H A;  2H9E C;  3RR3 A;  1G2M B;  2KNI A;  3KIV A;  3MKP A;  4PH9 A;  2Y5F L;  3Q7D A;  2BO2 A;  3NJP C;  4Y7A B;  2W2O E;  1LPG A;  2J38 B;  1IOX A;  2EI6 B;  2W86 A;  3TK5 B;  3N8W B;  3V64 C;  2K4R A;  4JZD L;  3HS6 A;  2H9E L;  1HCG B;  4AQT A;  1KDU A;  1LMJ A;  2QJ4 A;  1KIV A;  3ELA L;  1KSN B;  1NK1 A;  1NFU B;  1TPK A;  4KIV A;  3LIW B;  4RRZ A;  2P26 A;  4D0F A;  1LK9 A;  1HAF A;  1MOX C;  2BQ6 A;  1IQJ L;  5IKQ A;  2J94 B;  3ASI A;  1PFX L;  2W2Q E;  3QH0 A;  1SZB A;  1NQL B;  1UZQ A;  3CA7 A;  3M36 L;  5CS3 A;  1KI0 A;  5IKT A;  1G1S A;  2VWL L;  2BSF A;  5K0H B;  4Z0L A;  2Y38 A;  3IIT B;  5JBA E;  2KV4 A;  4JYV L;  1JV2 B;  1XKA L;  1A0H A;  3MQE A;  1A3P A;  1M1X B;  3F6U L;  2HPP P;  3BT2 A;  2L0S A;  2F9B L;  3SOB B;  2WPH E;  1APQ A;  2FLB L;  5E8D A;  1Q4G A;  3LTG D;  1NFY B;  3POY A;  4CIK A;  3P5B L;  3LC3 B;  4O1Z A;  4A94 C;  1CEB A;  4FM5 A;  4CUF A;  1F0R B;  5CIS A;  1DX5 I;  1CCF A;  4Y7B B;  1C5M F;  2P3U A;  3CFW A;  4Y6D B;  4CSY A;  1B9W A;  1DQB A;  1IQK L;  1FJS L;  1K37 A;  1KRN A;  3ZYJ B;  2I9A A;  2HOR A;  4A7I A;  1J9C L;  2XBX L;  3QMO A;  1NPE B;  3SOQ A;  4Z6A L;  5CSQ A;  3FBY A;  1ATB A;  4X8T L;  4YT6 L;  4O02 B;  4BVD A;  1LQD A;  1O5D L;  2KJ4 A;  4BTI A;  1COU A;  3QCW A;  4G1M B;  1ATD A;  3F1S B;  3GCX E;  5CKM A;  1AUT L;  2DOI A;  2P95 L;  1EMO A;  2FLG A;  2W3I B;  3M37 L;  5COE A;  5CS5 A;  2VH0 B;  3KQC L;  2K2S B;  4BVC A;  6COX A;  1EPH A;  4BV5 A;  1CVW L;  1X7A L;  2Y81 B;  2J4I B;  1NFX B;  1G1T A;  4BXS A;  1I0U A;  1CEJ A;  3N8Z A;  4GU3 A;  1JBU L;  5JBC E;  4RRY A;  3EGF A;  4JZE L;  1ATE A;  1CCV A;  2WYJ B;  3HS7 A;  2VJ3 A;  2MGR A;  1GK5 A;  4XLW A;  2QJ2 A;  4O03 A;  2VH6 B;  2PHB B;  2UWP B;  4LMF A;  2FEB A;  5KN5 C;  1PKR A;  2YGP A;  2BQ7 A;  4ZXX L;  2I9B A;  1NT0 A;  3LN0 A;  3TZI A;  1EPI A;  2P3T A;  1N7D A;  4MMZ B;  1KIG L;  1JL9 A;  3TGF A;  1L5G B;  3K65 A;  2VVC K;  2J2U B;  5KIR A;  4X8V L;  1W8B L;  4TGF A;  2FZZ L;  2RNL A;  4BXW A;  4Y79 B;  1HRE A;  3HPT A;  2J34 B;  5FDQ A;  1EBV A;  3C9A C;  4ISH L;  3KL6 B;  1IQE L;  1LMM A;  4MMX B;  1WHE A;  2P93 L;  1HT5 A;  1W7X L;  2XC5 L;  1FAX L;  2VRS A;  3SOV A;  1ADX A;  3N8Y B;  1GP9 A;  5JW1 A;  2WPK E;  3H5C B;  2Y7Z B;  1IQN L;  1RFN B;  4MMY B;  1B2I A;  1HJ7 A;  1WHF A;  1MQ6 L;  2P3F N;  3PGH A;  1PK4 A;  5CT2 A; 
#chains in the Genus database with same CATH homology
 3U73 A;  1NZI A;  1HPK A;  1YO8 A;  2TGF A;  1FSB A;  1EAI C;  2EI7 B;  5L2Y L;  1HX2 A;  1EMN A;  2P16 L;  4A5T S;  2PF1 A;  3N8X A;  1PK2 A;  1KLI L;  2W2M E;  2Y82 B;  1P9J A;  4CUE A;  1F7M A;  4RUT A;  1PGE A;  4NA9 L;  1BF9 A;  4BDW A;  2Y5G L;  1Z6C A;  2Q1J B;  2Y7X B;  5JVZ A;  3CEN L;  5EGM B;  5CKQ A;  1EQG A;  3NTB A;  2DOH X;  1PML A;  1IVO C;  2DDU A;  4ISI L;  1KLJ L;  1LPZ A;  3KQB L;  5CS9 A;  2VWO L;  3OLU A;  2WZP P;  2P3F L;  3N8W A;  1U8C B;  4X8S L;  1UZK A;  3LTF B;  3V65 B;  4RS0 A;  2XBW L;  3KCG L;  1EPG A;  4Y76 B;  1CVU A;  1FF7 A;  1K36 A;  4D3C A;  4IUA A;  1YUF A;  5I46 L;  2WPJ E;  1IJQ A;  1CX2 A;  1IQF L;  2G00 L;  3NT1 A;  4YT7 L;  2BOH A;  3TK6 B;  3KQE L;  3GIS X;  2MHP A;  1PMK A;  1HZ8 A;  1PXX A;  2P94 L;  3LC5 B;  4YZU B;  2KNF A;  2BMG A;  4BVV A;  3TH3 L;  2XC4 L;  2PF2 A;  5JBB E;  1EZQ B;  1IQI L;  5CP9 A;  2WYG B;  4X8U L;  3KRK A;  3HO5 A;  2YGO A;  1YUK B;  4DUR A;  2AYL A;  5IKV A;  2XBY L;  4JYU L;  4ZXY L;  3K9X A;  4LOR A;  1G1Q A;  2GD4 A;  5JVY A;  2EI8 B;  4OTJ A;  2SPT A;  2D1J B;  1GMN A;  1TPG A;  4BTT A;  2NPR A;  2WG4 B;  1IGZ A;  4OTY A;  1XFE A;  1CEA A;  3R05 A;  1FFM A;  3ZYI B;  1ATA A;  1GMO A;  2M74 A;  3HS5 A;  1XDT R;  3U7U G;  5CS1 A;  2MGP A;  1EGF A;  5COX A;  2WPL E;  3HN4 A;  1IQL L;  1UZJ A;  1XKB A;  4BTU A;  3ZYG A;  1UZP A;  2RA0 L;  1ZAQ A;  2HPQ P;  1KLO A;  2WPI E;  4NGA L;  2ADX A;  2WFX B;  5HPG A;  1G2L B;  1CQE A;  3N8V A;  2CJI B;  4ZH8 B;  5CKN A;  2K51 A;  2P28 B;  1WU1 B;  4C16 A;  2K2T A;  1I71 A;  1EPJ A;  4BDX A;  1NL1 A;  3BT1 A;  1HAE A;  1L3Y A;  2UWO B;  1OB1 C;  3DEM A;  2BZ6 L;  4M10 A;  1TLE A;  1U67 A;  1JFN A;  3ENS A;  1IOE L;  2W3K B;  2WG3 C;  2WPM E;  4RRX A;  3SP8 A;  1HPJ A;  1F0S B;  1YUG A;  2BQW A;  1NL2 A;  4COX A;  1V3X B;  2BOK L;  2BOX A;  2VVU L;  3GCW E;  3E6P L;  3Q3K B;  4E1G A;  2KL7 A;  3SW2 A;  3OLT A;  3BPS E;  3NXP A;  4D0E A;  3KQD L;  2W26 B;  3LN1 A;  1NFW B;  2FLR L;  1LPK A;  1DDX A;  1F7E A;  4XBM A;  2XC0 L;  4Y71 B;  2VVV L;  1FAK L;  2PR3 B;  3MDL A;  5F19 A;  2Y5H L;  1PRH A;  3TBD A;  1PTH A;  1IQM L;  1P0S L;  1QFK L;  1Z6E L;  2XBV L;  4M11 A;  4ZAE B;  4Z0K B;  1IQG L;  4RRW A;  1BHT A;  2PK4 A;  2BOU A;  1HT8 A;  2PUQ L;  1I5K A;  5CT1 A;  2KB9 A;  4BVW A;  1MQ5 L;  3NTG A;  4NG9 L;  1IP0 A;  2J95 B;  1URK A;  1EQH A;  3LAQ A;  1IGX A;  1APO A;  5JB8 E;  2Y80 B;  5L2Z L;  1DIY A;  5IKR A;  2OYE P;  2FD6 A;  4XL1 A;  4D90 A;  2JKH L;  3IJE B;  2B7D L;  1YGC L;  3S6X A;  3N8Y A;  1HRF A;  2VWM K;  2OYU P;  2YGQ A;  5F1A A;  1G1R A;  4HZH A;  2VWN L;  3FFG L;  4JZF L;  5JB9 E;  4ZHA B;  4BV7 A;  1TOZ A;  2WFT A;  2W2P E;  1IQH L;  3HO4 A;  2W2N E;  1DVA L;  4NZQ A;  1N1I A;  3CS7 L;  5CT3 A;  3FCS B;  2UWL B;  3HO3 A;  3KK6 A;  1FE2 A;  2RHP A;  4CUD A;  5L30 L;  2H9E C;  3RR3 A;  1G2M B;  2KNI A;  3KIV A;  3MKP A;  4PH9 A;  2Y5F L;  3Q7D A;  2BO2 A;  3NJP C;  4Y7A B;  2W2O E;  1LPG A;  2J38 B;  1IOX A;  2EI6 B;  2W86 A;  3TK5 B;  3N8W B;  3V64 C;  2K4R A;  4JZD L;  3HS6 A;  2H9E L;  1HCG B;  4AQT A;  1KDU A;  1LMJ A;  2QJ4 A;  1KIV A;  3ELA L;  1KSN B;  1NK1 A;  1NFU B;  1TPK A;  4KIV A;  3LIW B;  4RRZ A;  2P26 A;  4D0F A;  1HAF A;  1MOX C;  2BQ6 A;  1IQJ L;  5IKQ A;  2J94 B;  3ASI A;  1PFX L;  2W2Q E;  3QH0 A;  1SZB A;  1NQL B;  1UZQ A;  3CA7 A;  3M36 L;  5CS3 A;  1KI0 A;  5IKT A;  1G1S A;  2VWL L;  5K0H B;  4Z0L A;  2Y38 A;  3IIT B;  5JBA E;  2KV4 A;  4JYV L;  1JV2 B;  1XKA L;  1A0H A;  3MQE A;  1A3P A;  1M1X B;  3F6U L;  2HPP P;  3BT2 A;  2L0S A;  2F9B L;  3SOB B;  2WPH E;  1APQ A;  2FLB L;  5E8D A;  1Q4G A;  3LTG D;  1NFY B;  3POY A;  4CIK A;  3P5B L;  3LC3 B;  4O1Z A;  4A94 C;  1CEB A;  4FM5 A;  4CUF A;  1F0R B;  5CIS A;  1DX5 I;  1CCF A;  4Y7B B;  1C5M F;  2P3U A;  3CFW A;  4Y6D B;  4CSY A;  1B9W A;  1DQB A;  1IQK L;  1FJS L;  1K37 A;  1KRN A;  3ZYJ B;  2I9A A;  4A7I A;  1J9C L;  2XBX L;  3QMO A;  1NPE B;  3SOQ A;  4Z6A L;  5CSQ A;  3FBY A;  1ATB A;  4X8T L;  4YT6 L;  4O02 B;  4BVD A;  1LQD A;  1O5D L;  2KJ4 A;  4BTI A;  1COU A;  3QCW A;  4G1M B;  1ATD A;  3F1S B;  3GCX E;  5CKM A;  1AUT L;  2DOI A;  2P95 L;  1EMO A;  2FLG A;  2W3I B;  3M37 L;  5COE A;  5CS5 A;  2VH0 B;  3KQC L;  2K2S B;  4BVC A;  6COX A;  1EPH A;  4BV5 A;  1CVW L;  1X7A L;  2Y81 B;  2J4I B;  1NFX B;  1G1T A;  4BXS A;  1I0U A;  1CEJ A;  3N8Z A;  1JBU L;  5JBC E;  4RRY A;  3EGF A;  4JZE L;  1ATE A;  1CCV A;  2WYJ B;  3HS7 A;  2VJ3 A;  2MGR A;  1GK5 A;  4XLW A;  2QJ2 A;  4O03 A;  2VH6 B;  2PHB B;  2UWP B;  4LMF A;  2FEB A;  5KN5 C;  1PKR A;  2YGP A;  2BQ7 A;  4ZXX L;  2I9B A;  1NT0 A;  3LN0 A;  3TZI A;  1EPI A;  2P3T A;  1N7D A;  4MMZ B;  1KIG L;  1JL9 A;  3TGF A;  1L5G B;  3K65 A;  2VVC K;  2J2U B;  5KIR A;  4X8V L;  1W8B L;  4TGF A;  2FZZ L;  2RNL A;  4BXW A;  4Y79 B;  1HRE A;  3HPT A;  2J34 B;  5FDQ A;  1EBV A;  3C9A C;  4ISH L;  3KL6 B;  1IQE L;  1LMM A;  4MMX B;  1WHE A;  2P93 L;  1HT5 A;  1W7X L;  2XC5 L;  1FAX L;  3SOV A;  1ADX A;  3N8Y B;  1GP9 A;  5JW1 A;  2WPK E;  3H5C B;  2Y7Z B;  1IQN L;  1RFN B;  4MMY B;  1B2I A;  1HJ7 A;  1WHF A;  1MQ6 L;  2P3F N;  3PGH A;  1PK4 A;  5CT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...