2I9BA

Crystal structure of atf-urokinase receptor complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
CDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 24
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2i9bA01
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 2i9bA02
2WPJE 4Y79B 1FJSL 3TGFA 5F1AA 5I46L 2ADXA 1EGFA 5JB8E 5CS5A 1Q4GA 1I0UA 2WYGB 1KIGL 3POYA 4BXSA 3V65B 4CIKA 2AYLA 1EBVA 2K4RA 1DVAL 2VJ3A 2KL7A 3SOVA 2J2UB 3KCGL 2Y82B 3IJEB 2PR3B 1ATEA 2QJ2A 2PHBB 4COXA 3HS6A 5CKQA 1NL2A 2K51A 1GP9A 2XBVL 1N7DA 1F0RB 1F0SB 1FAKL 2J95B 3ENSA 4BVDA 3TZIA 2VH6B 2XBWL 4BV5A 2Q1JB 3M37L 1LPKA 5CS3A 1OB1C 1IGXA 2VH0B 2WFTA 2KV4A 2Y7XB 3QMOA 5CP9A 4BTIA 4JYUL 1X7AL 1EPIA 3N8WB 3SW2A 4RS0A 5HPGA 1NT0A 3SOQA 1G2LB 1JL9A 1IQGL 4D0FA 2BQWA 2H9EL 3TBDA 4ZXXL 1HZ8A 1CEAA 1HAFA 3OLTA 4PH9A 5IKQA 2VWMK 1F7EA 4D3CA 3NTBA 3MQEA 1TPKA 3FBYA 3KK6A 4D0EA 3CS7L 2WPHE 3TH3L 3N8YA 1IOXA 1ADXA 4A7IA 2G00L 1PK4A 2NPRA 3HO5A 1EQGA 4X8TL 2XC0L 2YGOA 3EGFA 2P16L 4O1ZA 3F6UL 2P3FN 1PFXL 4A5TS 1YUKB 1U67A 4E1GA 2FEBA 1MOXC 4RRWA 3BT2A 2VVUL 4ISHL 1WHFA 3N8ZA 2I9BA 2OYUP 3KQDL 2W3KB 1JV2B 3LN0A 5KN5C 4X8SL 2KB9A 1RFNB 2K2TA 4RRYA 4CUFA 2HPQP 1P9JA 2W2OE 1PTHA 1EPHA 2P3UA 5CS1A 1UZQA 3V64C 2BO2A 1HREA 1K37A 2W86A 1IQNL 2Y81B 4O02B 2Y5GL 1ATAA 4M10A 2XC5L 1DIYA 3K65A 2XBYL 4BV7A 3KQCL 2BZ6L 5L2ZL 1YUGA 3LN1A 3Q3KB 5JBCE 2W3IB 1MQ6L 2UWPB 1B9WA 5CT1A 5IKVA 3PGHA 3TK5B 2P3TA 1G2MB 2BOHA 2W2PE 2P3FL 5CT2A 4MMYB 2RA0L 2WPIE 1IQIL 1NPEB 1NFUB 1CQEA 3N8XA 2RHPA 3LC5B 2WG3C 4M11A 1PKRA 1HCGB 1ATDA 1JBUL 2WFXB 1NFWB 4ZH8B 3KQEL 1APOA 5EGMB 1Z6CA 5IKTA 2KJ4A 1EPJA 4JZFL 3U73A 1LMJA 1DX5I 1PMKA 2WPLE 3C9AC 2PK4A 4XL1A 2M74A 4Z0KB 4LORA 1L5GB 1M1XB 3SP8A 4RUTA 3MKPA 5E8DA 2HPPP 4KIVA 1ZAQA 3Q7DA 5JW1A 3ASIA 3M36L 1EAIC 1PK2A 4JZDL 1IQEL 1LQDA 2BOXA 2OYEP 5JBAE 2DOHX 4JYVL 1CVUA 2WPKE 1A3PA 4X8UL 4ZHAB 5CKMA 2QJ4A 1PXXA 2YGPA 1G1QA 4D90A 4YT6L 1SZBA 1AUTL 4OTYA 5L30L 1G1RA 3N8VA 5JB9E 1IQML 1MQ5L 3ELAL 4BTTA 1B2IA 4Z0LA 5COXA 2FLRL 3HS5A 2BOUA 2P94L 3NT1A 3N8YB 3HN4A 1KLIL 2BOKL 2VWOL 4O03A 1KI0A 5JBBE 1LPGA 3RR3A 3ZYJB 3HO3A 3TK6B 4TGFA 3FFGL 2W26B 2GD4A 3HPTA 1TOZA 2P93L 3HS7A 1TPGA 4IUAA 1L3YA 1IGZA 1CCFA 3CA7A 3BPSE 1G1SA 3BT1A 2WYJB 4BVVA 2J34B 1YGCL 2Y38A 1KLOA 2DDUA 2WPME 4YZUB 2W2NE 2FZZL 2J38B 1XFEA 4X8VL 4FM5A 1NL1A 1XKBA 2EI7B 1HAEA 1I71A 1KLJL 2Y5HL 3NTGA 2UWOB 5CS9A 2MGRA 1WHEA 2Y80B 1EPGA 3ZYGA 1FF7A 3SOBB 1FFMA 3U7UG 2I9AA 1IQKL 3P5BL 2K2SB 1EMNA 3CFWA 1NK1A 1U8CB 1WU1B 3KRKA 1DDXA 1GK5A 5JVYA 4NA9L 2CJIB 3LTFB 3QH0A 2W2QE 1EQHA 1FAXL 1Z6EL 4Z6AL 5CISA 1GMOA 5CT3A 1K36A 4AQTA 1HRFA 2MHPA 3ZYIB 2SPTA 3FCSB 1KIVA 3MDLA 2UWLB 3NXPA 4NG9L 3E6PL 4ISIL 2W2ME 2KNFA 1HT8A 2Y7ZB 1P0SL 4NGAL 1CEJA 1NFXB 1XDTR 4BTUA 4Y71B 4BVCA 1HPKA 2XC4L 1O5DL 4MMZB 1UZJA 1PRHA 4OTJA 1HJ7A 2FLBL 3KL6B 4ZXYL 4C16A 1W8BL 1YO8A 1CCVA 2FLGA 2J4IB 4DURA 4CUDA 3QCWA 4Y7BB 2B7DL 1KSNB 5FDQA 4ZAEB 1IVOC 1KDUA 1GMNA 1IQJL 2BQ6A 1PMLA 1IQFL 3DEMA 1BHTA 1IOEL 4NZQA 4JZEL 2DOIA 4MMXB 1V3XB 1NQLB 1A0HA 1IP0A 3KIVA 1KRNA 1FSBA 1NZIA 3N8WA 1TLEA 2VVCK 2VWLL 4YT7L 4BDWA 1IQHL 4Y76B 1HX2A 1URKA 2Y5FL 5L2YL 3KQBL 5K0HB 5KIRA 3GISX 1EZQB 2BMGA 2P28B 4RRZA 1EMOA 4RRXA 4BXWA 1UZKA 1DQBA 2F9BL 2FD6A 2EI6B 3OLUA 1G1TA 2WG4B 5IKRA 5F19A 2J94B 2P26A 1FE2A 1QFKL 1N1IA 1APQA 3HO4A 3GCWE 1W7XL 2MGPA 1F7MA 2EI8B 3LAQA 4Y7AB 2XBXL 6COXA 1HPJA 1HT5A 3H5CB 3R05A 1COUA 2BQ7A 4G1MB 2P95L 2VWNL 3NJPC 2PF2A 3CENL 4XLWA 2PF1A 4CUEA 1CX2A 3F1SB 4XBMA 4BVWA 1PGEA 3IITB 5CSQA 2TGFA 2VVVL 1JFNA 3K9XA 4BDXA 1CVWL 1XKAL 1NFYB 1UZPA 2JKHL 5COEA 1C5MF 1YUFA 3LIWB 5CKNA 1LPZA 4HZHA 1CEBA 2RNLA 3LC3B 1I5KA 2PUQL 5JVZA 1J9CL 2D1JB 2L0SA 4CSYA 1IJQA 1BF9A 1IQLL 1ATBA 3LTGD 3GCXE 4LMFA 4Y6DB
chains in the Genus database with same CATH superfamily
2WPJE 4Y79B 1FJSL 4A94C 3TGFA 5F1AA 5I46L 2ADXA 1EGFA 5JB8E 5CS5A 1Q4GA 1I0UA 2WYGB 1KIGL 3POYA 4BXSA 3V65B 4CIKA 2AYLA 1EBVA 2K4RA 1DVAL 2VJ3A 2KL7A 3SOVA 2J2UB 3KCGL 2Y82B 1V1HA 3IJEB 2PR3B 1ATEA 2QJ2A 2PHBB 4COXA 3HS6A 5CKQA 1NL2A 2K51A 1GP9A 2XBVL 1N7DA 1F0RB 1F0SB 1FAKL 2J95B 3ENSA 4BVDA 3TZIA 2VH6B 2XBWL 4BV5A 2KNIA 2Q1JB 3M37L 1LPKA 5CS3A 1OB1C 1IGXA 2VH0B 2WFTA 2KV4A 2Y7XB 3QMOA 5CP9A 4BTIA 4JYUL 1X7AL 1EPIA 3N8WB 3SW2A 4RS0A 5HPGA 1NT0A 3SOQA 1G2LB 1JL9A 1IQGL 4D0FA 2BQWA 2H9EL 3TBDA 4ZXXL 1HZ8A 1CEAA 1HAFA 3OLTA 4PH9A 5IKQA 2VWMK 1F7EA 1KKEA 4D3CA 3NTBA 3MQEA 1TPKA 3FBYA 3KK6A 4D0EA 3CS7L 2WPHE 3TH3L 3N8YA 1IOXA 1ADXA 4A7IA 2G00L 1PK4A 2NPRA 3HO5A 1EQGA 4X8TL 2XC0L 2YGOA 3EGFA 2P16L 1V1IA 4O1ZA 3F6UL 2P3FN 1PFXL 4A5TS 1YUKB 1U67A 4E1GA 2FEBA 1MOXC 4RRWA 2BSFA 3BT2A 2VVUL 4ISHL 1WHFA 3N8ZA 2I9BA 2OYUP 3KQDL 2W3KB 1JV2B 3LN0A 5KN5C 3S6XA 4X8SL 1LK9A 2KB9A 1RFNB 2K2TA 4RRYA 4CUFA 2HPQP 1P9JA 2W2OE 1PTHA 1EPHA 2P3UA 5CS1A 1UZQA 3V64C 2BO2A 1HREA 1K37A 2W86A 1IQNL 2Y81B 4O02B 2Y5GL 1ATAA 4M10A 2XC5L 1DIYA 3K65A 2XBYL 4BV7A 3KQCL 2BZ6L 5L2ZL 1YUGA 3LN1A 3Q3KB 5JBCE 2W3IB 1MQ6L 2UWPB 1B9WA 5CT1A 5IKVA 3PGHA 3TK5B 2P3TA 1G2MB 2BOHA 2W2PE 2P3FL 5CT2A 4MMYB 2RA0L 2WPIE 1IQIL 1NPEB 1NFUB 1CQEA 3N8XA 2RHPA 3LC5B 2WG3C 4M11A 1PKRA 1HCGB 1ATDA 1JBUL 2WFXB 1NFWB 4ZH8B 3KQEL 2WZPP 1APOA 5EGMB 1Z6CA 5IKTA 2KJ4A 1EPJA 4JZFL 3U73A 1LMJA 1DX5I 1PMKA 2BT7A 2WPLE 3C9AC 2PK4A 4XL1A 2M74A 4Z0KB 4LORA 1L5GB 1M1XB 2H9EC 3SP8A 4RUTA 3MKPA 5E8DA 2HPPP 4KIVA 1ZAQA 3Q7DA 5JW1A 3ASIA 3M36L 1EAIC 2BT8A 1PK2A 4JZDL 1IQEL 1LQDA 2BOXA 2OYEP 5JBAE 2DOHX 4JYVL 1CVUA 2WPKE 1A3PA 4X8UL 4ZHAB 5CKMA 2QJ4A 1PXXA 2YGPA 1G1QA 4D90A 4YT6L 1SZBA 1AUTL 4OTYA 5L30L 1G1RA 3N8VA 5JB9E 1IQML 1MQ5L 3ELAL 4BTTA 1B2IA 4Z0LA 5COXA 2FLRL 3HS5A 2BOUA 2P94L 3NT1A 3N8YB 3HN4A 1KLIL 2BOKL 2VWOL 4O03A 1KI0A 5JBBE 1LPGA 3RR3A 2JJLA 3ZYJB 3HO3A 3TK6B 4TGFA 3FFGL 2W26B 2GD4A 3HPTA 1TOZA 2P93L 3HS7A 1TPGA 4IUAA 1L3YA 1IGZA 1CCFA 3CA7A 3BPSE 1G1SA 3BT1A 2WYJB 4BVVA 2J34B 1YGCL 2Y38A 1KLOA 2DDUA 2HORA 2YGQA 2WPME 4YZUB 2W2NE 2FZZL 2J38B 1XFEA 4X8VL 4FM5A 1NL1A 1XKBA 2EI7B 1HAEA 1I71A 1KLJL 2Y5HL 3NTGA 2UWOB 5CS9A 2MGRA 1WHEA 2Y80B 1EPGA 3ZYGA 1FF7A 3SOBB 1FFMA 3U7UG 2I9AA 1IQKL 1QIUA 3P5BL 2K2SB 1EMNA 3CFWA 1NK1A 1U8CB 1WU1B 3KRKA 1DDXA 1LMMA 1GK5A 5JVYA 4NA9L 2CJIB 3LTFB 3QH0A 2W2QE 1EQHA 1FAXL 1Z6EL 4Z6AL 5CISA 1GMOA 5CT3A 1K36A 4AQTA 1HRFA 2MHPA 3ZYIB 2SPTA 3FCSB 1KIVA 3MDLA 2UWLB 3NXPA 4NG9L 3E6PL 4ISIL 2W2ME 2KNFA 1HT8A 2Y7ZB 1P0SL 4NGAL 1CEJA 1NFXB 1XDTR 4BTUA 4Y71B 4BVCA 1HPKA 2XC4L 1O5DL 4MMZB 1UZJA 1PRHA 4OTJA 1HJ7A 2FLBL 3KL6B 4ZXYL 4C16A 1W8BL 1YO8A 1CCVA 2FLGA 2J4IB 4DURA 4CUDA 3QCWA 4Y7BB 2B7DL 1KSNB 5FDQA 4ZAEB 1IVOC 1KDUA 1GMNA 1IQJL 2BQ6A 1PMLA 1IQFL 3DEMA 1BHTA 1IOEL 4NZQA 4JZEL 2DOIA 4MMXB 1V3XB 1NQLB 1A0HA 1IP0A 3KIVA 1KRNA 1FSBA 1NZIA 3N8WA 1TLEA 2VVCK 2VWLL 4YT7L 4BDWA 1IQHL 4Y76B 1HX2A 1URKA 2Y5FL 5L2YL 3KQBL 5K0HB 5KIRA 3GISX 1EZQB 2BMGA 2P28B 4RRZA 1EMOA 4RRXA 4BXWA 1UZKA 1DQBA 2F9BL 2FD6A 2EI6B 3OLUA 1G1TA 2WG4B 5IKRA 5F19A 2J94B 2P26A 1FE2A 1QFKL 1N1IA 1APQA 3HO4A 3GCWE 1W7XL 2MGPA 1F7MA 2EI8B 3LAQA 4Y7AB 2XBXL 6COXA 1HPJA 1HT5A 3H5CB 3R05A 1COUA 2BQ7A 4G1MB 2P95L 2VWNL 3NJPC 2PF2A 3CENL 4GU4A 4GU3A 4XLWA 2PF1A 4CUEA 1CX2A 3F1SB 4XBMA 4BVWA 1PGEA 3IITB 5CSQA 2TGFA 2VVVL 1JFNA 3K9XA 4BDXA 1CVWL 1XKAL 1NFYB 1UZPA 2JKHL 5COEA 1C5MF 1YUFA 2VRSA 3LIWB 5CKNA 1LPZA 4HZHA 1CEBA 2HOXA 2RNLA 3LC3B 1I5KA 2PUQL 5JVZA 1J9CL 2D1JB 2L0SA 4CSYA 1IJQA 1BF9A 1IQLL 1ATBA 3LTGD 3GCXE 4LMFA 4Y6DB
chains in the Genus database with same CATH topology
2WPJE 4Y79B 1FJSL 4A94C 3TGFA 5F1AA 5I46L 2ADXA 1EGFA 5JB8E 5CS5A 1Q4GA 1I0UA 2WYGB 1KIGL 3POYA 4BXSA 3V65B 4CIKA 2AYLA 1EBVA 2K4RA 1DVAL 2VJ3A 2KL7A 3SOVA 2J2UB 3KCGL 2Y82B 3IJEB 2PR3B 1ATEA 2QJ2A 2PHBB 4COXA 3HS6A 5CKQA 1NL2A 2K51A 1GP9A 2XBVL 1N7DA 1F0RB 1F0SB 1FAKL 2J95B 3ENSA 4BVDA 3TZIA 2VH6B 2XBWL 4BV5A 2KNIA 2Q1JB 3M37L 1LPKA 5CS3A 1OB1C 1IGXA 2VH0B 2WFTA 2KV4A 2Y7XB 3QMOA 5CP9A 4BTIA 4JYUL 1X7AL 1EPIA 3N8WB 3SW2A 4RS0A 5HPGA 1NT0A 3SOQA 1G2LB 1JL9A 1IQGL 4D0FA 2BQWA 2H9EL 3TBDA 4ZXXL 1HZ8A 1CEAA 1HAFA 3OLTA 4PH9A 5IKQA 2VWMK 1F7EA 4D3CA 3NTBA 3MQEA 1TPKA 3FBYA 3KK6A 4D0EA 3CS7L 2WPHE 3TH3L 3N8YA 1IOXA 1ADXA 4A7IA 2G00L 1PK4A 2NPRA 3HO5A 1EQGA 4X8TL 2XC0L 2YGOA 3EGFA 2P16L 4O1ZA 3F6UL 2P3FN 1PFXL 4A5TS 1YUKB 1U67A 4E1GA 2FEBA 1MOXC 4RRWA 3BT2A 2VVUL 4ISHL 1WHFA 3N8ZA 2I9BA 2OYUP 3KQDL 2W3KB 1JV2B 3LN0A 5KN5C 3S6XA 4X8SL 2KB9A 1RFNB 2K2TA 4RRYA 4CUFA 2HPQP 1P9JA 2W2OE 1PTHA 1EPHA 2P3UA 5CS1A 1UZQA 3V64C 2BO2A 1HREA 1K37A 2W86A 1IQNL 2Y81B 4O02B 2Y5GL 1ATAA 4M10A 2XC5L 1DIYA 3K65A 2XBYL 4BV7A 3KQCL 2BZ6L 5L2ZL 1YUGA 3LN1A 3Q3KB 5JBCE 2W3IB 1MQ6L 2UWPB 1B9WA 5CT1A 5IKVA 3PGHA 3TK5B 2P3TA 1G2MB 2BOHA 2W2PE 2P3FL 5CT2A 4MMYB 2RA0L 2WPIE 1IQIL 1NPEB 1NFUB 1CQEA 3N8XA 2RHPA 3LC5B 2WG3C 4M11A 1PKRA 1HCGB 1ATDA 1JBUL 2WFXB 1NFWB 4ZH8B 3KQEL 2WZPP 1APOA 5EGMB 1Z6CA 5IKTA 2KJ4A 1EPJA 4JZFL 3U73A 1LMJA 1DX5I 1PMKA 2WPLE 3C9AC 2PK4A 4XL1A 2M74A 4Z0KB 4LORA 1L5GB 1M1XB 2H9EC 3SP8A 4RUTA 3MKPA 5E8DA 2HPPP 4KIVA 1ZAQA 3Q7DA 5JW1A 3ASIA 3M36L 1EAIC 1PK2A 4JZDL 1IQEL 1LQDA 2BOXA 2OYEP 5JBAE 2DOHX 4JYVL 1CVUA 2WPKE 1A3PA 4X8UL 4ZHAB 5CKMA 2QJ4A 1PXXA 2YGPA 1G1QA 4D90A 4YT6L 1SZBA 1AUTL 4OTYA 5L30L 1G1RA 3N8VA 5JB9E 1IQML 1MQ5L 3ELAL 4BTTA 1B2IA 4Z0LA 5COXA 2FLRL 3HS5A 2BOUA 2P94L 3NT1A 3N8YB 3HN4A 1KLIL 2BOKL 2VWOL 4O03A 1KI0A 5JBBE 1LPGA 3RR3A 3ZYJB 3HO3A 3TK6B 4TGFA 3FFGL 2W26B 2GD4A 3HPTA 1TOZA 2P93L 3HS7A 1TPGA 4IUAA 1L3YA 1IGZA 1CCFA 3CA7A 3BPSE 1G1SA 3BT1A 2WYJB 4BVVA 2J34B 1YGCL 2Y38A 1KLOA 2DDUA 2YGQA 2WPME 4YZUB 2W2NE 2FZZL 2J38B 1XFEA 4X8VL 4FM5A 1NL1A 1XKBA 2EI7B 1HAEA 1I71A 1KLJL 2Y5HL 3NTGA 2UWOB 5CS9A 2MGRA 1WHEA 2Y80B 1EPGA 3ZYGA 1FF7A 3SOBB 1FFMA 3U7UG 2I9AA 1IQKL 3P5BL 2K2SB 1EMNA 3CFWA 1NK1A 1U8CB 1WU1B 3KRKA 1DDXA 1LMMA 1GK5A 5JVYA 4NA9L 2CJIB 3LTFB 3QH0A 2W2QE 1EQHA 1FAXL 1Z6EL 4Z6AL 5CISA 1GMOA 5CT3A 1K36A 4AQTA 1HRFA 2MHPA 3ZYIB 2SPTA 3FCSB 1KIVA 3MDLA 2UWLB 3NXPA 4NG9L 3E6PL 4ISIL 2W2ME 2KNFA 1HT8A 2Y7ZB 1P0SL 4NGAL 1CEJA 1NFXB 1XDTR 4BTUA 4Y71B 4BVCA 1HPKA 2XC4L 1O5DL 4MMZB 1UZJA 1PRHA 4OTJA 1HJ7A 2FLBL 3KL6B 4ZXYL 4C16A 1W8BL 1YO8A 1CCVA 2FLGA 2J4IB 4DURA 4CUDA 3QCWA 4Y7BB 2B7DL 1KSNB 5FDQA 4ZAEB 1IVOC 1KDUA 1GMNA 1IQJL 2BQ6A 1PMLA 1IQFL 3DEMA 1BHTA 1IOEL 4NZQA 4JZEL 2DOIA 4MMXB 1V3XB 1NQLB 1A0HA 1IP0A 3KIVA 1KRNA 1FSBA 1NZIA 3N8WA 1TLEA 2VVCK 2VWLL 4YT7L 4BDWA 1IQHL 4Y76B 1HX2A 1URKA 2Y5FL 5L2YL 3KQBL 5K0HB 5KIRA 3GISX 1EZQB 2BMGA 2P28B 4RRZA 1EMOA 4RRXA 4BXWA 1UZKA 1DQBA 2F9BL 2FD6A 2EI6B 3OLUA 1G1TA 2WG4B 5IKRA 5F19A 2J94B 2P26A 1FE2A 1QFKL 1N1IA 1APQA 3HO4A 3GCWE 1W7XL 2MGPA 1F7MA 2EI8B 3LAQA 4Y7AB 2XBXL 6COXA 1HPJA 1HT5A 3H5CB 3R05A 1COUA 2BQ7A 4G1MB 2P95L 2VWNL 3NJPC 2PF2A 3CENL 4XLWA 2PF1A 4CUEA 1CX2A 3F1SB 4XBMA 4BVWA 1PGEA 3IITB 5CSQA 2TGFA 2VVVL 1JFNA 3K9XA 4BDXA 1CVWL 1XKAL 1NFYB 1UZPA 2JKHL 5COEA 1C5MF 1YUFA 3LIWB 5CKNA 1LPZA 4HZHA 1CEBA 2RNLA 3LC3B 1I5KA 2PUQL 5JVZA 1J9CL 2D1JB 2L0SA 4CSYA 1IJQA 1BF9A 1IQLL 1ATBA 3LTGD 3GCXE 4LMFA 4Y6DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPJ E;  4Y79 B;  1FJS L;  3TGF A;  5F1A A;  5I46 L;  2ADX A;  1EGF A;  5JB8 E;  5CS5 A;  1Q4G A;  1I0U A;  2WYG B;  1KIG L;  3POY A;  4BXS A;  3V65 B;  4CIK A;  2AYL A;  1EBV A;  2K4R A;  1DVA L;  2VJ3 A;  2KL7 A;  3SOV A;  2J2U B;  3KCG L;  2Y82 B;  3IJE B;  2PR3 B;  1ATE A;  2QJ2 A;  2PHB B;  4COX A;  3HS6 A;  5CKQ A;  1NL2 A;  2K51 A;  1GP9 A;  2XBV L;  1N7D A;  1F0R B;  1F0S B;  1FAK L;  2J95 B;  3ENS A;  4BVD A;  3TZI A;  2VH6 B;  2XBW L;  4BV5 A;  2Q1J B;  3M37 L;  1LPK A;  5CS3 A;  1OB1 C;  1IGX A;  2VH0 B;  2WFT A;  2KV4 A;  2Y7X B;  3QMO A;  5CP9 A;  4BTI A;  4JYU L;  1X7A L;  1EPI A;  3N8W B;  3SW2 A;  4RS0 A;  5HPG A;  1NT0 A;  3SOQ A;  1G2L B;  1JL9 A;  1IQG L;  4D0F A;  2BQW A;  2H9E L;  3TBD A;  4ZXX L;  1HZ8 A;  1CEA A;  1HAF A;  3OLT A;  4PH9 A;  5IKQ A;  2VWM K;  1F7E A;  4D3C A;  3NTB A;  3MQE A;  1TPK A;  3FBY A;  3KK6 A;  4D0E A;  3CS7 L;  2WPH E;  3TH3 L;  3N8Y A;  1IOX A;  1ADX A;  4A7I A;  2G00 L;  1PK4 A;  2NPR A;  3HO5 A;  1EQG A;  4X8T L;  2XC0 L;  2YGO A;  3EGF A;  2P16 L;  4O1Z A;  3F6U L;  2P3F N;  1PFX L;  4A5T S;  1YUK B;  1U67 A;  4E1G A;  2FEB A;  1MOX C;  4RRW A;  3BT2 A;  2VVU L;  4ISH L;  1WHF A;  3N8Z A;  2I9B A;  2OYU P;  3KQD L;  2W3K B;  1JV2 B;  3LN0 A;  5KN5 C;  4X8S L;  2KB9 A;  1RFN B;  2K2T A;  4RRY A;  4CUF A;  2HPQ P;  1P9J A;  2W2O E;  1PTH A;  1EPH A;  2P3U A;  5CS1 A;  1UZQ A;  3V64 C;  2BO2 A;  1HRE A;  1K37 A;  2W86 A;  1IQN L;  2Y81 B;  4O02 B;  2Y5G L;  1ATA A;  4M10 A;  2XC5 L;  1DIY A;  3K65 A;  2XBY L;  4BV7 A;  3KQC L;  2BZ6 L;  5L2Z L;  1YUG A;  3LN1 A;  3Q3K B;  5JBC E;  2W3I B;  1MQ6 L;  2UWP B;  1B9W A;  5CT1 A;  5IKV A;  3PGH A;  3TK5 B;  2P3T A;  1G2M B;  2BOH A;  2W2P E;  2P3F L;  5CT2 A;  4MMY B;  2RA0 L;  2WPI E;  1IQI L;  1NPE B;  1NFU B;  1CQE A;  3N8X A;  2RHP A;  3LC5 B;  2WG3 C;  4M11 A;  1PKR A;  1HCG B;  1ATD A;  1JBU L;  2WFX B;  1NFW B;  4ZH8 B;  3KQE L;  1APO A;  5EGM B;  1Z6C A;  5IKT A;  2KJ4 A;  1EPJ A;  4JZF L;  3U73 A;  1LMJ A;  1DX5 I;  1PMK A;  2WPL E;  3C9A C;  2PK4 A;  4XL1 A;  2M74 A;  4Z0K B;  4LOR A;  1L5G B;  1M1X B;  3SP8 A;  4RUT A;  3MKP A;  5E8D A;  2HPP P;  4KIV A;  1ZAQ A;  3Q7D A;  5JW1 A;  3ASI A;  3M36 L;  1EAI C;  1PK2 A;  4JZD L;  1IQE L;  1LQD A;  2BOX A;  2OYE P;  5JBA E;  2DOH X;  4JYV L;  1CVU A;  2WPK E;  1A3P A;  4X8U L;  4ZHA B;  5CKM A;  2QJ4 A;  1PXX A;  2YGP A;  1G1Q A;  4D90 A;  4YT6 L;  1SZB A;  1AUT L;  4OTY A;  5L30 L;  1G1R A;  3N8V A;  5JB9 E;  1IQM L;  1MQ5 L;  3ELA L;  4BTT A;  1B2I A;  4Z0L A;  5COX A;  2FLR L;  3HS5 A;  2BOU A;  2P94 L;  3NT1 A;  3N8Y B;  3HN4 A;  1KLI L;  2BOK L;  2VWO L;  4O03 A;  1KI0 A;  5JBB E;  1LPG A;  3RR3 A;  3ZYJ B;  3HO3 A;  3TK6 B;  4TGF A;  3FFG L;  2W26 B;  2GD4 A;  3HPT A;  1TOZ A;  2P93 L;  3HS7 A;  1TPG A;  4IUA A;  1L3Y A;  1IGZ A;  1CCF A;  3CA7 A;  3BPS E;  1G1S A;  3BT1 A;  2WYJ B;  4BVV A;  2J34 B;  1YGC L;  2Y38 A;  1KLO A;  2DDU A;  2WPM E;  4YZU B;  2W2N E;  2FZZ L;  2J38 B;  1XFE A;  4X8V L;  4FM5 A;  1NL1 A;  1XKB A;  2EI7 B;  1HAE A;  1I71 A;  1KLJ L;  2Y5H L;  3NTG A;  2UWO B;  5CS9 A;  2MGR A;  1WHE A;  2Y80 B;  1EPG A;  3ZYG A;  1FF7 A;  3SOB B;  1FFM A;  3U7U G;  2I9A A;  1IQK L;  3P5B L;  2K2S B;  1EMN A;  3CFW A;  1NK1 A;  1U8C B;  1WU1 B;  3KRK A;  1DDX A;  1GK5 A;  5JVY A;  4NA9 L;  2CJI B;  3LTF B;  3QH0 A;  2W2Q E;  1EQH A;  1FAX L;  1Z6E L;  4Z6A L;  5CIS A;  1GMO A;  5CT3 A;  1K36 A;  4AQT A;  1HRF A;  2MHP A;  3ZYI B;  2SPT A;  3FCS B;  1KIV A;  3MDL A;  2UWL B;  3NXP A;  4NG9 L;  3E6P L;  4ISI L;  2W2M E;  2KNF A;  1HT8 A;  2Y7Z B;  1P0S L;  4NGA L;  1CEJ A;  1NFX B;  1XDT R;  4BTU A;  4Y71 B;  4BVC A;  1HPK A;  2XC4 L;  1O5D L;  4MMZ B;  1UZJ A;  1PRH A;  4OTJ A;  1HJ7 A;  2FLB L;  3KL6 B;  4ZXY L;  4C16 A;  1W8B L;  1YO8 A;  1CCV A;  2FLG A;  2J4I B;  4DUR A;  4CUD A;  3QCW A;  4Y7B B;  2B7D L;  1KSN B;  5FDQ A;  4ZAE B;  1IVO C;  1KDU A;  1GMN A;  1IQJ L;  2BQ6 A;  1PML A;  1IQF L;  3DEM A;  1BHT A;  1IOE L;  4NZQ A;  4JZE L;  2DOI A;  4MMX B;  1V3X B;  1NQL B;  1A0H A;  1IP0 A;  3KIV A;  1KRN A;  1FSB A;  1NZI A;  3N8W A;  1TLE A;  2VVC K;  2VWL L;  4YT7 L;  4BDW A;  1IQH L;  4Y76 B;  1HX2 A;  1URK A;  2Y5F L;  5L2Y L;  3KQB L;  5K0H B;  5KIR A;  3GIS X;  1EZQ B;  2BMG A;  2P28 B;  4RRZ A;  1EMO A;  4RRX A;  4BXW A;  1UZK A;  1DQB A;  2F9B L;  2FD6 A;  2EI6 B;  3OLU A;  1G1T A;  2WG4 B;  5IKR A;  5F19 A;  2J94 B;  2P26 A;  1FE2 A;  1QFK L;  1N1I A;  1APQ A;  3HO4 A;  3GCW E;  1W7X L;  2MGP A;  1F7M A;  2EI8 B;  3LAQ A;  4Y7A B;  2XBX L;  6COX A;  1HPJ A;  1HT5 A;  3H5C B;  3R05 A;  1COU A;  2BQ7 A;  4G1M B;  2P95 L;  2VWN L;  3NJP C;  2PF2 A;  3CEN L;  4XLW A;  2PF1 A;  4CUE A;  1CX2 A;  3F1S B;  4XBM A;  4BVW A;  1PGE A;  3IIT B;  5CSQ A;  2TGF A;  2VVV L;  1JFN A;  3K9X A;  4BDX A;  1CVW L;  1XKA L;  1NFY B;  1UZP A;  2JKH L;  5COE A;  1C5M F;  1YUF A;  3LIW B;  5CKN A;  1LPZ A;  4HZH A;  1CEB A;  2RNL A;  3LC3 B;  1I5K A;  2PUQ L;  5JVZ A;  1J9C L;  2D1J B;  2L0S A;  4CSY A;  1IJQ A;  1BF9 A;  1IQL L;  1ATB A;  3LTG D;  3GCX E;  4LMF A;  4Y6D B; 
#chains in the Genus database with same CATH topology
 2WPJ E;  4Y79 B;  1FJS L;  4A94 C;  3TGF A;  5F1A A;  5I46 L;  2ADX A;  1EGF A;  5JB8 E;  5CS5 A;  1Q4G A;  1I0U A;  2WYG B;  1KIG L;  3POY A;  4BXS A;  3V65 B;  4CIK A;  2AYL A;  1EBV A;  2K4R A;  1DVA L;  2VJ3 A;  2KL7 A;  3SOV A;  2J2U B;  3KCG L;  2Y82 B;  1V1H A;  3IJE B;  2PR3 B;  1ATE A;  2QJ2 A;  2PHB B;  4COX A;  3HS6 A;  5CKQ A;  1NL2 A;  2K51 A;  1GP9 A;  2XBV L;  1N7D A;  1F0R B;  1F0S B;  1FAK L;  2J95 B;  3ENS A;  4BVD A;  3TZI A;  2VH6 B;  2XBW L;  4BV5 A;  2KNI A;  2Q1J B;  3M37 L;  1LPK A;  5CS3 A;  1OB1 C;  1IGX A;  2VH0 B;  2WFT A;  2KV4 A;  2Y7X B;  3QMO A;  5CP9 A;  4BTI A;  4JYU L;  1X7A L;  1EPI A;  3N8W B;  3SW2 A;  4RS0 A;  5HPG A;  1NT0 A;  3SOQ A;  1G2L B;  1JL9 A;  1IQG L;  4D0F A;  2BQW A;  2H9E L;  3TBD A;  4ZXX L;  1HZ8 A;  1CEA A;  1HAF A;  3OLT A;  4PH9 A;  5IKQ A;  2VWM K;  1F7E A;  1KKE A;  4D3C A;  3NTB A;  3MQE A;  1TPK A;  3FBY A;  3KK6 A;  4D0E A;  3CS7 L;  2WPH E;  3TH3 L;  3N8Y A;  1IOX A;  1ADX A;  4A7I A;  2G00 L;  1PK4 A;  2NPR A;  3HO5 A;  1EQG A;  4X8T L;  2XC0 L;  2YGO A;  3EGF A;  2P16 L;  1V1I A;  4O1Z A;  3F6U L;  2P3F N;  1PFX L;  4A5T S;  1YUK B;  1U67 A;  4E1G A;  2FEB A;  1MOX C;  4RRW A;  2BSF A;  3BT2 A;  2VVU L;  4ISH L;  1WHF A;  3N8Z A;  2I9B A;  2OYU P;  3KQD L;  2W3K B;  1JV2 B;  3LN0 A;  5KN5 C;  3S6X A;  4X8S L;  1LK9 A;  2KB9 A;  1RFN B;  2K2T A;  4RRY A;  4CUF A;  2HPQ P;  1P9J A;  2W2O E;  1PTH A;  1EPH A;  2P3U A;  5CS1 A;  1UZQ A;  3V64 C;  2BO2 A;  1HRE A;  1K37 A;  2W86 A;  1IQN L;  2Y81 B;  4O02 B;  2Y5G L;  1ATA A;  4M10 A;  2XC5 L;  1DIY A;  3K65 A;  2XBY L;  4BV7 A;  3KQC L;  2BZ6 L;  5L2Z L;  1YUG A;  3LN1 A;  3Q3K B;  5JBC E;  2W3I B;  1MQ6 L;  2UWP B;  1B9W A;  5CT1 A;  5IKV A;  3PGH A;  3TK5 B;  2P3T A;  1G2M B;  2BOH A;  2W2P E;  2P3F L;  5CT2 A;  4MMY B;  2RA0 L;  2WPI E;  1IQI L;  1NPE B;  1NFU B;  1CQE A;  3N8X A;  2RHP A;  3LC5 B;  2WG3 C;  4M11 A;  1PKR A;  1HCG B;  1ATD A;  1JBU L;  2WFX B;  1NFW B;  4ZH8 B;  3KQE L;  2WZP P;  1APO A;  5EGM B;  1Z6C A;  5IKT A;  2KJ4 A;  1EPJ A;  4JZF L;  3U73 A;  1LMJ A;  1DX5 I;  1PMK A;  2BT7 A;  2WPL E;  3C9A C;  2PK4 A;  4XL1 A;  2M74 A;  4Z0K B;  4LOR A;  1L5G B;  1M1X B;  2H9E C;  3SP8 A;  4RUT A;  3MKP A;  5E8D A;  2HPP P;  4KIV A;  1ZAQ A;  3Q7D A;  5JW1 A;  3ASI A;  3M36 L;  1EAI C;  2BT8 A;  1PK2 A;  4JZD L;  1IQE L;  1LQD A;  2BOX A;  2OYE P;  5JBA E;  2DOH X;  4JYV L;  1CVU A;  2WPK E;  1A3P A;  4X8U L;  4ZHA B;  5CKM A;  2QJ4 A;  1PXX A;  2YGP A;  1G1Q A;  4D90 A;  4YT6 L;  1SZB A;  1AUT L;  4OTY A;  5L30 L;  1G1R A;  3N8V A;  5JB9 E;  1IQM L;  1MQ5 L;  3ELA L;  4BTT A;  1B2I A;  4Z0L A;  5COX A;  2FLR L;  3HS5 A;  2BOU A;  2P94 L;  3NT1 A;  3N8Y B;  3HN4 A;  1KLI L;  2BOK L;  2VWO L;  4O03 A;  1KI0 A;  5JBB E;  1LPG A;  3RR3 A;  2JJL A;  3ZYJ B;  3HO3 A;  3TK6 B;  4TGF A;  3FFG L;  2W26 B;  2GD4 A;  3HPT A;  1TOZ A;  2P93 L;  3HS7 A;  1TPG A;  4IUA A;  1L3Y A;  1IGZ A;  1CCF A;  3CA7 A;  3BPS E;  1G1S A;  3BT1 A;  2WYJ B;  4BVV A;  2J34 B;  1YGC L;  2Y38 A;  1KLO A;  2DDU A;  2HOR A;  2YGQ A;  2WPM E;  4YZU B;  2W2N E;  2FZZ L;  2J38 B;  1XFE A;  4X8V L;  4FM5 A;  1NL1 A;  1XKB A;  2EI7 B;  1HAE A;  1I71 A;  1KLJ L;  2Y5H L;  3NTG A;  2UWO B;  5CS9 A;  2MGR A;  1WHE A;  2Y80 B;  1EPG A;  3ZYG A;  1FF7 A;  3SOB B;  1FFM A;  3U7U G;  2I9A A;  1IQK L;  1QIU A;  3P5B L;  2K2S B;  1EMN A;  3CFW A;  1NK1 A;  1U8C B;  1WU1 B;  3KRK A;  1DDX A;  1LMM A;  1GK5 A;  5JVY A;  4NA9 L;  2CJI B;  3LTF B;  3QH0 A;  2W2Q E;  1EQH A;  1FAX L;  1Z6E L;  4Z6A L;  5CIS A;  1GMO A;  5CT3 A;  1K36 A;  4AQT A;  1HRF A;  2MHP A;  3ZYI B;  2SPT A;  3FCS B;  1KIV A;  3MDL A;  2UWL B;  3NXP A;  4NG9 L;  3E6P L;  4ISI L;  2W2M E;  2KNF A;  1HT8 A;  2Y7Z B;  1P0S L;  4NGA L;  1CEJ A;  1NFX B;  1XDT R;  4BTU A;  4Y71 B;  4BVC A;  1HPK A;  2XC4 L;  1O5D L;  4MMZ B;  1UZJ A;  1PRH A;  4OTJ A;  1HJ7 A;  2FLB L;  3KL6 B;  4ZXY L;  4C16 A;  1W8B L;  1YO8 A;  1CCV A;  2FLG A;  2J4I B;  4DUR A;  4CUD A;  3QCW A;  4Y7B B;  2B7D L;  1KSN B;  5FDQ A;  4ZAE B;  1IVO C;  1KDU A;  1GMN A;  1IQJ L;  2BQ6 A;  1PML A;  1IQF L;  3DEM A;  1BHT A;  1IOE L;  4NZQ A;  4JZE L;  2DOI A;  4MMX B;  1V3X B;  1NQL B;  1A0H A;  1IP0 A;  3KIV A;  1KRN A;  1FSB A;  1NZI A;  3N8W A;  1TLE A;  2VVC K;  2VWL L;  4YT7 L;  4BDW A;  1IQH L;  4Y76 B;  1HX2 A;  1URK A;  2Y5F L;  5L2Y L;  3KQB L;  5K0H B;  5KIR A;  3GIS X;  1EZQ B;  2BMG A;  2P28 B;  4RRZ A;  1EMO A;  4RRX A;  4BXW A;  1UZK A;  1DQB A;  2F9B L;  2FD6 A;  2EI6 B;  3OLU A;  1G1T A;  2WG4 B;  5IKR A;  5F19 A;  2J94 B;  2P26 A;  1FE2 A;  1QFK L;  1N1I A;  1APQ A;  3HO4 A;  3GCW E;  1W7X L;  2MGP A;  1F7M A;  2EI8 B;  3LAQ A;  4Y7A B;  2XBX L;  6COX A;  1HPJ A;  1HT5 A;  3H5C B;  3R05 A;  1COU A;  2BQ7 A;  4G1M B;  2P95 L;  2VWN L;  3NJP C;  2PF2 A;  3CEN L;  4GU4 A;  4GU3 A;  4XLW A;  2PF1 A;  4CUE A;  1CX2 A;  3F1S B;  4XBM A;  4BVW A;  1PGE A;  3IIT B;  5CSQ A;  2TGF A;  2VVV L;  1JFN A;  3K9X A;  4BDX A;  1CVW L;  1XKA L;  1NFY B;  1UZP A;  2JKH L;  5COE A;  1C5M F;  1YUF A;  2VRS A;  3LIW B;  5CKN A;  1LPZ A;  4HZH A;  1CEB A;  2HOX A;  2RNL A;  3LC3 B;  1I5K A;  2PUQ L;  5JVZ A;  1J9C L;  2D1J B;  2L0S A;  4CSY A;  1IJQ A;  1BF9 A;  1IQL L;  1ATB A;  3LTG D;  3GCX E;  4LMF A;  4Y6D B; 
#chains in the Genus database with same CATH homology
 2WPJ E;  4Y79 B;  1FJS L;  4A94 C;  3TGF A;  5F1A A;  5I46 L;  2ADX A;  1EGF A;  5JB8 E;  5CS5 A;  1Q4G A;  1I0U A;  2WYG B;  1KIG L;  3POY A;  4BXS A;  3V65 B;  4CIK A;  2AYL A;  1EBV A;  2K4R A;  1DVA L;  2VJ3 A;  2KL7 A;  3SOV A;  2J2U B;  3KCG L;  2Y82 B;  3IJE B;  2PR3 B;  1ATE A;  2QJ2 A;  2PHB B;  4COX A;  3HS6 A;  5CKQ A;  1NL2 A;  2K51 A;  1GP9 A;  2XBV L;  1N7D A;  1F0R B;  1F0S B;  1FAK L;  2J95 B;  3ENS A;  4BVD A;  3TZI A;  2VH6 B;  2XBW L;  4BV5 A;  2KNI A;  2Q1J B;  3M37 L;  1LPK A;  5CS3 A;  1OB1 C;  1IGX A;  2VH0 B;  2WFT A;  2KV4 A;  2Y7X B;  3QMO A;  5CP9 A;  4BTI A;  4JYU L;  1X7A L;  1EPI A;  3N8W B;  3SW2 A;  4RS0 A;  5HPG A;  1NT0 A;  3SOQ A;  1G2L B;  1JL9 A;  1IQG L;  4D0F A;  2BQW A;  2H9E L;  3TBD A;  4ZXX L;  1HZ8 A;  1CEA A;  1HAF A;  3OLT A;  4PH9 A;  5IKQ A;  2VWM K;  1F7E A;  4D3C A;  3NTB A;  3MQE A;  1TPK A;  3FBY A;  3KK6 A;  4D0E A;  3CS7 L;  2WPH E;  3TH3 L;  3N8Y A;  1IOX A;  1ADX A;  4A7I A;  2G00 L;  1PK4 A;  2NPR A;  3HO5 A;  1EQG A;  4X8T L;  2XC0 L;  2YGO A;  3EGF A;  2P16 L;  4O1Z A;  3F6U L;  2P3F N;  1PFX L;  4A5T S;  1YUK B;  1U67 A;  4E1G A;  2FEB A;  1MOX C;  4RRW A;  3BT2 A;  2VVU L;  4ISH L;  1WHF A;  3N8Z A;  2I9B A;  2OYU P;  3KQD L;  2W3K B;  1JV2 B;  3LN0 A;  5KN5 C;  3S6X A;  4X8S L;  2KB9 A;  1RFN B;  2K2T A;  4RRY A;  4CUF A;  2HPQ P;  1P9J A;  2W2O E;  1PTH A;  1EPH A;  2P3U A;  5CS1 A;  1UZQ A;  3V64 C;  2BO2 A;  1HRE A;  1K37 A;  2W86 A;  1IQN L;  2Y81 B;  4O02 B;  2Y5G L;  1ATA A;  4M10 A;  2XC5 L;  1DIY A;  3K65 A;  2XBY L;  4BV7 A;  3KQC L;  2BZ6 L;  5L2Z L;  1YUG A;  3LN1 A;  3Q3K B;  5JBC E;  2W3I B;  1MQ6 L;  2UWP B;  1B9W A;  5CT1 A;  5IKV A;  3PGH A;  3TK5 B;  2P3T A;  1G2M B;  2BOH A;  2W2P E;  2P3F L;  5CT2 A;  4MMY B;  2RA0 L;  2WPI E;  1IQI L;  1NPE B;  1NFU B;  1CQE A;  3N8X A;  2RHP A;  3LC5 B;  2WG3 C;  4M11 A;  1PKR A;  1HCG B;  1ATD A;  1JBU L;  2WFX B;  1NFW B;  4ZH8 B;  3KQE L;  2WZP P;  1APO A;  5EGM B;  1Z6C A;  5IKT A;  2KJ4 A;  1EPJ A;  4JZF L;  3U73 A;  1LMJ A;  1DX5 I;  1PMK A;  2WPL E;  3C9A C;  2PK4 A;  4XL1 A;  2M74 A;  4Z0K B;  4LOR A;  1L5G B;  1M1X B;  2H9E C;  3SP8 A;  4RUT A;  3MKP A;  5E8D A;  2HPP P;  4KIV A;  1ZAQ A;  3Q7D A;  5JW1 A;  3ASI A;  3M36 L;  1EAI C;  1PK2 A;  4JZD L;  1IQE L;  1LQD A;  2BOX A;  2OYE P;  5JBA E;  2DOH X;  4JYV L;  1CVU A;  2WPK E;  1A3P A;  4X8U L;  4ZHA B;  5CKM A;  2QJ4 A;  1PXX A;  2YGP A;  1G1Q A;  4D90 A;  4YT6 L;  1SZB A;  1AUT L;  4OTY A;  5L30 L;  1G1R A;  3N8V A;  5JB9 E;  1IQM L;  1MQ5 L;  3ELA L;  4BTT A;  1B2I A;  4Z0L A;  5COX A;  2FLR L;  3HS5 A;  2BOU A;  2P94 L;  3NT1 A;  3N8Y B;  3HN4 A;  1KLI L;  2BOK L;  2VWO L;  4O03 A;  1KI0 A;  5JBB E;  1LPG A;  3RR3 A;  3ZYJ B;  3HO3 A;  3TK6 B;  4TGF A;  3FFG L;  2W26 B;  2GD4 A;  3HPT A;  1TOZ A;  2P93 L;  3HS7 A;  1TPG A;  4IUA A;  1L3Y A;  1IGZ A;  1CCF A;  3CA7 A;  3BPS E;  1G1S A;  3BT1 A;  2WYJ B;  4BVV A;  2J34 B;  1YGC L;  2Y38 A;  1KLO A;  2DDU A;  2YGQ A;  2WPM E;  4YZU B;  2W2N E;  2FZZ L;  2J38 B;  1XFE A;  4X8V L;  4FM5 A;  1NL1 A;  1XKB A;  2EI7 B;  1HAE A;  1I71 A;  1KLJ L;  2Y5H L;  3NTG A;  2UWO B;  5CS9 A;  2MGR A;  1WHE A;  2Y80 B;  1EPG A;  3ZYG A;  1FF7 A;  3SOB B;  1FFM A;  3U7U G;  2I9A A;  1IQK L;  3P5B L;  2K2S B;  1EMN A;  3CFW A;  1NK1 A;  1U8C B;  1WU1 B;  3KRK A;  1DDX A;  1LMM A;  1GK5 A;  5JVY A;  4NA9 L;  2CJI B;  3LTF B;  3QH0 A;  2W2Q E;  1EQH A;  1FAX L;  1Z6E L;  4Z6A L;  5CIS A;  1GMO A;  5CT3 A;  1K36 A;  4AQT A;  1HRF A;  2MHP A;  3ZYI B;  2SPT A;  3FCS B;  1KIV A;  3MDL A;  2UWL B;  3NXP A;  4NG9 L;  3E6P L;  4ISI L;  2W2M E;  2KNF A;  1HT8 A;  2Y7Z B;  1P0S L;  4NGA L;  1CEJ A;  1NFX B;  1XDT R;  4BTU A;  4Y71 B;  4BVC A;  1HPK A;  2XC4 L;  1O5D L;  4MMZ B;  1UZJ A;  1PRH A;  4OTJ A;  1HJ7 A;  2FLB L;  3KL6 B;  4ZXY L;  4C16 A;  1W8B L;  1YO8 A;  1CCV A;  2FLG A;  2J4I B;  4DUR A;  4CUD A;  3QCW A;  4Y7B B;  2B7D L;  1KSN B;  5FDQ A;  4ZAE B;  1IVO C;  1KDU A;  1GMN A;  1IQJ L;  2BQ6 A;  1PML A;  1IQF L;  3DEM A;  1BHT A;  1IOE L;  4NZQ A;  4JZE L;  2DOI A;  4MMX B;  1V3X B;  1NQL B;  1A0H A;  1IP0 A;  3KIV A;  1KRN A;  1FSB A;  1NZI A;  3N8W A;  1TLE A;  2VVC K;  2VWL L;  4YT7 L;  4BDW A;  1IQH L;  4Y76 B;  1HX2 A;  1URK A;  2Y5F L;  5L2Y L;  3KQB L;  5K0H B;  5KIR A;  3GIS X;  1EZQ B;  2BMG A;  2P28 B;  4RRZ A;  1EMO A;  4RRX A;  4BXW A;  1UZK A;  1DQB A;  2F9B L;  2FD6 A;  2EI6 B;  3OLU A;  1G1T A;  2WG4 B;  5IKR A;  5F19 A;  2J94 B;  2P26 A;  1FE2 A;  1QFK L;  1N1I A;  1APQ A;  3HO4 A;  3GCW E;  1W7X L;  2MGP A;  1F7M A;  2EI8 B;  3LAQ A;  4Y7A B;  2XBX L;  6COX A;  1HPJ A;  1HT5 A;  3H5C B;  3R05 A;  1COU A;  2BQ7 A;  4G1M B;  2P95 L;  2VWN L;  3NJP C;  2PF2 A;  3CEN L;  4XLW A;  2PF1 A;  4CUE A;  1CX2 A;  3F1S B;  4XBM A;  4BVW A;  1PGE A;  3IIT B;  5CSQ A;  2TGF A;  2VVV L;  1JFN A;  3K9X A;  4BDX A;  1CVW L;  1XKA L;  1NFY B;  1UZP A;  2JKH L;  5COE A;  1C5M F;  1YUF A;  3LIW B;  5CKN A;  1LPZ A;  4HZH A;  1CEB A;  2RNL A;  3LC3 B;  1I5K A;  2PUQ L;  5JVZ A;  1J9C L;  2D1J B;  2L0S A;  4CSY A;  1IJQ A;  1BF9 A;  1IQL L;  1ATB A;  3LTG D;  3GCX E;  4LMF A;  4Y6D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...