2I9HA

Nmr solution structure of the reduced form of thioredoxin 1 from yeast (trx1)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
103
structure length
103
Chain Sequence
MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin I
publication title NMR solution structure of the reduced form of thioredoxin 1 from Sacharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 16
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2i9hA00
4POBA 5J5NA 3CMIA 6GSTA 1DSBA 1JZWA 1XVQA 3WT2A 8GSSA 1JHBA 1GSDA 2IMIA 2JZTA 5ECHB 4RQRA 2LRNA 1VF1A 4QQ7A 4ZL8A 2GZYA 3IK7A 4AF2A 3TRXA 2MZCA 3F4TA 3GKKA 3QAVA 2HSHA 1V98A 1XZOA 2NBSA 1AQVA 1A24A 1ERTA 2YWMA 3H8QA 4K7OA 4WR4A 3VWWA 2JL4A 4ECCA 2YWNA 2H75A 1FAAA 5IOWA 2B5EA 1G0TA 1FB0A 1R5PA 11GSA 5DALA 3TKSC 4LL1B 2FHEA 2R4VA 3OR5A 3O76A 4JR4A 3E9JB 3C1RA 4H86A 1BJXA 2PBJA 5J9CA 2VIMA 5A4WA 3L9UA 1PKZA 1YEXA 2X64A 3HA9A 4MH2A 2O89A 4KCEA 3ZTLA 3IK9A 1EEMA 2AAWA 4I8BA 3GMFA 4JU5A 2CA8A 3EWLA 4MF5A 4AJ7A 2VL3A 2VM1A 1W89A 5A4VA 1TK8B 4KB3A 2HZFA 3GV1A 1ST9A 19GSA 2WULA 4LMWA 5E4WA 3FHKA 5ABRA 2R37A 2F51A 1QK8A 2DJ0A 3K8NA 1GTBA 1AW9A 2J23A 3HJOA 2BMXA 3LYPA 2GSQA 2HRFA 3CSJA 4JRRA 4IELA 1USBA 1R7HA 1J0FA 3A2VA 3LQ7A 1FVKA 4K2DA 2NTOA 2EIRA 5CRDA 1EWXA 2LTKA 2YCDA 2VD1A 4ML6A 3CSHA 2I9HA 1T8EB 1WPIA 1TU7A 3L9SA 2H01A 3PGTA 2GS3A 3APQA 3IA1A 2VCQA 3GIXA 5ECIB 4WETA 5FWGA 3W8JA 4NWYA 2H6YA 17GSA 2DJ3A 1X9WB 2JADA 1HNAA 3IPZA 1SD8A 2DIYA 5G1KA 3KH7A 4Z7XA 1F3AA 1OVNA 3ZIJA 3PH9A 1MD4A 1UN2A 2H0IA 4O7HA 1B9YC 1V2AA 1MDKA 2RLIA 5AISA 1IYIA 2DSAA 1WE0A 5B8AA 1MEKA 4BL7A 4J2FA 3UOMA 3KMNA 3LGCA 2GT6A 2VOCA 2X8CA 1YF0A 5H5RA 2IMFA 3QR6A 4HJMA 3NOFA 5AN1A 1EP7A 4JZQA 5IQYA 3GA4A 4RI7A 2GSTA 3QDNA 3LG6A 5CO3A 1BG5A 3S9FA 2QGVA 5ECPB 3VWXA 4G2EA 3EURA 3A3TA 4WF4A 3EC3A 4GXZA 3FZ5A 4TOPA 3PR8A 2IWTA 1XWKA 3G7YA 3CSIA 1SYXA 1TKDB 1ML6A 1WOUA 5ECMB 1GUKA 1PX6A 5C04A 1F2EA 2L5OA 4MZWA 2H30A 1S3AA 2P5RA 4MJEA 14GSA 3TKPA 1S3DA 2CAIA 3ZMKA 3VWUA 2OE3A 4MH3A 2VLTA 4PNGA 5DJLA 5ECRB 3DD3A 1JZRA 3TRPA 3KP9A 2V41A 3VPQA 5D9TA 4MA9A 1SL2B 2XC2A 4K0NA 2WDUA 3ERFA 1XOAA 1ERVA 1RK4A 2FGXA 2DBCA 2HYXA 4IJ3A 2CVKA 5DJMA 3TJFA 5IO2A 4KUNA 1SU9A 2VCWA 4Q5RA 1N8JA 3TRQA 3GKNA 4O5RA 4HUAA 3KZQA 1PMTA 5CP1A 1AAZA 4AJ8A 2N5AA 1GLQA 1HYUA 3LORA 3EVIA 3FR3A 5CAXA 2LRCA 2OBKA 5AIVA 4N10A 2CVDA 5ECLB 4AGSA 1EZKA 3EINA 3WD6A 4DSSA 1OYJA 3O6TA 4N30A 4RQXA 1GUMA 3QFAC 2DMLA 1AUCA 2QSIA 4QL7A 1QQ2A 4V2MA 2XPDA 4PXOA 2F8FA 2CZ3A 1B4PA 2OKAA 1LU4A 1H75A 3Q74A 4YH2A 4TW5A 3CYNA 2YPMA 2H1BA 1SK0A 3KEBA 3QFBC 4POLA 1A0RP 4MK3A 3ZMLA 2VLUA 5DCGA 2FA8A 3H79A 4MDCA 1S3CA 2O87A 4XHMA 4K7NA 5JCUA 4OFNA 5G30A 4LA1A 5IM9A 2CAQA 1I9DA 2HXKA 1FVJA 1O73A 2A2SA 5IMFA 4ZILA 1GRXA 2C0EA 1PL1A 1K0DA 3TOTA 3W8SA 5FHIA 4CW9A 2RUFA 2OE1A 4J57E 3BBYA 4IS0A 2IN3A 4DEJA 3V1WA 2OE0A 1XPVA 2K8SA 3HCZA 4TR0A 5IPHA 2L59A 2DC5A 2R2JA 3ZFBA 4TXVA 1KNGA 1JZDA 3J7Yk 2OACA 1KEBA 2EIQA 3LEFA 3GYKA 4X0XA 5G5EA 2X99A 1BAYA 2DJ2A 9GSSA 2GSRA 1AXDA 2CQ9A 3BOAA 3ERWA 1ZMAA 1AIUA 3KM6A 1NHOA 4YAVA 2ZUPA 3FEUA 3GL3A 1A8YA 3I43A 1DUGA 3IRAA 4TR1A 5ELAA 4PX1A 5ID2B 4KE3A 2A4VA 3HY2A 3FZAA 3ME8A 4ZL7A 4MLYA 5DBQA 3UVTA 3ZVJD 1WMJA 2CX3A 2EIOA 1A2LA 1M99A 1X5CA 1CQGA 3UL3A 3BCIA 2GZPA 3UEMA 2M80A 2B5YA 3I69A 1AQWA 2G0FA 2MMZA 3JCML 5INYA 3CTGA 3M0FA 3GTUA 1OE8A 1I5GA 3M1GA 2FCHA 5C00A 1M9BA 5F8BA 1X0RA 1YJ6A 1A8LA 1XVWA 3TCOA 2H0GA 4KSOA 2P0GA 2WRTA 5B8BA 3HVVA 1U3IA 3TB2A 3F4RA 1A2JA 2X8GA 4LL4B 3RAZA 3VURA 3M3MA 5D9XA 2M72A 4OO4A 3D0ZA 4FYCA 1Q98A 3Q18A 2MMNA 3DIEA 3EU3A 1WJKA 3TDGA 5DALB 1PA3A 3VWVA 1HNCA 2WCIA 4KX4A 5AIXA 5GAPD 2PGTA 5JWOB 5ECQB 5IOXA 1TRSA 3GX0A 3VI7A 1TRVA 4PUAA 2IL3A 2NPBA 4K1FA 1T00A 1BEDA 5HFIA 4XTSA 1ILOA 4KA0A 3E0UA 4F82A 3O3TA 3FZ9A 4ZB6A 2AB6A 2ON7A 1DE2A 3HVSA 5G5FA 3L78A 3SBCA 1F9MA 2KOKA 4GSTA 7GSSA 1V40A 3P90A 4TN8A 4PURA 1EGOA 2WGRA 4NV2A 5G1LA 1G6YA 4DSRA 2M46A 2XPEA 1T1VA 4ULXA 4HDEA 2DMMA 5A5KA 4JEDA 3UMAA 3GH9A 1K0MA 1GSSA 5D9WA 4ID0A 1Z7PA 4ZB9A 2JACA 2KLXA 2GQLA 2VL9A 1SKRB 1Q4JA 4D73B 5DAKA 4PUFC 1HNBA 1TI3A 1XWBA 1THXA 4F03A 4WKWA 3VPTA 1O8XA 2YNXA 5CRGA 3F3QA 4MJCA 3ZLPA 5ELGA 3TJJA 3C8EA 3DMLA 1XXUA 6GSXA 4TKYA 4BVXA 3D5JA 3RDWA 6GSVA 5EVOA 3UBKA 1XW5A 2PVOC 2WFCA 1F37A 2CV4A 2R6KA 1XBSA 3EMPA 2RUEA 3BJ5A 4MJBA 2HT9A 2XBIA 1VF4A 4K9ZA 2NVLA 1G7OA 3ZRDA 2IPAA 3U5RE 12GSA 1XW6A 2FWHA 1M2DA 5KEJA 1QXHA 3HDCA 4EL1A 2H70A 1RW1A 1QGVA 3DKSA 1O85A 2AYTA 1XW9A 3QD9A 5LD0A 2E0QA 3HD5A 2YJ7A 4HEA2 2C4JA 2C3NA 4TXOA 2HLSA 3SWLA 2OBIA 1XOBA 4F0CA 4E8HA 3C7MA 4HS1A 2YN1A 4ML1A 1GSYA 3F6FA 1ZYEA 2GT5A 2REMA 2HRNA 2TRCP 1K3LA 4WBJA 2FNOA 1R5AA 4Q5FA 1O8WA 3G7JA 2V1MA 1PSQA 3C1SA 2MMAA 3BCKA 3DXBA 5IMVA 3A5WA 2PERA 1DE1A 2V6OA 1M2AA 3KXOA 2VLVA 4FYBA 1EP8A 4MZCA 4IJIA 3P2AA 2AV4A 2QC7A 3ZFLA 2DIZA 2P31A 4MMMA 2FWEA 4GQFA 5F05A 3TKSA 1U6TA 4MZBA 3GFKA 1BQ7A 3GUSA 5HFGA 1X9MB 1O81A 5ECKB 4HZ4A 2DJKA 3UJ1A 3F9UA 4DSSB 3HYPA 2YV7A 5D96A 2QKEA 3L0HA 3Q6OA 3FY7A 3BD2A 4L0UA 3GNJA 3GHAA 1MDJA 3HHVA 6GSUA 1F3BA 2H66A 2F9SA 4ILFA 4OO5A 1ACVA 3RHBA 3FZ4A 3FKFA 5IO0A 5CRHA 5F0GA 3IAM2 3IAS2 3RHCA 1M7TA 2LSTA 2YWIA 2H76A 5L71A 2JU5A 3UIWA 5JCGA 3VK9A 2HFDA 1OKTA 1Z3EA 1ZZYA 3EE2A 3MSZA 4GRFA 1O7UA 4MPFA 2AJQB 2C0DA 3KIJA 1K0BA 4NAXA 1YEPA 3ZYWA 5EPFA 2B5XA 4FO5A 4IP6A 5H5SA 2K6VA 4HOJA 4AJ6A 4X43A 4EE0A 2H6XA 4NV5A 2MBTA 1TRUA 3MWHA 3LXTA 2KHPA 4ZBAA 3FK8A 3ZZXA 4POKA 4ZBDA 2IIYA 2P5QA 4EC0A 3QOUA 3N9JA 1T3BA 2GLRA 1MTCA 1OAZA 5J3RA 1TK5B 3EMXA 2CVBA 4O92A 4O32A 2GQKA 1XWCA 2LEGA 1G6WA 1EGRA 5J9BA 1TRWA 5IPGA 4RUVA 3N5OA 2A2RA 1X5EA 5ENUA 4L5LA 2C80A 3ISOA 4BPYA 2VCZA 2IJYA 2K18A 4KNDA 4KGIA 5KN0A 1PD21 2YZUA 1SJIA 3F4SA 3VFIA 5ECNB 3I9V2 1GTIA 1XFLA 2B1LA 1PQNA 2VCTA 4HZ2A 2K8VA 3IR4A 3GTUB 4QL9A 3F0IA 2H71A 4V2LA 2IMDA 4BVYA 5EL8A 3CBUA 3TGZA 3L9VA 2CZ2A 5ECOB 4TR3A 4N0VA 3GKXA 3GX8A 1ABAA 1TJDA 1SENA 1EOGA 3G9BA 4KSMA 4BA7A 3HJMA 4K8MA 4MF6A 3TOUA 1O6JA 2WZ9A 3R2QA 2FLSA 3TJGA 1GTAA 2L6CA 1JLVA 5KN2A 2OA7A 4KDYA 2MMOA 3KJYA 3A2WA 4MJAA 3IOSA 2FA4A 2X8HA 1HQOA 13GSA 5EY6A 1TTZA 1THOA 3GSTA 2H72A 1TI1A 1TDIA 3TJBA 2O85A 2LJKA 4NXIA 2JZRA 3CRUA 2LUSA 5KN3A 2EC4A 5D93A 1E6BA 3D4MA 5A4UA 3HVXA 5JWRB 2GZZA 1R4WA 1JZOA 2FUG2 2L6DA 4IQAA 4MF7A 3DEXA 2FWGA 1SK2A 1GNEA 2IMKA 1M0UA 2E7PA 1WWJA 3DRNA 4IN0A 1T4YA 4MP4A 2AHEA 1ZYQB 2B3SA 3ZVJA 3D6IA 5HR0A 3HZ4A 3ERGA 3C71A 3RPNA 2J9HA 4HU9A 4J56E 6GSYA 2LNTA 3NIVA 3H1NA 1A2MA 1GP1A 3LXZA 1SKWB 1GWCA 1SD9A 5FT3A 4V1Ag 3KGKA 3KCMA 1WIKA 1FOVA 2VUPA 1CQHA 1XWAA 3QCPA 4RI6A 1C72A 5B6MA 1M9AA 4GCIA 5DAKB 1XCCA 3MDKA 3PINA 1B4QA 3KD0A 3GN3A 4IHUA 2IFQA 3QPMA 1ZL9A 1YKAA 1GTUA 3G7IA 4ECBA 2PVQA 2LQOA 1T4ZA 2JSYA 3QAWA 2R5GA 5E59A 2H19A 4BWSA 1U3AA 1V58A 5D8IA 2ALBA 2LV3A 3E3EA 1DBYA 5G2ZA 3J7Yb 2B6MA 3MNGA 4XS4A 5B6NA 3P7XA 2VL2A 5HQPA 2C3TA 1TOFA 4GQCA 2DJJA 1K3YA 2BTOT 2JZSA 4GTUA 1JLWA 1U88A 4I2TA 1KTEA 2PMTA 3LYKA 4N0ZA 3F63A 5HR3A 5ID2A 3GH6A 2YJHA 4EUYA 1GSUA 2C8UA 4ECJA 3RPPA 20GSA 4F9ZA 4NMUA 3UVHA 2L5LA 2C3QA 2F8AA 1IYHA 1FG4A 4TXOB 1J08A 1B9XC 5F06A 2H6ZA 2E2MA 4OFTA 4IVFA 1J9BA 2LJRA 2E2GA 3FR6A 3FYGA 5IIZA 5G31A 1SKSB 4XS1A 3GL5A 1OC9A 1YKCA 4OFMA 2HZEA 1R26A 4KAEA 4OMVA 2HNLA 5GAND 4HJ2A 3EYTA 4KDUA 4FYUA 1V57A 4I97A 1EEJA 4FH8A 2NDOA 1K0OA 4XS6A 1LBKA 4I6XA 4L5OA 1PL2A 1VRSD 2H8LA 1TK0B 1PGTA 2LRTA 2WS2A 4EDYA 1GH2A 4ZB8A 2I4AA 4JR6A 2YZHA 1U87A 2N5BA 1M2BA 3TKSE 2PUKC 3LWAA 4NPBA 1FW1A 1NW2A 5F07A 3WT1A 5D73A 4ECIA 1SJ6A 5IMAA 16GSA 4CDOA 4HQZA 4X1UA 2L4CA 3C73A 1UC7A 4L0WA 1GL8A 1WP0A 4MABA 3HZ8A 1E2YA 1SJZA 4GSNA 5JCWA 3GSSA 5LCZA 1Z9HA 2VAFA 1TP9A 2L57A 1EV9A 2H0HA 4PQ1A 2GTUA 1BX9A 3FR9A 3DVXA 5IMDA 3LSZA 3IBHA 2YP6A 2MBSA 1ZCPA 2OJLA 3DVWA 3QMXA 3WGEA 2G2QA 4ACSA 1WRYA 2K9FA 3H4KA 3HJPA 5KN1A 4IBPA 1H4OA 1T7PB 4YQMA 2HE3A 2B7KA 4EDZA 3TUEA 1GSEA 1XIYA 2AUVA 4KDXA 1ON4A 2WJUA 1W4VA 4NHWA 2H1DA 2I1UA 3ZIVA 1ZOFA 3UARA 4G10A 3EU4A 2TIRA 1AQXA 4ZBBA 3TKRA 6GSSA 1GULA 4Q5NA 4GF0A 3GURA 2OADA 4V1Ap 1YDKA 22GSA 1K3OA 4EVMA 4GWRA 3A2XA 4G9HA 4D73A 5GSTA 5CYYA 1VGLA 1YQ1A 4GLTA 4EKZA 5DCHA 2V6KA 1JFUA 1K0AA 5IMZA 4LLRA 5DVBA 2PN8A 4N11A 1YF1A 1Z5YE 4TRXA 1OC8A 3CRTA 2HI7A 2LQQA 2GSSA 6GSWA 2IMEA 2ZCTA 4IQ1A 2LKUA 1N2AA 3ME7A 4IKHA 2VCVA 4MCUA 2FD3A 4WF5A 1TXXA 5DQSA 3WYWA 4PNFA 5B7CA 2RM6A 2LNSA 2XBQA 3ED3A 4TVEA 5J41A 2LJAA 4KH7A 3IXRA 5COHA 3D22A 1TW9A 1F6MC 2GDRA 4ZL9A 5CRWA 1HD2A 2PPTA 1UA5A 5D9VA 3US3A 2V2GA 3CXGA 3MAKA 2TRXA 2CX4A 3F8UA 3GKMA 3IE3A 2V32A 2CT6A 2GVPA 2KP1A 2R3XA 4ZXGA 1ZGNA 3H93A 4WEYA 3DYRA 1QMVA 2N5FA 3LFLA 2DJ1A 1SL0B 5HFKA 1FO5A 4DSQA 2YV9A 3WGXA 1UVZA 4KCAA 5DDLA 3TKQA 1VF2A 2O8VB 1QFNA 4LMVA 3ZITA 2VD0A 1Z7RA 2I3YA 1Y6EA 1QUWA 1XWGA 1NM3A 3HKRA 1AC1A 1MDIA 2ZNMA 4JBBA 2FY6A 4TR1B 1BYEA 4YQVA 4OWYA 3IHQA 1X9SB 2F3MA 4IGJA 5CREA 1OC3A 1SYRA 2HSYA 1V9WA 3IDVA 1B48A 4EXJA 2ON5A 4XRDA 4EF0A 3TJKA 2B1KA 3FRCA 4PGTA 2Z9SA 4WBRD 3GRXA 3ZL5A 5GSSA 4JE1A 3VI5A 18GSA 3UBLA 4MPGA 2LS5A 2PU9C 1KBNA 1EV4A 3IV4A 1YY7A 3I6AA 4CHSA 5HR2A 5DQYA 4F2IA 4I5QA 5CNWA 5H5QA 3P8WA 1B8XA 4IW9A 1Z6MA 2FWFA 2WB9A 3APOA 4ISDA 4TR4A 3AY8A 5GZZB 3WGDA 2IFQB 1ERUA 2I81A 4POMA 3KMOA 3NZNA 5J4UA 1VF3A 2VCXA 3L4NA 2MYGA 1PN9A 5IMCA 2KP2A 1GUHA 1YZXA 3ZREA 4HU7A 4K0GA 3KH9A 3D4TA 4KW6A 4OCFA 2JSZA 1FHEA 4XS4B 3FW2A 1TU8A 4YQUA 1Z6NA 4F0BA 2GGTA 3M9KA 2VL2C 2B7JA 4XIHA 3KTBA 10GSA 1Y25A 2C1YA 4K7IA 4V2NA 3CTFA 4BWQA 1NSWA 4WXTA 2BJXA 1RQMA 5JWQB 2VO4A 2RM5A 3UAPA 2C0GA 5HR1A 4DVCA 1GSQA 2RIIA 4HQSA 2O7KA 2H73A 4PQHA 4NHZA 1OKDA 2ES7A 3QAGA 3APSA 1EOHA 3F6DA 2VM2A 4EO3A 1MD3A 1OC9B 1ERWA 3IC4A 2HZEB 1SL1B 1A23A 3KTLA 1K0NA 2YWOA 2C0FA 4WR5A 3VLNA 3HXSA 2YOIA 1OE7A 1A0FA 4E8EA 2GQMA 2KUCA 2H1AA 1GSFA 4XCSA 1SK1A 1PX7A 2H1GA 1FB6A 3D21A 4OD7A 5AGYA 4G19A 3W6GA 4GSSA 4HI7A 1URMA 1LJRA 4OCEA 4XRAA 1NHYA 2L4QA 5ECSA 4IP1A 2YANA 3DWVA 2H74A 4YAPA 2D2ZA 3KP8A 1GNWA 3LJRA 2DLXA 1G7EA 4I2UA 5LNKe 4Q5QA 1PKWA 4ZIJA 1X5DA 4L8EA 3Q19A 3F3RA 3M9JA 4P3YB 2PWJA 3RBTA 3M8NA 1PRXA 4K6XA 2XHFA 3U6VA 1GLPA 1K0CA 4PQIA 4FIWA 3DGQA
chains in the Genus database with same CATH superfamily
4POBA 5J5NA 3CMIA 6GSTA 1DSBA 1JZWA 1XVQA 3WT2A 8GSSA 1JHBA 1GSDA 2IMIA 2JZTA 5ECHB 4RQRA 2LRNA 1VF1A 4QQ7A 4ZL8A 2GZYA 3IK7A 4AF2A 3TRXA 2MZCA 3F4TA 3GKKA 3QAVA 2HSHA 1V98A 1XZOA 2NBSA 1AQVA 1A24A 1ERTA 2YWMA 3H8QA 4K7OA 4WR4A 3VWWA 2JL4A 4ECCA 2YWNA 2H75A 1FAAA 5IOWA 2B5EA 1G0TA 1FB0A 1R5PA 11GSA 5DALA 3TKSC 4LL1B 2FHEA 2R4VA 3OR5A 3O76A 4JR4A 3E9JB 3C1RA 4H86A 1BJXA 2PBJA 5J9CA 2VIMA 5A4WA 3L9UA 1PKZA 1YEXA 2X64A 3HA9A 4MH2A 2O89A 4KCEA 3ZTLA 3IK9A 1EEMA 2AAWA 4I8BA 3GMFA 4JU5A 2CA8A 3EWLA 4MF5A 4Z2UA 4AJ7A 2VL3A 2VM1A 1W89A 5A4VA 1TK8B 4KB3A 2HZFA 3GV1A 1ST9A 19GSA 2WULA 4LMWA 5E4WA 3FHKA 5ABRA 2R37A 2F51A 1QK8A 2DJ0A 3K8NA 1GTBA 1AW9A 2J23A 3HJOA 2BMXA 3LYPA 2GSQA 2HRFA 3CSJA 4JRRA 4IELA 1USBA 1R7HA 1J0FA 3A2VA 3LQ7A 1FVKA 4K2DA 2NTOA 2EIRA 5CRDA 1EWXA 2LTKA 2YCDA 2VD1A 4ML6A 3CSHA 2I9HA 1T8EB 1WPIA 1TU7A 3L9SA 2H01A 3PGTA 2GS3A 3APQA 3IA1A 2VCQA 3GIXA 5ECIB 4WETA 5FWGA 3W8JA 4NWYA 2H6YA 17GSA 2DJ3A 1X9WB 2JADA 1HNAA 3IPZA 1SD8A 2DIYA 5G1KA 3KH7A 4Z7XA 1F3AA 1OVNA 3ZIJA 3PH9A 1MD4A 1UN2A 2H0IA 4O7HA 1B9YC 2HRKA 1V2AA 1MDKA 2RLIA 5AISA 1IYIA 2DSAA 1WE0A 5B8AA 4HSCX 1MEKA 4BL7A 4J2FA 3UOMA 3KMNA 3LGCA 2GT6A 2VOCA 2DKIA 2X8CA 1YF0A 5H5RA 2IMFA 3QR6A 4HJMA 3MYDA 3NOFA 5AN1A 1EP7A 4JZQA 5IQYA 3GA4A 4RI7A 2GSTA 3QDNA 3LG6A 5CO3A 1BG5A 3S9FA 2QGVA 5ECPB 3VWXA 4G2EA 3EURA 3A3TA 4PTSA 4WF4A 3EC3A 4GXZA 3FZ5A 2HRAA 4TOPA 3PR8A 2IWTA 3A5IA 1XWKA 3G7YA 3CSIA 1SYXA 1TKDB 1ML6A 1WOUA 3HVNA 5ECMB 1GUKA 1PX6A 5C04A 1F2EA 2L5OA 4MZWA 2H30A 1S3AA 2P5RA 4MJEA 14GSA 3TKPA 1S3DA 2CAIA 3ZMKA 3VWUA 2OE3A 4MH3A 2VLTA 4PNGA 5DJLA 5ECRB 3DD3A 1JZRA 3TRPA 3KP9A 2V41A 3VPQA 4ICYA 5D9TA 4MA9A 1SL2B 2XC2A 4K0NA 2WDUA 3ERFA 4KF9A 1XOAA 1ERVA 1RK4A 2FGXA 2DBCA 2HYXA 4IJ3A 2CVKA 5DJMA 3TJFA 5IO2A 4KUNA 4EIQA 1SU9A 2VCWA 4Q5RA 1N8JA 3TRQA 3GKNA 4O5RA 4HUAA 3KZQA 1PMTA 5CP1A 1AAZA 4AJ8A 2N5AA 1GLQA 1HYUA 3LORA 3EVIA 3FR3A 5CAXA 2LRCA 2OBKA 5AIVA 4N10A 2CVDA 5ECLB 4AGSA 3IC8A 1EZKA 3EINA 3WD6A 4DSSA 1OYJA 3O6TA 4CY8A 4N30A 4RQXA 1GUMA 3QFAC 2DMLA 1AUCA 2QSIA 4QL7A 1QQ2A 4V2MA 4K5RA 2XPDA 4PXOA 2F8FA 2CZ3A 1B4PA 2OKAA 1LU4A 1H75A 3Q74A 4YH2A 4TW5A 3CYNA 2YPMA 2H1BA 1SK0A 3KEBA 3QFBC 4POLA 1A0RP 4MK3A 3ZMLA 2VLUA 5DCGA 2FA8A 3H79A 4MDCA 1S3CA 2O87A 4XHMA 4K7NA 5JCUA 4OFNA 5G30A 4LA1A 5IM9A 2CAQA 1I9DA 2HXKA 1FVJA 1O73A 2A2SA 5IMFA 4ZILA 1GRXA 2C0EA 1PL1A 1K0DA 3TOTA 3W8SA 5FHIA 4CW9A 2RUFA 2OE1A 4J57E 3BBYA 4IS0A 2IN3A 4DEJA 3V1WA 2OE0A 1XPVA 2K8SA 3HCZA 4TR0A 5IPHA 2L59A 2DC5A 2R2JA 3ZFBA 4TXVA 1KNGA 1JZDA 3J7Yk 2OACA 1KEBA 2EIQA 2QA1A 3LEFA 3GYKA 4X0XA 5G5EA 2X99A 1BAYA 2DJ2A 5BMUA 9GSSA 5KOXA 2GSRA 1AXDA 2CQ9A 3BOAA 3ERWA 1ZMAA 1AIUA 3KM6A 1NHOA 4YAVA 4BIKA 2ZUPA 3FEUA 3GL3A 1A8YA 4EIPA 3I43A 1DUGA 3IRAA 4TR1A 5ELAA 4PX1A 5ID2B 4KE3A 2A4VA 3HY2A 3FZAA 3ME8A 4ZL7A 4MLYA 5DBQA 3UVTA 3ZVJD 1WMJA 2CX3A 2EIOA 1A2LA 1M99A 1X5CA 1CQGA 3UL3A 3BCIA 2A2PA 2GZPA 2M80A 3UEMA 2B5YA 3I69A 1AQWA 2G0FA 2MMZA 3JCML 5INYA 3CTGA 3M0FA 3GTUA 1OE8A 1I5GA 3M1GA 2FCHA 5C00A 1M9BA 5F8BA 1X0RA 1YJ6A 1A8LA 1XVWA 3TCOA 2H0GA 4KSOA 2P0GA 2WRTA 5B8BA 3HVVA 1U3IA 3TB2A 3F4RA 1A2JA 2X8GA 4LL4B 3RAZA 3VURA 3M3MA 5D9XA 2M72A 4OO4A 3D0ZA 4Z2RA 4FYCA 1Q98A 3Q18A 2MMNA 3DIEA 3EU3A 1WJKA 3TDGA 5DALB 1PA3A 3VWVA 1HNCA 2WCIA 4KX4A 5AIXA 5GAPD 2PGTA 5JWOB 5ECQB 5IOXA 1TRSA 3GX0A 3VI7A 1TRVA 4PUAA 2IL3A 2NPBA 4K1FA 1T00A 4O5UA 1BEDA 5HFIA 4XTSA 1ILOA 4KA0A 3E0UA 4F82A 3O3TA 3FZ9A 4ZB6A 2AB6A 2ON7A 1DE2A 3HVSA 5G5FA 3L78A 3SBCA 1F9MA 2KOKA 4GSTA 7GSSA 1V40A 3P90A 4TN8A 4PURA 1EGOA 2WGRA 4NV2A 5G1LA 1G6YA 4DSRA 2M46A 2XPEA 1T1VA 4ULXA 4HDEA 2DMMA 5A5KA 4JEDA 3UMAA 3GH9A 1K0MA 1GSSA 2A4HA 2HSMA 5D9WA 4ID0A 1Z7PA 4ZB9A 2JACA 2KLXA 2GQLA 2VL9A 1SKRB 1Q4JA 4D73B 5DAKA 4PUFC 1HNBA 1TI3A 1XWBA 1THXA 4F03A 4WKWA 3VPTA 4BL7B 1O8XA 2YNXA 5CRGA 3F3QA 4MJCA 3ZLPA 5ELGA 3TJJA 3C8EA 3DMLA 1XXUA 6GSXA 4TKYA 4BVXA 3D5JA 3RDWA 6GSVA 5EVOA 3UBKA 1XW5A 2PVOC 2WFCA 1F37A 2CV4A 2R6KA 1XBSA 3EMPA 2RUEA 3BJ5A 4MJBA 2HT9A 2XBIA 1VF4A 4K9ZA 2NVLA 1G7OA 3ZRDA 2IPAA 3U5RE 12GSA 1XW6A 2FWHA 1M2DA 5KEJA 1QXHA 3HDCA 4EL1A 2H70A 1RW1A 1QGVA 3DKSA 1O85A 2AYTA 1XW9A 3QD9A 5LD0A 2E0QA 3HD5A 2YJ7A 4HEA2 2C4JA 2C3NA 4TXOA 2HLSA 3SWLA 2OBIA 1XOBA 4F0CA 4E8HA 3C7MA 4HS1A 2YN1A 4ML1A 1GSYA 3F6FA 1ZYEA 2GT5A 2REMA 2HRNA 2TRCP 1K3LA 4WBJA 2FNOA 1R5AA 4Q5FA 1O8WA 3G7JA 2V1MA 1PSQA 3C1SA 2MMAA 3BCKA 3DXBA 5IMVA 3R3EA 3A5WA 2PERA 3EPTA 1DE1A 2V6OA 1M2AA 3KXOA 2VLVA 4FYBA 1EP8A 4MZCA 4IJIA 3P2AA 2AV4A 2QC7A 3ZFLA 2DIZA 2P31A 4MMMA 1ZYPA 2FWEA 4GQFA 5F05A 3TKSA 1U6TA 4MZBA 3GFKA 1BQ7A 3GUSA 5HFGA 1X9MB 1O81A 4FQUA 5ECKB 4HZ4A 2DJKA 3UJ1A 3F9UA 4DSSB 3HYPA 2YV7A 5D96A 2QKEA 3L0HA 3Q6OA 3FY7A 3BD2A 4L0UA 3GNJA 3GHAA 1MDJA 3HHVA 6GSUA 1F3BA 2H66A 2F9SA 4ILFA 4OO5A 1ACVA 3RHBA 3FZ4A 3FKFA 4K2XA 5IO0A 5CRHA 5F0GA 3IAM2 3IAS2 3RHCA 1M7TA 2LSTA 2YWIA 2H76A 5L71A 2JU5A 3UIWA 5JCGA 3VK9A 2HFDA 1OKTA 1Z3EA 1ZZYA 3EE2A 3MSZA 4GRFA 1O7UA 4MPFA 2AJQB 2C0DA 3KIJA 1K0BA 4NAXA 1YEPA 3ZYWA 5EPFA 2B5XA 4FO5A 4IP6A 5H5SA 2K6VA 4HOJA 4AJ6A 4X43A 4EE0A 2H6XA 4NV5A 2MBTA 1TRUA 3MWHA 3LXTA 2KHPA 4ZBAA 3CQFA 3FK8A 3ZZXA 4POKA 4ZBDA 2IIYA 2P5QA 4EC0A 3QOUA 3N9JA 1T3BA 2GLRA 1MTCA 1OAZA 5J3RA 1TK5B 3EMXA 2CVBA 4O92A 5BRTA 4O32A 2GQKA 1XWCA 2LEGA 1G6WA 1EGRA 4G0KA 5J9BA 1TRWA 5IPGA 4RUVA 3N5OA 2A2RA 1X5EA 5ENUA 4L5LA 2C80A 3ISOA 4BPYA 2VCZA 2IJYA 2K18A 4KNDA 4KGIA 5KN0A 1PD21 2YZUA 1SJIA 3F4SA 3VFIA 5ECNB 3I9V2 1GTIA 1XFLA 2B1LA 1PQNA 2VCTA 4HZ2A 2K8VA 3IR4A 3GTUB 4QL9A 3F0IA 2H71A 4V2LA 4A5PA 2IMDA 4BVYA 5EL8A 3CBUA 3TGZA 3L9VA 2CZ2A 5ECOB 4TR3A 4N0VA 3GKXA 3GX8A 1ABAA 1TJDA 1SENA 1EOGA 3MIXA 3G9BA 4KSMA 4BA7A 3HJMA 4K8MA 4MF6A 3TOUA 1O6JA 3FMWA 2WZ9A 3R2QA 2FLSA 3TJGA 1GTAA 2L6CA 1JLVA 5KN2A 2OA7A 4KDYA 2MMOA 3KJYA 3A2WA 4MJAA 3IOSA 2FA4A 2X8HA 1HQOA 13GSA 5EY6A 1TTZA 1THOA 4YKFA 3GSTA 2H72A 1TI1A 1TDIA 3TJBA 2O85A 2LJKA 4NXIA 2JZRA 3CRUA 2LUSA 5KN3A 2EC4A 5D93A 1E6BA 3D4MA 5A4UA 3HVXA 1S3RA 5JWRB 2GZZA 1R4WA 1JZOA 2FUG2 2L6DA 4IQAA 4MF7A 3DEXA 2FWGA 2UZ8A 1FOHA 1SK2A 1GNEA 2IMKA 2QA2A 1M0UA 2E7PA 1WWJA 3DRNA 4IN0A 1T4YA 4MP4A 2AHEA 1ZYQB 2B3SA 3ZVJA 3D6IA 5HR0A 3HZ4A 3ERGA 3C71A 3RPNA 2J9HA 4HU9A 4J56E 6GSYA 2LNTA 3NIVA 3H1NA 1A2MA 1GP1A 1M3JA 3LXZA 1SKWB 1GWCA 1SD9A 5FT3A 4V1Ag 3KGKA 3KCMA 1WIKA 1FOVA 2VUPA 1CQHA 1XWAA 3QCPA 4RI6A 1C72A 5B6MA 1M9AA 4GCIA 5DAKB 1XCCA 3MDKA 3PINA 1B4QA 3KD0A 3GN3A 4IHUA 2IFQA 3QPMA 1ZL9A 1YKAA 1GTUA 3G7IA 4ECBA 2PVQA 2LQOA 2R0PA 1T4ZA 2JSYA 3QAWA 2R5GA 5E59A 2H19A 4BVXB 4BWSA 1U3AA 1V58A 5D8IA 2ALBA 2LV3A 3E3EA 1DBYA 5G2ZA 3J7Yb 2B6MA 3MNGA 4XS4A 5B6NA 4G0LA 3P7XA 4X4JA 2VL2A 5HQPA 2C3TA 1TOFA 4GQCA 2DJJA 1K3YA 2BTOT 2JZSA 4GTUA 1JLWA 1U88A 4I2TA 1KTEA 2PMTA 3LYKA 4N0ZA 3F63A 5HR3A 5ID2A 3GH6A 2YJHA 4EUYA 1GSUA 2C8UA 4ECJA 3RPPA 20GSA 4F9ZA 4NMUA 3UVHA 2L5LA 2X4AA 2C3QA 2F8AA 1IYHA 1FG4A 4TXOB 1J08A 1B9XC 5F06A 2H6ZA 2E2MA 4OFTA 4IVFA 1J9BA 2LJRA 2E2GA 3FR6A 3FYGA 5IIZA 5G31A 1SKSB 4XS1A 3GL5A 1OC9A 1YKCA 4OFMA 2HZEA 1R26A 4KAEA 4OMVA 2HNLA 5GAND 1XG8A 4HJ2A 3EYTA 4KDUA 4FYUA 1V57A 4I97A 1EEJA 4FH8A 2NDOA 1K0OA 4XS6A 1LBKA 4I6XA 4L5OA 1PL2A 1VRSD 2H8LA 1ZYNA 1TK0B 1PGTA 2LRTA 2WS2A 4EDYA 1GH2A 4ZB8A 2I4AA 4JR6A 2YZHA 2R0GA 1U87A 2N5BA 1M2BA 3TKSE 2PUKC 3LWAA 4NPBA 1FW1A 1NW2A 5F07A 3WT1A 5D73A 4ECIA 4Z2TA 1SJ6A 5IMAA 16GSA 4CDOA 4HQZA 4X1UA 2L4CA 3C73A 1UC7A 4L0WA 1GL8A 1WP0A 1PFOA 4MABA 3HZ8A 1E2YA 1SJZA 4GSNA 5JCWA 3GSSA 5LCZA 1PN0A 1Z9HA 2VAFA 1TP9A 2L57A 1EV9A 2H0HA 4PQ1A 5KOWA 2GTUA 1BX9A 3FR9A 3DVXA 5IMDA 4YKGA 3LSZA 3IBHA 2YP6A 2MBSA 1ZCPA 2OJLA 3DVWA 3QMXA 3WGEA 2G2QA 4ACSA 1WRYA 2K9FA 3H4KA 3HJPA 5KN1A 4IBPA 1H4OA 4G0IA 1T7PB 4YQMA 2HE3A 2B7KA 4EDZA 3TUEA 1GSEA 1XIYA 2AUVA 4KDXA 1ON4A 2WJUA 1W4VA 4NHWA 2H1DA 2I1UA 3ZIVA 1ZOFA 3UARA 4G10A 3EU4A 2TIRA 1AQXA 4ZBBA 3TKRA 6GSSA 1GULA 4Q5NA 4GF0A 3GURA 2OADA 4V1Ap 1YDKA 22GSA 1K3OA 4EVMA 4GWRA 3A2XA 4G9HA 4D73A 5GSTA 5CYYA 1VGLA 1YQ1A 4GLTA 4EKZA 5DCHA 2V6KA 1JFUA 1K0AA 5IMZA 4LLRA 5DVBA 2PN8A 4N11A 1YF1A 1Z5YE 4TRXA 1OC8A 3CRTA 4USSA 2HI7A 2LQQA 2GSSA 6GSWA 2IMEA 2ZCTA 4IQ1A 2LKUA 1N2AA 3ME7A 4IKHA 2VCVA 4MCUA 2FD3A 4WF5A 1TXXA 5DQSA 3WYWA 4PNFA 5B7CA 2RM6A 2LNSA 2XBQA 3ED3A 4TVEA 4BVYB 5J41A 2LJAA 4KH7A 3IXRA 5COHA 3D22A 1TW9A 1F6MC 2GDRA 4ZL9A 5CRWA 1HD2A 2PPTA 1UA5A 5D9VA 3US3A 2V2GA 3CXGA 3MAKA 2TRXA 2CX4A 3F8UA 3GKMA 3IE3A 2V32A 2CT6A 2X49A 2GVPA 2KP1A 2R3XA 4ZXGA 1ZGNA 3H93A 4WEYA 3DYRA 1QMVA 2N5FA 3LFLA 2DJ1A 1SL0B 5HFKA 1FO5A 4DSQA 2YV9A 3WGXA 1UVZA 4KCAA 5DDLA 3TKQA 1VF2A 2O8VB 1QFNA 4LMVA 3ZITA 2VD0A 1Z7RA 2I3YA 1Y6EA 1QUWA 1XWGA 1NM3A 3HKRA 1AC1A 1MDIA 2ZNMA 4JBBA 2FY6A 1M3IA 4TR1B 1BYEA 4YQVA 4OWYA 3IHQA 1X9SB 2F3MA 4IGJA 5CREA 1OC3A 1SYRA 2HSYA 1V9WA 3IDVA 1B48A 4EXJA 2ON5A 4XRDA 4EF0A 3TJKA 2B1KA 3FRCA 4PGTA 2Z9SA 4WBRD 2DKHA 3GRXA 3ZL5A 5GSSA 4JE1A 3VI5A 18GSA 3UBLA 4MPGA 2LS5A 3LW9A 2PU9C 1KBNA 1EV4A 3IV4A 1YY7A 3I6AA 4CHSA 5HR2A 5DQYA 4F2IA 4I5QA 5CNWA 5H5QA 3IHGA 3P8WA 1B8XA 4IW9A 1Z6MA 2FWFA 2WB9A 4MNNA 3APOA 4ISDA 4TR4A 3AY8A 5GZZB 3WGDA 2IFQB 1ERUA 2I81A 4POMA 3KMOA 3NZNA 2R0CA 5J4UA 1VF3A 2VCXA 3L4NA 2MYGA 1PN9A 5IMCA 2KP2A 1GUHA 1YZXA 3ZREA 4HU7A 4K0GA 3KH9A 3D4TA 4KW6A 4OCFA 2JSZA 1FHEA 4XS4B 3FW2A 1TU8A 4YQUA 1Z6NA 4F0BA 4K5SA 2GGTA 3M9KA 2VL2C 2B7JA 4XIHA 4CY6A 3KTBA 10GSA 1Y25A 2C1YA 4K7IA 4V2NA 3CTFA 4BWQA 1NSWA 4WXTA 2BJXA 1RQMA 5JWQB 2VO4A 2RM5A 3UAPA 2C0GA 5HR1A 4DVCA 1GSQA 2RIIA 4HQSA 2O7KA 2H73A 4PQHA 4O5QA 4NHZA 1OKDA 2ES7A 3QAGA 3APSA 1EOHA 3F6DA 2VM2A 4EO3A 1MD3A 1OC9B 1ERWA 3IC4A 2HZEB 1SL1B 1A23A 3KTLA 1K0NA 2YWOA 2C0FA 4WR5A 3VLNA 3HXSA 2YOIA 1OE7A 1A0FA 4E8EA 2GQMA 2KUCA 2H1AA 1GSFA 4XCSA 1SK1A 1PX7A 2H1GA 1FB6A 3D21A 4OD7A 5AGYA 4G19A 3W6GA 4GSSA 4HI7A 1URMA 1LJRA 4OCEA 4XRAA 1NHYA 2L4QA 4IP1A 5ECSA 2YANA 3DWVA 2H74A 4YAPA 2D2ZA 3KP8A 1GNWA 3LJRA 2DLXA 1G7EA 4I2UA 5LNKe 4Q5QA 3PPUA 1PKWA 4ZIJA 1X5DA 4L8EA 3Q19A 3F3RA 3M9JA 4P3YB 2PWJA 3RBTA 3M8NA 1PRXA 4K6XA 2XHFA 3U6VA 1GLPA 1K0CA 4PQIA 4FIWA 3DGQA
chains in the Genus database with same CATH topology
4POBA 5J5NA 3CMIA 6GSTA 1DSBA 1JZWA 1XVQA 3WT2A 8GSSA 1JHBA 1GSDA 2IMIA 2JZTA 5ECHB 4RQRA 2LRNA 1VF1A 4QQ7A 4ZL8A 2GZYA 3IK7A 4AF2A 3TRXA 2MZCA 3F4TA 3GKKA 3QAVA 2HSHA 1V98A 1XZOA 2NBSA 1AQVA 1A24A 1ERTA 2YWMA 3H8QA 4K7OA 4WR4A 3VWWA 2JL4A 4ECCA 2YWNA 2H75A 1FAAA 5IOWA 2B5EA 1G0TA 1FB0A 1R5PA 11GSA 5DALA 3TKSC 4LL1B 2FHEA 2R4VA 3OR5A 3O76A 4JR4A 3E9JB 3C1RA 4H86A 1BJXA 2PBJA 5J9CA 2VIMA 5A4WA 3L9UA 1PKZA 1YEXA 2X64A 3HA9A 4MH2A 2O89A 4KCEA 3ZTLA 3IK9A 1EEMA 2AAWA 4I8BA 3GMFA 4JU5A 2CA8A 3EWLA 4MF5A 4Z2UA 4AJ7A 2VL3A 2VM1A 1W89A 5A4VA 1TK8B 4KB3A 2HZFA 3GV1A 1ST9A 19GSA 2WULA 4LMWA 5E4WA 3FHKA 5ABRA 2R37A 2F51A 1QK8A 2DJ0A 3K8NA 1GTBA 1AW9A 2J23A 3HJOA 2BMXA 3LYPA 2GSQA 2HRFA 3CSJA 4JRRA 4IELA 1USBA 1R7HA 1J0FA 3A2VA 3LQ7A 1FVKA 4K2DA 2NTOA 2EIRA 5CRDA 1EWXA 2LTKA 2YCDA 2VD1A 4ML6A 3CSHA 2I9HA 1T8EB 1WPIA 1TU7A 3L9SA 2H01A 3PGTA 2GS3A 3APQA 3IA1A 2VCQA 3GIXA 5ECIB 4WETA 5FWGA 3W8JA 4NWYA 2H6YA 17GSA 2DJ3A 1X9WB 2JADA 1HNAA 3IPZA 1SD8A 2DIYA 5G1KA 3KH7A 4Z7XA 1F3AA 1OVNA 3ZIJA 3PH9A 1MD4A 1UN2A 2H0IA 4O7HA 1B9YC 2HRKA 1V2AA 1MDKA 2RLIA 5AISA 1IYIA 2DSAA 1WE0A 5B8AA 1MEKA 4BL7A 4J2FA 3UOMA 3KMNA 3LGCA 2GT6A 2VOCA 2DKIA 2X8CA 1YF0A 5H5RA 2IMFA 3QR6A 4HJMA 3MYDA 3NOFA 5AN1A 1EP7A 4JZQA 5IQYA 3GA4A 4RI7A 2GSTA 3QDNA 3LG6A 5CO3A 1BG5A 3S9FA 2QGVA 5ECPB 3VWXA 4G2EA 3EURA 3A3TA 4PTSA 4WF4A 3EC3A 4GXZA 3FZ5A 2HRAA 4TOPA 3PR8A 2IWTA 3A5IA 1XWKA 3G7YA 3CSIA 1SYXA 1TKDB 1ML6A 1WOUA 5ECMB 1GUKA 1PX6A 5C04A 1F2EA 2L5OA 4MZWA 2H30A 1S3AA 2P5RA 4MJEA 14GSA 3TKPA 1S3DA 2CAIA 3ZMKA 3VWUA 2OE3A 4MH3A 2VLTA 4PNGA 5DJLA 5ECRB 3DD3A 1JZRA 3TRPA 3KP9A 2V41A 3VPQA 4ICYA 5D9TA 4MA9A 1SL2B 2XC2A 4K0NA 2WDUA 3ERFA 4KF9A 1XOAA 1ERVA 1RK4A 2FGXA 2DBCA 2HYXA 4IJ3A 2CVKA 5DJMA 3TJFA 5IO2A 4KUNA 4EIQA 1SU9A 2VCWA 4Q5RA 1N8JA 3TRQA 3GKNA 4O5RA 4HUAA 3KZQA 1PMTA 5CP1A 1AAZA 4AJ8A 2N5AA 1GLQA 1HYUA 3LORA 3EVIA 3FR3A 5CAXA 2LRCA 2OBKA 5AIVA 4N10A 2CVDA 5ECLB 4AGSA 3IC8A 1EZKA 3EINA 3WD6A 4DSSA 1OYJA 3O6TA 4CY8A 4N30A 4RQXA 1GUMA 3QFAC 2DMLA 1AUCA 2QSIA 4QL7A 1QQ2A 4V2MA 4K5RA 2XPDA 4PXOA 2F8FA 2CZ3A 1B4PA 2OKAA 1LU4A 1H75A 3Q74A 4YH2A 4TW5A 3CYNA 2YPMA 2H1BA 1SK0A 3KEBA 3QFBC 4POLA 1A0RP 4MK3A 3ZMLA 2VLUA 5DCGA 2FA8A 3H79A 4MDCA 1S3CA 2O87A 4XHMA 4K7NA 5JCUA 4OFNA 5G30A 4LA1A 5IM9A 2CAQA 1I9DA 2HXKA 1FVJA 1O73A 2A2SA 5IMFA 4ZILA 1GRXA 2C0EA 1PL1A 1K0DA 3TOTA 3W8SA 5FHIA 4CW9A 2RUFA 2OE1A 4J57E 3BBYA 4IS0A 2IN3A 4DEJA 3V1WA 2OE0A 1XPVA 2K8SA 3HCZA 4TR0A 5IPHA 2L59A 2DC5A 2R2JA 3ZFBA 4TXVA 1KNGA 1JZDA 3J7Yk 2OACA 1KEBA 2EIQA 2QA1A 3LEFA 3GYKA 4X0XA 5G5EA 2X99A 1BAYA 2DJ2A 5BMUA 9GSSA 5KOXA 2GSRA 1AXDA 2CQ9A 3BOAA 3ERWA 1ZMAA 1AIUA 3KM6A 1NHOA 4YAVA 2ZUPA 3FEUA 3GL3A 1A8YA 4EIPA 3I43A 1DUGA 3IRAA 4TR1A 5ELAA 4PX1A 5ID2B 4KE3A 2A4VA 3HY2A 3FZAA 3ME8A 4ZL7A 4MLYA 5DBQA 3UVTA 3ZVJD 1WMJA 2CX3A 2EIOA 1A2LA 1M99A 1X5CA 1CQGA 3UL3A 3BCIA 2A2PA 2GZPA 2M80A 3UEMA 2B5YA 3I69A 1AQWA 2G0FA 2MMZA 3JCML 5INYA 3CTGA 3M0FA 3GTUA 1OE8A 1I5GA 3M1GA 2FCHA 5C00A 1M9BA 5F8BA 1X0RA 1YJ6A 1A8LA 1XVWA 3TCOA 2H0GA 4KSOA 2P0GA 2WRTA 5B8BA 3HVVA 1U3IA 3TB2A 3F4RA 1A2JA 2X8GA 4LL4B 3RAZA 3VURA 3M3MA 5D9XA 2M72A 4OO4A 3D0ZA 4Z2RA 4FYCA 1Q98A 3Q18A 2MMNA 3DIEA 3EU3A 1WJKA 3TDGA 5DALB 1PA3A 3VWVA 1HNCA 2WCIA 4KX4A 5AIXA 5GAPD 2PGTA 5JWOB 5ECQB 5IOXA 1TRSA 3GX0A 3VI7A 1TRVA 4PUAA 2IL3A 2NPBA 4K1FA 1T00A 4O5UA 1BEDA 5HFIA 4XTSA 1ILOA 4KA0A 3E0UA 4F82A 3O3TA 3FZ9A 4ZB6A 2AB6A 2ON7A 1DE2A 3HVSA 5G5FA 3L78A 3SBCA 1F9MA 2KOKA 4GSTA 7GSSA 1V40A 3P90A 4TN8A 4PURA 1EGOA 2WGRA 4NV2A 5G1LA 1G6YA 4DSRA 2M46A 2XPEA 1T1VA 4ULXA 4HDEA 2DMMA 5A5KA 4JEDA 3UMAA 3GH9A 1K0MA 1GSSA 2A4HA 2HSMA 5D9WA 4ID0A 1Z7PA 4ZB9A 2JACA 2KLXA 2GQLA 2VL9A 1SKRB 1Q4JA 4D73B 5DAKA 4PUFC 1HNBA 1TI3A 1XWBA 1THXA 4F03A 4WKWA 3VPTA 4BL7B 1O8XA 2YNXA 5CRGA 3F3QA 4MJCA 3ZLPA 5ELGA 3TJJA 3C8EA 3DMLA 1XXUA 6GSXA 4TKYA 4BVXA 3D5JA 3RDWA 6GSVA 5EVOA 3UBKA 1XW5A 2PVOC 2WFCA 1F37A 2CV4A 2R6KA 1XBSA 3EMPA 2RUEA 3BJ5A 4MJBA 2HT9A 2XBIA 1VF4A 4K9ZA 2NVLA 1G7OA 3ZRDA 2IPAA 3U5RE 12GSA 1XW6A 2FWHA 1M2DA 5KEJA 1QXHA 3HDCA 4EL1A 2H70A 1RW1A 1QGVA 3DKSA 1O85A 2AYTA 1XW9A 3QD9A 5LD0A 2E0QA 3HD5A 2YJ7A 4HEA2 2C4JA 2C3NA 4TXOA 2HLSA 3SWLA 2OBIA 1XOBA 4F0CA 4E8HA 3C7MA 4HS1A 2YN1A 4ML1A 1GSYA 3F6FA 1ZYEA 2GT5A 2REMA 2HRNA 2TRCP 1K3LA 4WBJA 2FNOA 1R5AA 4Q5FA 1O8WA 3G7JA 2V1MA 1PSQA 3C1SA 2MMAA 3BCKA 3DXBA 5IMVA 3R3EA 3A5WA 2PERA 3EPTA 1DE1A 2V6OA 1M2AA 3KXOA 2VLVA 4FYBA 1EP8A 4MZCA 4IJIA 3P2AA 2AV4A 2QC7A 3ZFLA 2DIZA 2P31A 4MMMA 1ZYPA 2FWEA 4GQFA 5F05A 3TKSA 1U6TA 4MZBA 3GFKA 1BQ7A 3GUSA 5HFGA 1X9MB 1O81A 4FQUA 5ECKB 4HZ4A 2DJKA 3UJ1A 3F9UA 4DSSB 3HYPA 2YV7A 5D96A 2QKEA 3L0HA 3Q6OA 3FY7A 3BD2A 4L0UA 3GNJA 3GHAA 1MDJA 3HHVA 6GSUA 1F3BA 2H66A 2F9SA 4ILFA 4OO5A 1ACVA 3RHBA 3FZ4A 3FKFA 4K2XA 5IO0A 5CRHA 5F0GA 3IAM2 3IAS2 3RHCA 1M7TA 2LSTA 2YWIA 2H76A 5L71A 2JU5A 3UIWA 5JCGA 3VK9A 2HFDA 1OKTA 1Z3EA 1ZZYA 3EE2A 3MSZA 4GRFA 1O7UA 4MPFA 2AJQB 2C0DA 3KIJA 1K0BA 4NAXA 1YEPA 3ZYWA 5EPFA 2B5XA 4FO5A 4IP6A 5H5SA 2K6VA 4HOJA 4AJ6A 4X43A 4EE0A 2H6XA 4NV5A 2MBTA 1TRUA 3MWHA 3LXTA 2KHPA 4ZBAA 3FK8A 3ZZXA 4POKA 4ZBDA 2IIYA 2P5QA 4EC0A 3QOUA 3N9JA 1T3BA 2GLRA 1MTCA 1OAZA 5J3RA 1TK5B 3EMXA 2CVBA 4O92A 5BRTA 4O32A 2GQKA 1XWCA 2LEGA 1G6WA 1EGRA 4G0KA 5J9BA 1TRWA 5IPGA 4RUVA 3N5OA 2A2RA 1X5EA 5ENUA 4L5LA 2C80A 3ISOA 4BPYA 2VCZA 2IJYA 2K18A 4KNDA 4KGIA 5KN0A 1PD21 2YZUA 1SJIA 3F4SA 3VFIA 5ECNB 3I9V2 1GTIA 1XFLA 2B1LA 1PQNA 2VCTA 4HZ2A 2K8VA 3IR4A 3GTUB 4QL9A 3F0IA 2H71A 4V2LA 4A5PA 2IMDA 4BVYA 5EL8A 3CBUA 3TGZA 3L9VA 2CZ2A 5ECOB 4TR3A 4N0VA 3GKXA 3GX8A 1ABAA 1TJDA 1SENA 1EOGA 3MIXA 3G9BA 4KSMA 4BA7A 3HJMA 4K8MA 4MF6A 3TOUA 1O6JA 3FMWA 2WZ9A 3R2QA 2FLSA 3TJGA 1GTAA 2L6CA 1JLVA 5KN2A 2OA7A 4KDYA 2MMOA 3KJYA 3A2WA 4MJAA 3IOSA 2FA4A 2X8HA 1HQOA 13GSA 5EY6A 1TTZA 1THOA 4YKFA 3GSTA 2H72A 1TI1A 1TDIA 3TJBA 2O85A 2LJKA 4NXIA 2JZRA 3CRUA 2LUSA 5KN3A 2EC4A 5D93A 1E6BA 3D4MA 5A4UA 3HVXA 5JWRB 2GZZA 1R4WA 1JZOA 2FUG2 2L6DA 4IQAA 4MF7A 3DEXA 2FWGA 2UZ8A 1FOHA 1SK2A 1GNEA 2IMKA 2QA2A 1M0UA 2E7PA 1WWJA 3DRNA 4IN0A 1T4YA 4MP4A 2AHEA 1ZYQB 2B3SA 3ZVJA 3D6IA 5HR0A 3HZ4A 3ERGA 3C71A 3RPNA 2J9HA 4HU9A 4J56E 6GSYA 2LNTA 3NIVA 3H1NA 1A2MA 1GP1A 3LXZA 1SKWB 1GWCA 1SD9A 5FT3A 4V1Ag 3KGKA 3KCMA 1WIKA 1FOVA 2VUPA 1CQHA 1XWAA 3QCPA 4RI6A 1C72A 5B6MA 1M9AA 4GCIA 5DAKB 1XCCA 3MDKA 3PINA 1B4QA 3KD0A 3GN3A 4IHUA 2IFQA 3QPMA 1ZL9A 1YKAA 1GTUA 3G7IA 4ECBA 2PVQA 2LQOA 2R0PA 1T4ZA 2JSYA 3QAWA 2R5GA 5E59A 2H19A 4BVXB 4BWSA 1U3AA 1V58A 5D8IA 2ALBA 2LV3A 3E3EA 1DBYA 5G2ZA 3J7Yb 2B6MA 3MNGA 4XS4A 5B6NA 4G0LA 3P7XA 4X4JA 2VL2A 5HQPA 2C3TA 1TOFA 4GQCA 2DJJA 1K3YA 2BTOT 2JZSA 4GTUA 1JLWA 1U88A 4I2TA 1KTEA 2PMTA 3LYKA 4N0ZA 3F63A 5HR3A 5ID2A 3GH6A 2YJHA 4EUYA 1GSUA 2C8UA 4ECJA 3RPPA 20GSA 4F9ZA 4NMUA 3UVHA 2L5LA 2X4AA 2C3QA 2F8AA 1IYHA 1FG4A 4TXOB 1J08A 1B9XC 5F06A 2H6ZA 2E2MA 4OFTA 4IVFA 1J9BA 2LJRA 2E2GA 3FR6A 3FYGA 5IIZA 5G31A 1SKSB 4XS1A 3GL5A 1OC9A 1YKCA 4OFMA 2HZEA 1R26A 4KAEA 4OMVA 2HNLA 5GAND 4HJ2A 3EYTA 4KDUA 4FYUA 1V57A 4I97A 1EEJA 4FH8A 2NDOA 1K0OA 4XS6A 1LBKA 4I6XA 4L5OA 1PL2A 1VRSD 2H8LA 1ZYNA 1TK0B 1PGTA 2LRTA 2WS2A 4EDYA 1GH2A 4ZB8A 2I4AA 4JR6A 2YZHA 2R0GA 1U87A 2N5BA 1M2BA 3TKSE 2PUKC 3LWAA 4NPBA 1FW1A 1NW2A 5F07A 3WT1A 5D73A 4ECIA 4Z2TA 1SJ6A 5IMAA 16GSA 4CDOA 4HQZA 4X1UA 2L4CA 3C73A 1UC7A 4L0WA 1GL8A 1WP0A 4MABA 3HZ8A 1E2YA 1SJZA 4GSNA 5JCWA 3GSSA 5LCZA 1PN0A 1Z9HA 2VAFA 1TP9A 2L57A 1EV9A 2H0HA 4PQ1A 5KOWA 2GTUA 1BX9A 3FR9A 3DVXA 5IMDA 4YKGA 3LSZA 3IBHA 2YP6A 2MBSA 1ZCPA 2OJLA 3DVWA 3QMXA 3WGEA 2G2QA 4ACSA 1WRYA 2K9FA 3H4KA 3HJPA 5KN1A 4IBPA 1H4OA 4G0IA 1T7PB 4YQMA 2HE3A 2B7KA 4EDZA 3TUEA 1GSEA 1XIYA 2AUVA 4KDXA 1ON4A 2WJUA 1W4VA 4NHWA 2H1DA 2I1UA 3ZIVA 1ZOFA 3UARA 4G10A 3EU4A 2TIRA 1AQXA 4ZBBA 3TKRA 6GSSA 1GULA 4Q5NA 4GF0A 3GURA 2OADA 4V1Ap 1YDKA 22GSA 1K3OA 4EVMA 4GWRA 3A2XA 4G9HA 4D73A 5GSTA 5CYYA 1VGLA 1YQ1A 4GLTA 4EKZA 5DCHA 2V6KA 1JFUA 1K0AA 5IMZA 4LLRA 5DVBA 2PN8A 4N11A 1YF1A 1Z5YE 4TRXA 1OC8A 3CRTA 4USSA 2HI7A 2LQQA 2GSSA 6GSWA 2IMEA 2ZCTA 4IQ1A 2LKUA 1N2AA 3ME7A 4IKHA 2VCVA 4MCUA 2FD3A 4WF5A 1TXXA 5DQSA 3WYWA 4PNFA 5B7CA 2RM6A 2LNSA 2XBQA 3ED3A 4TVEA 4BVYB 5J41A 2LJAA 4KH7A 3IXRA 5COHA 3D22A 1TW9A 1F6MC 2GDRA 4ZL9A 5CRWA 1HD2A 2PPTA 1UA5A 5D9VA 3US3A 2V2GA 3CXGA 3MAKA 2TRXA 2CX4A 3F8UA 3GKMA 3IE3A 2V32A 2CT6A 2X49A 2GVPA 2KP1A 2R3XA 4ZXGA 1ZGNA 3H93A 4WEYA 3DYRA 1QMVA 2N5FA 3LFLA 2DJ1A 1SL0B 5HFKA 1FO5A 4DSQA 2YV9A 3WGXA 1UVZA 4KCAA 5DDLA 3TKQA 1VF2A 2O8VB 1QFNA 4LMVA 3ZITA 2VD0A 1Z7RA 2I3YA 1Y6EA 1QUWA 1XWGA 1NM3A 3HKRA 1AC1A 1MDIA 2ZNMA 4JBBA 2FY6A 4TR1B 1BYEA 4YQVA 4OWYA 3IHQA 1X9SB 2F3MA 4IGJA 5CREA 1OC3A 1SYRA 2HSYA 1V9WA 3IDVA 1B48A 4EXJA 2ON5A 4XRDA 4EF0A 3TJKA 2B1KA 3FRCA 4PGTA 2Z9SA 4WBRD 2DKHA 3GRXA 3ZL5A 5GSSA 4JE1A 3VI5A 18GSA 3UBLA 4MPGA 2LS5A 3LW9A 2PU9C 1KBNA 1EV4A 3IV4A 1YY7A 3I6AA 4CHSA 5HR2A 5DQYA 4F2IA 4I5QA 5CNWA 5H5QA 3IHGA 3P8WA 1B8XA 4IW9A 1Z6MA 2FWFA 2WB9A 4MNNA 3APOA 4ISDA 4TR4A 3AY8A 5GZZB 3WGDA 2IFQB 1ERUA 2I81A 4POMA 3KMOA 3NZNA 2R0CA 5J4UA 1VF3A 2VCXA 3L4NA 2MYGA 1PN9A 5IMCA 2KP2A 1GUHA 1YZXA 3ZREA 4HU7A 4K0GA 3KH9A 3D4TA 4KW6A 4OCFA 2JSZA 1FHEA 4XS4B 3FW2A 1TU8A 4YQUA 1Z6NA 4F0BA 4K5SA 2GGTA 3M9KA 2VL2C 2B7JA 4XIHA 4CY6A 3KTBA 10GSA 1Y25A 2C1YA 4K7IA 4V2NA 3CTFA 4BWQA 1NSWA 4WXTA 2BJXA 1RQMA 5JWQB 2VO4A 2RM5A 3UAPA 2C0GA 5HR1A 4DVCA 1GSQA 2RIIA 4HQSA 2O7KA 2H73A 4PQHA 4O5QA 4NHZA 1OKDA 2ES7A 3QAGA 3APSA 1EOHA 3F6DA 2VM2A 4EO3A 1MD3A 1OC9B 1ERWA 3IC4A 2HZEB 1SL1B 1A23A 3KTLA 1K0NA 2YWOA 2C0FA 4WR5A 3VLNA 3HXSA 2YOIA 1OE7A 1A0FA 4E8EA 2GQMA 2KUCA 2H1AA 1GSFA 4XCSA 1SK1A 1PX7A 2H1GA 1FB6A 3D21A 4OD7A 5AGYA 4G19A 3W6GA 4GSSA 4HI7A 1URMA 1LJRA 4OCEA 4XRAA 1NHYA 2L4QA 4IP1A 5ECSA 2YANA 3DWVA 2H74A 4YAPA 2D2ZA 3KP8A 1GNWA 3LJRA 2DLXA 1G7EA 4I2UA 5LNKe 4Q5QA 3PPUA 1PKWA 4ZIJA 1X5DA 4L8EA 3Q19A 3F3RA 3M9JA 4P3YB 2PWJA 3RBTA 3M8NA 1PRXA 4K6XA 2XHFA 3U6VA 1GLPA 1K0CA 4PQIA 4FIWA 3DGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4POB A;  5J5N A;  3CMI A;  6GST A;  1DSB A;  1JZW A;  1XVQ A;  3WT2 A;  8GSS A;  1JHB A;  1GSD A;  2IMI A;  2JZT A;  5ECH B;  4RQR A;  2LRN A;  1VF1 A;  4QQ7 A;  4ZL8 A;  2GZY A;  3IK7 A;  4AF2 A;  3TRX A;  2MZC A;  3F4T A;  3GKK A;  3QAV A;  2HSH A;  1V98 A;  1XZO A;  2NBS A;  1AQV A;  1A24 A;  1ERT A;  2YWM A;  3H8Q A;  4K7O A;  4WR4 A;  3VWW A;  2JL4 A;  4ECC A;  2YWN A;  2H75 A;  1FAA A;  5IOW A;  2B5E A;  1G0T A;  1FB0 A;  1R5P A;  11GS A;  5DAL A;  3TKS C;  4LL1 B;  2FHE A;  2R4V A;  3OR5 A;  3O76 A;  4JR4 A;  3E9J B;  3C1R A;  4H86 A;  1BJX A;  2PBJ A;  5J9C A;  2VIM A;  5A4W A;  3L9U A;  1PKZ A;  1YEX A;  2X64 A;  3HA9 A;  4MH2 A;  2O89 A;  4KCE A;  3ZTL A;  3IK9 A;  1EEM A;  2AAW A;  4I8B A;  3GMF A;  4JU5 A;  2CA8 A;  3EWL A;  4MF5 A;  4AJ7 A;  2VL3 A;  2VM1 A;  1W89 A;  5A4V A;  1TK8 B;  4KB3 A;  2HZF A;  3GV1 A;  1ST9 A;  19GS A;  2WUL A;  4LMW A;  5E4W A;  3FHK A;  5ABR A;  2R37 A;  2F51 A;  1QK8 A;  2DJ0 A;  3K8N A;  1GTB A;  1AW9 A;  2J23 A;  3HJO A;  2BMX A;  3LYP A;  2GSQ A;  2HRF A;  3CSJ A;  4JRR A;  4IEL A;  1USB A;  1R7H A;  1J0F A;  3A2V A;  3LQ7 A;  1FVK A;  4K2D A;  2NTO A;  2EIR A;  5CRD A;  1EWX A;  2LTK A;  2YCD A;  2VD1 A;  4ML6 A;  3CSH A;  2I9H A;  1T8E B;  1WPI A;  1TU7 A;  3L9S A;  2H01 A;  3PGT A;  2GS3 A;  3APQ A;  3IA1 A;  2VCQ A;  3GIX A;  5ECI B;  4WET A;  5FWG A;  3W8J A;  4NWY A;  2H6Y A;  17GS A;  2DJ3 A;  1X9W B;  2JAD A;  1HNA A;  3IPZ A;  1SD8 A;  2DIY A;  5G1K A;  3KH7 A;  4Z7X A;  1F3A A;  1OVN A;  3ZIJ A;  3PH9 A;  1MD4 A;  1UN2 A;  2H0I A;  4O7H A;  1B9Y C;  1V2A A;  1MDK A;  2RLI A;  5AIS A;  1IYI A;  2DSA A;  1WE0 A;  5B8A A;  1MEK A;  4BL7 A;  4J2F A;  3UOM A;  3KMN A;  3LGC A;  2GT6 A;  2VOC A;  2X8C A;  1YF0 A;  5H5R A;  2IMF A;  3QR6 A;  4HJM A;  3NOF A;  5AN1 A;  1EP7 A;  4JZQ A;  5IQY A;  3GA4 A;  4RI7 A;  2GST A;  3QDN A;  3LG6 A;  5CO3 A;  1BG5 A;  3S9F A;  2QGV A;  5ECP B;  3VWX A;  4G2E A;  3EUR A;  3A3T A;  4WF4 A;  3EC3 A;  4GXZ A;  3FZ5 A;  4TOP A;  3PR8 A;  2IWT A;  1XWK A;  3G7Y A;  3CSI A;  1SYX A;  1TKD B;  1ML6 A;  1WOU A;  5ECM B;  1GUK A;  1PX6 A;  5C04 A;  1F2E A;  2L5O A;  4MZW A;  2H30 A;  1S3A A;  2P5R A;  4MJE A;  14GS A;  3TKP A;  1S3D A;  2CAI A;  3ZMK A;  3VWU A;  2OE3 A;  4MH3 A;  2VLT A;  4PNG A;  5DJL A;  5ECR B;  3DD3 A;  1JZR A;  3TRP A;  3KP9 A;  2V41 A;  3VPQ A;  5D9T A;  4MA9 A;  1SL2 B;  2XC2 A;  4K0N A;  2WDU A;  3ERF A;  1XOA A;  1ERV A;  1RK4 A;  2FGX A;  2DBC A;  2HYX A;  4IJ3 A;  2CVK A;  5DJM A;  3TJF A;  5IO2 A;  4KUN A;  1SU9 A;  2VCW A;  4Q5R A;  1N8J A;  3TRQ A;  3GKN A;  4O5R A;  4HUA A;  3KZQ A;  1PMT A;  5CP1 A;  1AAZ A;  4AJ8 A;  2N5A A;  1GLQ A;  1HYU A;  3LOR A;  3EVI A;  3FR3 A;  5CAX A;  2LRC A;  2OBK A;  5AIV A;  4N10 A;  2CVD A;  5ECL B;  4AGS A;  1EZK A;  3EIN A;  3WD6 A;  4DSS A;  1OYJ A;  3O6T A;  4N30 A;  4RQX A;  1GUM A;  3QFA C;  2DML A;  1AUC A;  2QSI A;  4QL7 A;  1QQ2 A;  4V2M A;  2XPD A;  4PXO A;  2F8F A;  2CZ3 A;  1B4P A;  2OKA A;  1LU4 A;  1H75 A;  3Q74 A;  4YH2 A;  4TW5 A;  3CYN A;  2YPM A;  2H1B A;  1SK0 A;  3KEB A;  3QFB C;  4POL A;  1A0R P;  4MK3 A;  3ZML A;  2VLU A;  5DCG A;  2FA8 A;  3H79 A;  4MDC A;  1S3C A;  2O87 A;  4XHM A;  4K7N A;  5JCU A;  4OFN A;  5G30 A;  4LA1 A;  5IM9 A;  2CAQ A;  1I9D A;  2HXK A;  1FVJ A;  1O73 A;  2A2S A;  5IMF A;  4ZIL A;  1GRX A;  2C0E A;  1PL1 A;  1K0D A;  3TOT A;  3W8S A;  5FHI A;  4CW9 A;  2RUF A;  2OE1 A;  4J57 E;  3BBY A;  4IS0 A;  2IN3 A;  4DEJ A;  3V1W A;  2OE0 A;  1XPV A;  2K8S A;  3HCZ A;  4TR0 A;  5IPH A;  2L59 A;  2DC5 A;  2R2J A;  3ZFB A;  4TXV A;  1KNG A;  1JZD A;  3J7Y k;  2OAC A;  1KEB A;  2EIQ A;  3LEF A;  3GYK A;  4X0X A;  5G5E A;  2X99 A;  1BAY A;  2DJ2 A;  9GSS A;  2GSR A;  1AXD A;  2CQ9 A;  3BOA A;  3ERW A;  1ZMA A;  1AIU A;  3KM6 A;  1NHO A;  4YAV A;  2ZUP A;  3FEU A;  3GL3 A;  1A8Y A;  3I43 A;  1DUG A;  3IRA A;  4TR1 A;  5ELA A;  4PX1 A;  5ID2 B;  4KE3 A;  2A4V A;  3HY2 A;  3FZA A;  3ME8 A;  4ZL7 A;  4MLY A;  5DBQ A;  3UVT A;  3ZVJ D;  1WMJ A;  2CX3 A;  2EIO A;  1A2L A;  1M99 A;  1X5C A;  1CQG A;  3UL3 A;  3BCI A;  2GZP A;  3UEM A;  2M80 A;  2B5Y A;  3I69 A;  1AQW A;  2G0F A;  2MMZ A;  3JCM L;  5INY A;  3CTG A;  3M0F A;  3GTU A;  1OE8 A;  1I5G A;  3M1G A;  2FCH A;  5C00 A;  1M9B A;  5F8B A;  1X0R A;  1YJ6 A;  1A8L A;  1XVW A;  3TCO A;  2H0G A;  4KSO A;  2P0G A;  2WRT A;  5B8B A;  3HVV A;  1U3I A;  3TB2 A;  3F4R A;  1A2J A;  2X8G A;  4LL4 B;  3RAZ A;  3VUR A;  3M3M A;  5D9X A;  2M72 A;  4OO4 A;  3D0Z A;  4FYC A;  1Q98 A;  3Q18 A;  2MMN A;  3DIE A;  3EU3 A;  1WJK A;  3TDG A;  5DAL B;  1PA3 A;  3VWV A;  1HNC A;  2WCI A;  4KX4 A;  5AIX A;  5GAP D;  2PGT A;  5JWO B;  5ECQ B;  5IOX A;  1TRS A;  3GX0 A;  3VI7 A;  1TRV A;  4PUA A;  2IL3 A;  2NPB A;  4K1F A;  1T00 A;  1BED A;  5HFI A;  4XTS A;  1ILO A;  4KA0 A;  3E0U A;  4F82 A;  3O3T A;  3FZ9 A;  4ZB6 A;  2AB6 A;  2ON7 A;  1DE2 A;  3HVS A;  5G5F A;  3L78 A;  3SBC A;  1F9M A;  2KOK A;  4GST A;  7GSS A;  1V40 A;  3P90 A;  4TN8 A;  4PUR A;  1EGO A;  2WGR A;  4NV2 A;  5G1L A;  1G6Y A;  4DSR A;  2M46 A;  2XPE A;  1T1V A;  4ULX A;  4HDE A;  2DMM A;  5A5K A;  4JED A;  3UMA A;  3GH9 A;  1K0M A;  1GSS A;  5D9W A;  4ID0 A;  1Z7P A;  4ZB9 A;  2JAC A;  2KLX A;  2GQL A;  2VL9 A;  1SKR B;  1Q4J A;  4D73 B;  5DAK A;  4PUF C;  1HNB A;  1TI3 A;  1XWB A;  1THX A;  4F03 A;  4WKW A;  3VPT A;  1O8X A;  2YNX A;  5CRG A;  3F3Q A;  4MJC A;  3ZLP A;  5ELG A;  3TJJ A;  3C8E A;  3DML A;  1XXU A;  6GSX A;  4TKY A;  4BVX A;  3D5J A;  3RDW A;  6GSV A;  5EVO A;  3UBK A;  1XW5 A;  2PVO C;  2WFC A;  1F37 A;  2CV4 A;  2R6K A;  1XBS A;  3EMP A;  2RUE A;  3BJ5 A;  4MJB A;  2HT9 A;  2XBI A;  1VF4 A;  4K9Z A;  2NVL A;  1G7O A;  3ZRD A;  2IPA A;  3U5R E;  12GS A;  1XW6 A;  2FWH A;  1M2D A;  5KEJ A;  1QXH A;  3HDC A;  4EL1 A;  2H70 A;  1RW1 A;  1QGV A;  3DKS A;  1O85 A;  2AYT A;  1XW9 A;  3QD9 A;  5LD0 A;  2E0Q A;  3HD5 A;  2YJ7 A;  4HEA 2;  2C4J A;  2C3N A;  4TXO A;  2HLS A;  3SWL A;  2OBI A;  1XOB A;  4F0C A;  4E8H A;  3C7M A;  4HS1 A;  2YN1 A;  4ML1 A;  1GSY A;  3F6F A;  1ZYE A;  2GT5 A;  2REM A;  2HRN A;  2TRC P;  1K3L A;  4WBJ A;  2FNO A;  1R5A A;  4Q5F A;  1O8W A;  3G7J A;  2V1M A;  1PSQ A;  3C1S A;  2MMA A;  3BCK A;  3DXB A;  5IMV A;  3A5W A;  2PER A;  1DE1 A;  2V6O A;  1M2A A;  3KXO A;  2VLV A;  4FYB A;  1EP8 A;  4MZC A;  4IJI A;  3P2A A;  2AV4 A;  2QC7 A;  3ZFL A;  2DIZ A;  2P31 A;  4MMM A;  2FWE A;  4GQF A;  5F05 A;  3TKS A;  1U6T A;  4MZB A;  3GFK A;  1BQ7 A;  3GUS A;  5HFG A;  1X9M B;  1O81 A;  5ECK B;  4HZ4 A;  2DJK A;  3UJ1 A;  3F9U A;  4DSS B;  3HYP A;  2YV7 A;  5D96 A;  2QKE A;  3L0H A;  3Q6O A;  3FY7 A;  3BD2 A;  4L0U A;  3GNJ A;  3GHA A;  1MDJ A;  3HHV A;  6GSU A;  1F3B A;  2H66 A;  2F9S A;  4ILF A;  4OO5 A;  1ACV A;  3RHB A;  3FZ4 A;  3FKF A;  5IO0 A;  5CRH A;  5F0G A;  3IAM 2;  3IAS 2;  3RHC A;  1M7T A;  2LST A;  2YWI A;  2H76 A;  5L71 A;  2JU5 A;  3UIW A;  5JCG A;  3VK9 A;  2HFD A;  1OKT A;  1Z3E A;  1ZZY A;  3EE2 A;  3MSZ A;  4GRF A;  1O7U A;  4MPF A;  2AJQ B;  2C0D A;  3KIJ A;  1K0B A;  4NAX A;  1YEP A;  3ZYW A;  5EPF A;  2B5X A;  4FO5 A;  4IP6 A;  5H5S A;  2K6V A;  4HOJ A;  4AJ6 A;  4X43 A;  4EE0 A;  2H6X A;  4NV5 A;  2MBT A;  1TRU A;  3MWH A;  3LXT A;  2KHP A;  4ZBA A;  3FK8 A;  3ZZX A;  4POK A;  4ZBD A;  2IIY A;  2P5Q A;  4EC0 A;  3QOU A;  3N9J A;  1T3B A;  2GLR A;  1MTC A;  1OAZ A;  5J3R A;  1TK5 B;  3EMX A;  2CVB A;  4O92 A;  4O32 A;  2GQK A;  1XWC A;  2LEG A;  1G6W A;  1EGR A;  5J9B A;  1TRW A;  5IPG A;  4RUV A;  3N5O A;  2A2R A;  1X5E A;  5ENU A;  4L5L A;  2C80 A;  3ISO A;  4BPY A;  2VCZ A;  2IJY A;  2K18 A;  4KND A;  4KGI A;  5KN0 A;  1PD2 1;  2YZU A;  1SJI A;  3F4S A;  3VFI A;  5ECN B;  3I9V 2;  1GTI A;  1XFL A;  2B1L A;  1PQN A;  2VCT A;  4HZ2 A;  2K8V A;  3IR4 A;  3GTU B;  4QL9 A;  3F0I A;  2H71 A;  4V2L A;  2IMD A;  4BVY A;  5EL8 A;  3CBU A;  3TGZ A;  3L9V A;  2CZ2 A;  5ECO B;  4TR3 A;  4N0V A;  3GKX A;  3GX8 A;  1ABA A;  1TJD A;  1SEN A;  1EOG A;  3G9B A;  4KSM A;  4BA7 A;  3HJM A;  4K8M A;  4MF6 A;  3TOU A;  1O6J A;  2WZ9 A;  3R2Q A;  2FLS A;  3TJG A;  1GTA A;  2L6C A;  1JLV A;  5KN2 A;  2OA7 A;  4KDY A;  2MMO A;  3KJY A;  3A2W A;  4MJA A;  3IOS A;  2FA4 A;  2X8H A;  1HQO A;  13GS A;  5EY6 A;  1TTZ A;  1THO A;  3GST A;  2H72 A;  1TI1 A;  1TDI A;  3TJB A;  2O85 A;  2LJK A;  4NXI A;  2JZR A;  3CRU A;  2LUS A;  5KN3 A;  2EC4 A;  5D93 A;  1E6B A;  3D4M A;  5A4U A;  3HVX A;  5JWR B;  2GZZ A;  1R4W A;  1JZO A;  2FUG 2;  2L6D A;  4IQA A;  4MF7 A;  3DEX A;  2FWG A;  1SK2 A;  1GNE A;  2IMK A;  1M0U A;  2E7P A;  1WWJ A;  3DRN A;  4IN0 A;  1T4Y A;  4MP4 A;  2AHE A;  1ZYQ B;  2B3S A;  3ZVJ A;  3D6I A;  5HR0 A;  3HZ4 A;  3ERG A;  3C71 A;  3RPN A;  2J9H A;  4HU9 A;  4J56 E;  6GSY A;  2LNT A;  3NIV A;  3H1N A;  1A2M A;  1GP1 A;  3LXZ A;  1SKW B;  1GWC A;  1SD9 A;  5FT3 A;  4V1A g;  3KGK A;  3KCM A;  1WIK A;  1FOV A;  2VUP A;  1CQH A;  1XWA A;  3QCP A;  4RI6 A;  1C72 A;  5B6M A;  1M9A A;  4GCI A;  5DAK B;  1XCC A;  3MDK A;  3PIN A;  1B4Q A;  3KD0 A;  3GN3 A;  4IHU A;  2IFQ A;  3QPM A;  1ZL9 A;  1YKA A;  1GTU A;  3G7I A;  4ECB A;  2PVQ A;  2LQO A;  1T4Z A;  2JSY A;  3QAW A;  2R5G A;  5E59 A;  2H19 A;  4BWS A;  1U3A A;  1V58 A;  5D8I A;  2ALB A;  2LV3 A;  3E3E A;  1DBY A;  5G2Z A;  3J7Y b;  2B6M A;  3MNG A;  4XS4 A;  5B6N A;  3P7X A;  2VL2 A;  5HQP A;  2C3T A;  1TOF A;  4GQC A;  2DJJ A;  1K3Y A;  2BTO T;  2JZS A;  4GTU A;  1JLW A;  1U88 A;  4I2T A;  1KTE A;  2PMT A;  3LYK A;  4N0Z A;  3F63 A;  5HR3 A;  5ID2 A;  3GH6 A;  2YJH A;  4EUY A;  1GSU A;  2C8U A;  4ECJ A;  3RPP A;  20GS A;  4F9Z A;  4NMU A;  3UVH A;  2L5L A;  2C3Q A;  2F8A A;  1IYH A;  1FG4 A;  4TXO B;  1J08 A;  1B9X C;  5F06 A;  2H6Z A;  2E2M A;  4OFT A;  4IVF A;  1J9B A;  2LJR A;  2E2G A;  3FR6 A;  3FYG A;  5IIZ A;  5G31 A;  1SKS B;  4XS1 A;  3GL5 A;  1OC9 A;  1YKC A;  4OFM A;  2HZE A;  1R26 A;  4KAE A;  4OMV A;  2HNL A;  5GAN D;  4HJ2 A;  3EYT A;  4KDU A;  4FYU A;  1V57 A;  4I97 A;  1EEJ A;  4FH8 A;  2NDO A;  1K0O A;  4XS6 A;  1LBK A;  4I6X A;  4L5O A;  1PL2 A;  1VRS D;  2H8L A;  1TK0 B;  1PGT A;  2LRT A;  2WS2 A;  4EDY A;  1GH2 A;  4ZB8 A;  2I4A A;  4JR6 A;  2YZH A;  1U87 A;  2N5B A;  1M2B A;  3TKS E;  2PUK C;  3LWA A;  4NPB A;  1FW1 A;  1NW2 A;  5F07 A;  3WT1 A;  5D73 A;  4ECI A;  1SJ6 A;  5IMA A;  16GS A;  4CDO A;  4HQZ A;  4X1U A;  2L4C A;  3C73 A;  1UC7 A;  4L0W A;  1GL8 A;  1WP0 A;  4MAB A;  3HZ8 A;  1E2Y A;  1SJZ A;  4GSN A;  5JCW A;  3GSS A;  5LCZ A;  1Z9H A;  2VAF A;  1TP9 A;  2L57 A;  1EV9 A;  2H0H A;  4PQ1 A;  2GTU A;  1BX9 A;  3FR9 A;  3DVX A;  5IMD A;  3LSZ A;  3IBH A;  2YP6 A;  2MBS A;  1ZCP A;  2OJL A;  3DVW A;  3QMX A;  3WGE A;  2G2Q A;  4ACS A;  1WRY A;  2K9F A;  3H4K A;  3HJP A;  5KN1 A;  4IBP A;  1H4O A;  1T7P B;  4YQM A;  2HE3 A;  2B7K A;  4EDZ A;  3TUE A;  1GSE A;  1XIY A;  2AUV A;  4KDX A;  1ON4 A;  2WJU A;  1W4V A;  4NHW A;  2H1D A;  2I1U A;  3ZIV A;  1ZOF A;  3UAR A;  4G10 A;  3EU4 A;  2TIR A;  1AQX A;  4ZBB A;  3TKR A;  6GSS A;  1GUL A;  4Q5N A;  4GF0 A;  3GUR A;  2OAD A;  4V1A p;  1YDK A;  22GS A;  1K3O A;  4EVM A;  4GWR A;  3A2X A;  4G9H A;  4D73 A;  5GST A;  5CYY A;  1VGL A;  1YQ1 A;  4GLT A;  4EKZ A;  5DCH A;  2V6K A;  1JFU A;  1K0A A;  5IMZ A;  4LLR A;  5DVB A;  2PN8 A;  4N11 A;  1YF1 A;  1Z5Y E;  4TRX A;  1OC8 A;  3CRT A;  2HI7 A;  2LQQ A;  2GSS A;  6GSW A;  2IME A;  2ZCT A;  4IQ1 A;  2LKU A;  1N2A A;  3ME7 A;  4IKH A;  2VCV A;  4MCU A;  2FD3 A;  4WF5 A;  1TXX A;  5DQS A;  3WYW A;  4PNF A;  5B7C A;  2RM6 A;  2LNS A;  2XBQ A;  3ED3 A;  4TVE A;  5J41 A;  2LJA A;  4KH7 A;  3IXR A;  5COH A;  3D22 A;  1TW9 A;  1F6M C;  2GDR A;  4ZL9 A;  5CRW A;  1HD2 A;  2PPT A;  1UA5 A;  5D9V A;  3US3 A;  2V2G A;  3CXG A;  3MAK A;  2TRX A;  2CX4 A;  3F8U A;  3GKM A;  3IE3 A;  2V32 A;  2CT6 A;  2GVP A;  2KP1 A;  2R3X A;  4ZXG A;  1ZGN A;  3H93 A;  4WEY A;  3DYR A;  1QMV A;  2N5F A;  3LFL A;  2DJ1 A;  1SL0 B;  5HFK A;  1FO5 A;  4DSQ A;  2YV9 A;  3WGX A;  1UVZ A;  4KCA A;  5DDL A;  3TKQ A;  1VF2 A;  2O8V B;  1QFN A;  4LMV A;  3ZIT A;  2VD0 A;  1Z7R A;  2I3Y A;  1Y6E A;  1QUW A;  1XWG A;  1NM3 A;  3HKR A;  1AC1 A;  1MDI A;  2ZNM A;  4JBB A;  2FY6 A;  4TR1 B;  1BYE A;  4YQV A;  4OWY A;  3IHQ A;  1X9S B;  2F3M A;  4IGJ A;  5CRE A;  1OC3 A;  1SYR A;  2HSY A;  1V9W A;  3IDV A;  1B48 A;  4EXJ A;  2ON5 A;  4XRD A;  4EF0 A;  3TJK A;  2B1K A;  3FRC A;  4PGT A;  2Z9S A;  4WBR D;  3GRX A;  3ZL5 A;  5GSS A;  4JE1 A;  3VI5 A;  18GS A;  3UBL A;  4MPG A;  2LS5 A;  2PU9 C;  1KBN A;  1EV4 A;  3IV4 A;  1YY7 A;  3I6A A;  4CHS A;  5HR2 A;  5DQY A;  4F2I A;  4I5Q A;  5CNW A;  5H5Q A;  3P8W A;  1B8X A;  4IW9 A;  1Z6M A;  2FWF A;  2WB9 A;  3APO A;  4ISD A;  4TR4 A;  3AY8 A;  5GZZ B;  3WGD A;  2IFQ B;  1ERU A;  2I81 A;  4POM A;  3KMO A;  3NZN A;  5J4U A;  1VF3 A;  2VCX A;  3L4N A;  2MYG A;  1PN9 A;  5IMC A;  2KP2 A;  1GUH A;  1YZX A;  3ZRE A;  4HU7 A;  4K0G A;  3KH9 A;  3D4T A;  4KW6 A;  4OCF A;  2JSZ A;  1FHE A;  4XS4 B;  3FW2 A;  1TU8 A;  4YQU A;  1Z6N A;  4F0B A;  2GGT A;  3M9K A;  2VL2 C;  2B7J A;  4XIH A;  3KTB A;  10GS A;  1Y25 A;  2C1Y A;  4K7I A;  4V2N A;  3CTF A;  4BWQ A;  1NSW A;  4WXT A;  2BJX A;  1RQM A;  5JWQ B;  2VO4 A;  2RM5 A;  3UAP A;  2C0G A;  5HR1 A;  4DVC A;  1GSQ A;  2RII A;  4HQS A;  2O7K A;  2H73 A;  4PQH A;  4NHZ A;  1OKD A;  2ES7 A;  3QAG A;  3APS A;  1EOH A;  3F6D A;  2VM2 A;  4EO3 A;  1MD3 A;  1OC9 B;  1ERW A;  3IC4 A;  2HZE B;  1SL1 B;  1A23 A;  3KTL A;  1K0N A;  2YWO A;  2C0F A;  4WR5 A;  3VLN A;  3HXS A;  2YOI A;  1OE7 A;  1A0F A;  4E8E A;  2GQM A;  2KUC A;  2H1A A;  1GSF A;  4XCS A;  1SK1 A;  1PX7 A;  2H1G A;  1FB6 A;  3D21 A;  4OD7 A;  5AGY A;  4G19 A;  3W6G A;  4GSS A;  4HI7 A;  1URM A;  1LJR A;  4OCE A;  4XRA A;  1NHY A;  2L4Q A;  5ECS A;  4IP1 A;  2YAN A;  3DWV A;  2H74 A;  4YAP A;  2D2Z A;  3KP8 A;  1GNW A;  3LJR A;  2DLX A;  1G7E A;  4I2U A;  5LNK e;  4Q5Q A;  1PKW A;  4ZIJ A;  1X5D A;  4L8E A;  3Q19 A;  3F3R A;  3M9J A;  4P3Y B;  2PWJ A;  3RBT A;  3M8N A;  1PRX A;  4K6X A;  2XHF A;  3U6V A;  1GLP A;  1K0C A;  4PQI A;  4FIW A;  3DGQ A; 
#chains in the Genus database with same CATH topology
 4POB A;  5J5N A;  3CMI A;  6GST A;  1DSB A;  1JZW A;  1XVQ A;  3WT2 A;  8GSS A;  1JHB A;  1GSD A;  2IMI A;  2JZT A;  5ECH B;  4RQR A;  2LRN A;  1VF1 A;  4QQ7 A;  4ZL8 A;  2GZY A;  3IK7 A;  4AF2 A;  3TRX A;  2MZC A;  3F4T A;  3GKK A;  3QAV A;  2HSH A;  1V98 A;  1XZO A;  2NBS A;  1AQV A;  1A24 A;  1ERT A;  2YWM A;  3H8Q A;  4K7O A;  4WR4 A;  3VWW A;  2JL4 A;  4ECC A;  2YWN A;  2H75 A;  1FAA A;  5IOW A;  2B5E A;  1G0T A;  1FB0 A;  1R5P A;  11GS A;  5DAL A;  3TKS C;  4LL1 B;  2FHE A;  2R4V A;  3OR5 A;  3O76 A;  4JR4 A;  3E9J B;  3C1R A;  4H86 A;  1BJX A;  2PBJ A;  5J9C A;  2VIM A;  5A4W A;  3L9U A;  1PKZ A;  1YEX A;  2X64 A;  3HA9 A;  4MH2 A;  2O89 A;  4KCE A;  3ZTL A;  3IK9 A;  1EEM A;  2AAW A;  4I8B A;  3GMF A;  4JU5 A;  2CA8 A;  3EWL A;  4MF5 A;  4Z2U A;  4AJ7 A;  2VL3 A;  2VM1 A;  1W89 A;  5A4V A;  1TK8 B;  4KB3 A;  2HZF A;  3GV1 A;  1ST9 A;  19GS A;  2WUL A;  4LMW A;  5E4W A;  3FHK A;  5ABR A;  2R37 A;  2F51 A;  1QK8 A;  2DJ0 A;  3K8N A;  1GTB A;  1AW9 A;  2J23 A;  3HJO A;  2BMX A;  3LYP A;  2GSQ A;  2HRF A;  3CSJ A;  4JRR A;  4IEL A;  1USB A;  1R7H A;  1J0F A;  3A2V A;  3LQ7 A;  1FVK A;  4K2D A;  2NTO A;  2EIR A;  5CRD A;  1EWX A;  2LTK A;  2YCD A;  2VD1 A;  4ML6 A;  3CSH A;  2I9H A;  1T8E B;  1WPI A;  1TU7 A;  3L9S A;  2H01 A;  3PGT A;  2GS3 A;  3APQ A;  3IA1 A;  2VCQ A;  3GIX A;  5ECI B;  4WET A;  5FWG A;  3W8J A;  4NWY A;  2H6Y A;  17GS A;  2DJ3 A;  1X9W B;  2JAD A;  1HNA A;  3IPZ A;  1SD8 A;  2DIY A;  5G1K A;  3KH7 A;  4Z7X A;  1F3A A;  1OVN A;  3ZIJ A;  3PH9 A;  1MD4 A;  1UN2 A;  2H0I A;  4O7H A;  1B9Y C;  2HRK A;  1V2A A;  1MDK A;  2RLI A;  5AIS A;  1IYI A;  2DSA A;  1WE0 A;  5B8A A;  4HSC X;  1MEK A;  4BL7 A;  4J2F A;  3UOM A;  3KMN A;  3LGC A;  2GT6 A;  2VOC A;  2DKI A;  2X8C A;  1YF0 A;  5H5R A;  2IMF A;  3QR6 A;  4HJM A;  3MYD A;  3NOF A;  5AN1 A;  1EP7 A;  4JZQ A;  5IQY A;  3GA4 A;  4RI7 A;  2GST A;  3QDN A;  3LG6 A;  5CO3 A;  1BG5 A;  3S9F A;  2QGV A;  5ECP B;  3VWX A;  4G2E A;  3EUR A;  3A3T A;  4PTS A;  4WF4 A;  3EC3 A;  4GXZ A;  3FZ5 A;  2HRA A;  4TOP A;  3PR8 A;  2IWT A;  3A5I A;  1XWK A;  3G7Y A;  3CSI A;  1SYX A;  1TKD B;  1ML6 A;  1WOU A;  3HVN A;  5ECM B;  1GUK A;  1PX6 A;  5C04 A;  1F2E A;  2L5O A;  4MZW A;  2H30 A;  1S3A A;  2P5R A;  4MJE A;  14GS A;  3TKP A;  1S3D A;  2CAI A;  3ZMK A;  3VWU A;  2OE3 A;  4MH3 A;  2VLT A;  4PNG A;  5DJL A;  5ECR B;  3DD3 A;  1JZR A;  3TRP A;  3KP9 A;  2V41 A;  3VPQ A;  4ICY A;  5D9T A;  4MA9 A;  1SL2 B;  2XC2 A;  4K0N A;  2WDU A;  3ERF A;  4KF9 A;  1XOA A;  1ERV A;  1RK4 A;  2FGX A;  2DBC A;  2HYX A;  4IJ3 A;  2CVK A;  5DJM A;  3TJF A;  5IO2 A;  4KUN A;  4EIQ A;  1SU9 A;  2VCW A;  4Q5R A;  1N8J A;  3TRQ A;  3GKN A;  4O5R A;  4HUA A;  3KZQ A;  1PMT A;  5CP1 A;  1AAZ A;  4AJ8 A;  2N5A A;  1GLQ A;  1HYU A;  3LOR A;  3EVI A;  3FR3 A;  5CAX A;  2LRC A;  2OBK A;  5AIV A;  4N10 A;  2CVD A;  5ECL B;  4AGS A;  3IC8 A;  1EZK A;  3EIN A;  3WD6 A;  4DSS A;  1OYJ A;  3O6T A;  4CY8 A;  4N30 A;  4RQX A;  1GUM A;  3QFA C;  2DML A;  1AUC A;  2QSI A;  4QL7 A;  1QQ2 A;  4V2M A;  4K5R A;  2XPD A;  4PXO A;  2F8F A;  2CZ3 A;  1B4P A;  2OKA A;  1LU4 A;  1H75 A;  3Q74 A;  4YH2 A;  4TW5 A;  3CYN A;  2YPM A;  2H1B A;  1SK0 A;  3KEB A;  3QFB C;  4POL A;  1A0R P;  4MK3 A;  3ZML A;  2VLU A;  5DCG A;  2FA8 A;  3H79 A;  4MDC A;  1S3C A;  2O87 A;  4XHM A;  4K7N A;  5JCU A;  4OFN A;  5G30 A;  4LA1 A;  5IM9 A;  2CAQ A;  1I9D A;  2HXK A;  1FVJ A;  1O73 A;  2A2S A;  5IMF A;  4ZIL A;  1GRX A;  2C0E A;  1PL1 A;  1K0D A;  3TOT A;  3W8S A;  5FHI A;  4CW9 A;  2RUF A;  2OE1 A;  4J57 E;  3BBY A;  4IS0 A;  2IN3 A;  4DEJ A;  3V1W A;  2OE0 A;  1XPV A;  2K8S A;  3HCZ A;  4TR0 A;  5IPH A;  2L59 A;  2DC5 A;  2R2J A;  3ZFB A;  4TXV A;  1KNG A;  1JZD A;  3J7Y k;  2OAC A;  1KEB A;  2EIQ A;  2QA1 A;  3LEF A;  3GYK A;  4X0X A;  5G5E A;  2X99 A;  1BAY A;  2DJ2 A;  5BMU A;  9GSS A;  5KOX A;  2GSR A;  1AXD A;  2CQ9 A;  3BOA A;  3ERW A;  1ZMA A;  1AIU A;  3KM6 A;  1NHO A;  4YAV A;  4BIK A;  2ZUP A;  3FEU A;  3GL3 A;  1A8Y A;  4EIP A;  3I43 A;  1DUG A;  3IRA A;  4TR1 A;  5ELA A;  4PX1 A;  5ID2 B;  4KE3 A;  2A4V A;  3HY2 A;  3FZA A;  3ME8 A;  4ZL7 A;  4MLY A;  5DBQ A;  3UVT A;  3ZVJ D;  1WMJ A;  2CX3 A;  2EIO A;  1A2L A;  1M99 A;  1X5C A;  1CQG A;  3UL3 A;  3BCI A;  2A2P A;  2GZP A;  2M80 A;  3UEM A;  2B5Y A;  3I69 A;  1AQW A;  2G0F A;  2MMZ A;  3JCM L;  5INY A;  3CTG A;  3M0F A;  3GTU A;  1OE8 A;  1I5G A;  3M1G A;  2FCH A;  5C00 A;  1M9B A;  5F8B A;  1X0R A;  1YJ6 A;  1A8L A;  1XVW A;  3TCO A;  2H0G A;  4KSO A;  2P0G A;  2WRT A;  5B8B A;  3HVV A;  1U3I A;  3TB2 A;  3F4R A;  1A2J A;  2X8G A;  4LL4 B;  3RAZ A;  3VUR A;  3M3M A;  5D9X A;  2M72 A;  4OO4 A;  3D0Z A;  4Z2R A;  4FYC A;  1Q98 A;  3Q18 A;  2MMN A;  3DIE A;  3EU3 A;  1WJK A;  3TDG A;  5DAL B;  1PA3 A;  3VWV A;  1HNC A;  2WCI A;  4KX4 A;  5AIX A;  5GAP D;  2PGT A;  5JWO B;  5ECQ B;  5IOX A;  1TRS A;  3GX0 A;  3VI7 A;  1TRV A;  4PUA A;  2IL3 A;  2NPB A;  4K1F A;  1T00 A;  4O5U A;  1BED A;  5HFI A;  4XTS A;  1ILO A;  4KA0 A;  3E0U A;  4F82 A;  3O3T A;  3FZ9 A;  4ZB6 A;  2AB6 A;  2ON7 A;  1DE2 A;  3HVS A;  5G5F A;  3L78 A;  3SBC A;  1F9M A;  2KOK A;  4GST A;  7GSS A;  1V40 A;  3P90 A;  4TN8 A;  4PUR A;  1EGO A;  2WGR A;  4NV2 A;  5G1L A;  1G6Y A;  4DSR A;  2M46 A;  2XPE A;  1T1V A;  4ULX A;  4HDE A;  2DMM A;  5A5K A;  4JED A;  3UMA A;  3GH9 A;  1K0M A;  1GSS A;  2A4H A;  2HSM A;  5D9W A;  4ID0 A;  1Z7P A;  4ZB9 A;  2JAC A;  2KLX A;  2GQL A;  2VL9 A;  1SKR B;  1Q4J A;  4D73 B;  5DAK A;  4PUF C;  1HNB A;  1TI3 A;  1XWB A;  1THX A;  4F03 A;  4WKW A;  3VPT A;  4BL7 B;  1O8X A;  2YNX A;  5CRG A;  3F3Q A;  4MJC A;  3ZLP A;  5ELG A;  3TJJ A;  3C8E A;  3DML A;  1XXU A;  6GSX A;  4TKY A;  4BVX A;  3D5J A;  3RDW A;  6GSV A;  5EVO A;  3UBK A;  1XW5 A;  2PVO C;  2WFC A;  1F37 A;  2CV4 A;  2R6K A;  1XBS A;  3EMP A;  2RUE A;  3BJ5 A;  4MJB A;  2HT9 A;  2XBI A;  1VF4 A;  4K9Z A;  2NVL A;  1G7O A;  3ZRD A;  2IPA A;  3U5R E;  12GS A;  1XW6 A;  2FWH A;  1M2D A;  5KEJ A;  1QXH A;  3HDC A;  4EL1 A;  2H70 A;  1RW1 A;  1QGV A;  3DKS A;  1O85 A;  2AYT A;  1XW9 A;  3QD9 A;  5LD0 A;  2E0Q A;  3HD5 A;  2YJ7 A;  4HEA 2;  2C4J A;  2C3N A;  4TXO A;  2HLS A;  3SWL A;  2OBI A;  1XOB A;  4F0C A;  4E8H A;  3C7M A;  4HS1 A;  2YN1 A;  4ML1 A;  1GSY A;  3F6F A;  1ZYE A;  2GT5 A;  2REM A;  2HRN A;  2TRC P;  1K3L A;  4WBJ A;  2FNO A;  1R5A A;  4Q5F A;  1O8W A;  3G7J A;  2V1M A;  1PSQ A;  3C1S A;  2MMA A;  3BCK A;  3DXB A;  5IMV A;  3R3E A;  3A5W A;  2PER A;  3EPT A;  1DE1 A;  2V6O A;  1M2A A;  3KXO A;  2VLV A;  4FYB A;  1EP8 A;  4MZC A;  4IJI A;  3P2A A;  2AV4 A;  2QC7 A;  3ZFL A;  2DIZ A;  2P31 A;  4MMM A;  1ZYP A;  2FWE A;  4GQF A;  5F05 A;  3TKS A;  1U6T A;  4MZB A;  3GFK A;  1BQ7 A;  3GUS A;  5HFG A;  1X9M B;  1O81 A;  4FQU A;  5ECK B;  4HZ4 A;  2DJK A;  3UJ1 A;  3F9U A;  4DSS B;  3HYP A;  2YV7 A;  5D96 A;  2QKE A;  3L0H A;  3Q6O A;  3FY7 A;  3BD2 A;  4L0U A;  3GNJ A;  3GHA A;  1MDJ A;  3HHV A;  6GSU A;  1F3B A;  2H66 A;  2F9S A;  4ILF A;  4OO5 A;  1ACV A;  3RHB A;  3FZ4 A;  3FKF A;  4K2X A;  5IO0 A;  5CRH A;  5F0G A;  3IAM 2;  3IAS 2;  3RHC A;  1M7T A;  2LST A;  2YWI A;  2H76 A;  5L71 A;  2JU5 A;  3UIW A;  5JCG A;  3VK9 A;  2HFD A;  1OKT A;  1Z3E A;  1ZZY A;  3EE2 A;  3MSZ A;  4GRF A;  1O7U A;  4MPF A;  2AJQ B;  2C0D A;  3KIJ A;  1K0B A;  4NAX A;  1YEP A;  3ZYW A;  5EPF A;  2B5X A;  4FO5 A;  4IP6 A;  5H5S A;  2K6V A;  4HOJ A;  4AJ6 A;  4X43 A;  4EE0 A;  2H6X A;  4NV5 A;  2MBT A;  1TRU A;  3MWH A;  3LXT A;  2KHP A;  4ZBA A;  3CQF A;  3FK8 A;  3ZZX A;  4POK A;  4ZBD A;  2IIY A;  2P5Q A;  4EC0 A;  3QOU A;  3N9J A;  1T3B A;  2GLR A;  1MTC A;  1OAZ A;  5J3R A;  1TK5 B;  3EMX A;  2CVB A;  4O92 A;  5BRT A;  4O32 A;  2GQK A;  1XWC A;  2LEG A;  1G6W A;  1EGR A;  4G0K A;  5J9B A;  1TRW A;  5IPG A;  4RUV A;  3N5O A;  2A2R A;  1X5E A;  5ENU A;  4L5L A;  2C80 A;  3ISO A;  4BPY A;  2VCZ A;  2IJY A;  2K18 A;  4KND A;  4KGI A;  5KN0 A;  1PD2 1;  2YZU A;  1SJI A;  3F4S A;  3VFI A;  5ECN B;  3I9V 2;  1GTI A;  1XFL A;  2B1L A;  1PQN A;  2VCT A;  4HZ2 A;  2K8V A;  3IR4 A;  3GTU B;  4QL9 A;  3F0I A;  2H71 A;  4V2L A;  4A5P A;  2IMD A;  4BVY A;  5EL8 A;  3CBU A;  3TGZ A;  3L9V A;  2CZ2 A;  5ECO B;  4TR3 A;  4N0V A;  3GKX A;  3GX8 A;  1ABA A;  1TJD A;  1SEN A;  1EOG A;  3MIX A;  3G9B A;  4KSM A;  4BA7 A;  3HJM A;  4K8M A;  4MF6 A;  3TOU A;  1O6J A;  3FMW A;  2WZ9 A;  3R2Q A;  2FLS A;  3TJG A;  1GTA A;  2L6C A;  1JLV A;  5KN2 A;  2OA7 A;  4KDY A;  2MMO A;  3KJY A;  3A2W A;  4MJA A;  3IOS A;  2FA4 A;  2X8H A;  1HQO A;  13GS A;  5EY6 A;  1TTZ A;  1THO A;  4YKF A;  3GST A;  2H72 A;  1TI1 A;  1TDI A;  3TJB A;  2O85 A;  2LJK A;  4NXI A;  2JZR A;  3CRU A;  2LUS A;  5KN3 A;  2EC4 A;  5D93 A;  1E6B A;  3D4M A;  5A4U A;  3HVX A;  1S3R A;  5JWR B;  2GZZ A;  1R4W A;  1JZO A;  2FUG 2;  2L6D A;  4IQA A;  4MF7 A;  3DEX A;  2FWG A;  2UZ8 A;  1FOH A;  1SK2 A;  1GNE A;  2IMK A;  2QA2 A;  1M0U A;  2E7P A;  1WWJ A;  3DRN A;  4IN0 A;  1T4Y A;  4MP4 A;  2AHE A;  1ZYQ B;  2B3S A;  3ZVJ A;  3D6I A;  5HR0 A;  3HZ4 A;  3ERG A;  3C71 A;  3RPN A;  2J9H A;  4HU9 A;  4J56 E;  6GSY A;  2LNT A;  3NIV A;  3H1N A;  1A2M A;  1GP1 A;  1M3J A;  3LXZ A;  1SKW B;  1GWC A;  1SD9 A;  5FT3 A;  4V1A g;  3KGK A;  3KCM A;  1WIK A;  1FOV A;  2VUP A;  1CQH A;  1XWA A;  3QCP A;  4RI6 A;  1C72 A;  5B6M A;  1M9A A;  4GCI A;  5DAK B;  1XCC A;  3MDK A;  3PIN A;  1B4Q A;  3KD0 A;  3GN3 A;  4IHU A;  2IFQ A;  3QPM A;  1ZL9 A;  1YKA A;  1GTU A;  3G7I A;  4ECB A;  2PVQ A;  2LQO A;  2R0P A;  1T4Z A;  2JSY A;  3QAW A;  2R5G A;  5E59 A;  2H19 A;  4BVX B;  4BWS A;  1U3A A;  1V58 A;  5D8I A;  2ALB A;  2LV3 A;  3E3E A;  1DBY A;  5G2Z A;  3J7Y b;  2B6M A;  3MNG A;  4XS4 A;  5B6N A;  4G0L A;  3P7X A;  4X4J A;  2VL2 A;  5HQP A;  2C3T A;  1TOF A;  4GQC A;  2DJJ A;  1K3Y A;  2BTO T;  2JZS A;  4GTU A;  1JLW A;  1U88 A;  4I2T A;  1KTE A;  2PMT A;  3LYK A;  4N0Z A;  3F63 A;  5HR3 A;  5ID2 A;  3GH6 A;  2YJH A;  4EUY A;  1GSU A;  2C8U A;  4ECJ A;  3RPP A;  20GS A;  4F9Z A;  4NMU A;  3UVH A;  2L5L A;  2X4A A;  2C3Q A;  2F8A A;  1IYH A;  1FG4 A;  4TXO B;  1J08 A;  1B9X C;  5F06 A;  2H6Z A;  2E2M A;  4OFT A;  4IVF A;  1J9B A;  2LJR A;  2E2G A;  3FR6 A;  3FYG A;  5IIZ A;  5G31 A;  1SKS B;  4XS1 A;  3GL5 A;  1OC9 A;  1YKC A;  4OFM A;  2HZE A;  1R26 A;  4KAE A;  4OMV A;  2HNL A;  5GAN D;  1XG8 A;  4HJ2 A;  3EYT A;  4KDU A;  4FYU A;  1V57 A;  4I97 A;  1EEJ A;  4FH8 A;  2NDO A;  1K0O A;  4XS6 A;  1LBK A;  4I6X A;  4L5O A;  1PL2 A;  1VRS D;  2H8L A;  1ZYN A;  1TK0 B;  1PGT A;  2LRT A;  2WS2 A;  4EDY A;  1GH2 A;  4ZB8 A;  2I4A A;  4JR6 A;  2YZH A;  2R0G A;  1U87 A;  2N5B A;  1M2B A;  3TKS E;  2PUK C;  3LWA A;  4NPB A;  1FW1 A;  1NW2 A;  5F07 A;  3WT1 A;  5D73 A;  4ECI A;  4Z2T A;  1SJ6 A;  5IMA A;  16GS A;  4CDO A;  4HQZ A;  4X1U A;  2L4C A;  3C73 A;  1UC7 A;  4L0W A;  1GL8 A;  1WP0 A;  1PFO A;  4MAB A;  3HZ8 A;  1E2Y A;  1SJZ A;  4GSN A;  5JCW A;  3GSS A;  5LCZ A;  1PN0 A;  1Z9H A;  2VAF A;  1TP9 A;  2L57 A;  1EV9 A;  2H0H A;  4PQ1 A;  5KOW A;  2GTU A;  1BX9 A;  3FR9 A;  3DVX A;  5IMD A;  4YKG A;  3LSZ A;  3IBH A;  2YP6 A;  2MBS A;  1ZCP A;  2OJL A;  3DVW A;  3QMX A;  3WGE A;  2G2Q A;  4ACS A;  1WRY A;  2K9F A;  3H4K A;  3HJP A;  5KN1 A;  4IBP A;  1H4O A;  4G0I A;  1T7P B;  4YQM A;  2HE3 A;  2B7K A;  4EDZ A;  3TUE A;  1GSE A;  1XIY A;  2AUV A;  4KDX A;  1ON4 A;  2WJU A;  1W4V A;  4NHW A;  2H1D A;  2I1U A;  3ZIV A;  1ZOF A;  3UAR A;  4G10 A;  3EU4 A;  2TIR A;  1AQX A;  4ZBB A;  3TKR A;  6GSS A;  1GUL A;  4Q5N A;  4GF0 A;  3GUR A;  2OAD A;  4V1A p;  1YDK A;  22GS A;  1K3O A;  4EVM A;  4GWR A;  3A2X A;  4G9H A;  4D73 A;  5GST A;  5CYY A;  1VGL A;  1YQ1 A;  4GLT A;  4EKZ A;  5DCH A;  2V6K A;  1JFU A;  1K0A A;  5IMZ A;  4LLR A;  5DVB A;  2PN8 A;  4N11 A;  1YF1 A;  1Z5Y E;  4TRX A;  1OC8 A;  3CRT A;  4USS A;  2HI7 A;  2LQQ A;  2GSS A;  6GSW A;  2IME A;  2ZCT A;  4IQ1 A;  2LKU A;  1N2A A;  3ME7 A;  4IKH A;  2VCV A;  4MCU A;  2FD3 A;  4WF5 A;  1TXX A;  5DQS A;  3WYW A;  4PNF A;  5B7C A;  2RM6 A;  2LNS A;  2XBQ A;  3ED3 A;  4TVE A;  4BVY B;  5J41 A;  2LJA A;  4KH7 A;  3IXR A;  5COH A;  3D22 A;  1TW9 A;  1F6M C;  2GDR A;  4ZL9 A;  5CRW A;  1HD2 A;  2PPT A;  1UA5 A;  5D9V A;  3US3 A;  2V2G A;  3CXG A;  3MAK A;  2TRX A;  2CX4 A;  3F8U A;  3GKM A;  3IE3 A;  2V32 A;  2CT6 A;  2X49 A;  2GVP A;  2KP1 A;  2R3X A;  4ZXG A;  1ZGN A;  3H93 A;  4WEY A;  3DYR A;  1QMV A;  2N5F A;  3LFL A;  2DJ1 A;  1SL0 B;  5HFK A;  1FO5 A;  4DSQ A;  2YV9 A;  3WGX A;  1UVZ A;  4KCA A;  5DDL A;  3TKQ A;  1VF2 A;  2O8V B;  1QFN A;  4LMV A;  3ZIT A;  2VD0 A;  1Z7R A;  2I3Y A;  1Y6E A;  1QUW A;  1XWG A;  1NM3 A;  3HKR A;  1AC1 A;  1MDI A;  2ZNM A;  4JBB A;  2FY6 A;  1M3I A;  4TR1 B;  1BYE A;  4YQV A;  4OWY A;  3IHQ A;  1X9S B;  2F3M A;  4IGJ A;  5CRE A;  1OC3 A;  1SYR A;  2HSY A;  1V9W A;  3IDV A;  1B48 A;  4EXJ A;  2ON5 A;  4XRD A;  4EF0 A;  3TJK A;  2B1K A;  3FRC A;  4PGT A;  2Z9S A;  4WBR D;  2DKH A;  3GRX A;  3ZL5 A;  5GSS A;  4JE1 A;  3VI5 A;  18GS A;  3UBL A;  4MPG A;  2LS5 A;  3LW9 A;  2PU9 C;  1KBN A;  1EV4 A;  3IV4 A;  1YY7 A;  3I6A A;  4CHS A;  5HR2 A;  5DQY A;  4F2I A;  4I5Q A;  5CNW A;  5H5Q A;  3IHG A;  3P8W A;  1B8X A;  4IW9 A;  1Z6M A;  2FWF A;  2WB9 A;  4MNN A;  3APO A;  4ISD A;  4TR4 A;  3AY8 A;  5GZZ B;  3WGD A;  2IFQ B;  1ERU A;  2I81 A;  4POM A;  3KMO A;  3NZN A;  2R0C A;  5J4U A;  1VF3 A;  2VCX A;  3L4N A;  2MYG A;  1PN9 A;  5IMC A;  2KP2 A;  1GUH A;  1YZX A;  3ZRE A;  4HU7 A;  4K0G A;  3KH9 A;  3D4T A;  4KW6 A;  4OCF A;  2JSZ A;  1FHE A;  4XS4 B;  3FW2 A;  1TU8 A;  4YQU A;  1Z6N A;  4F0B A;  4K5S A;  2GGT A;  3M9K A;  2VL2 C;  2B7J A;  4XIH A;  4CY6 A;  3KTB A;  10GS A;  1Y25 A;  2C1Y A;  4K7I A;  4V2N A;  3CTF A;  4BWQ A;  1NSW A;  4WXT A;  2BJX A;  1RQM A;  5JWQ B;  2VO4 A;  2RM5 A;  3UAP A;  2C0G A;  5HR1 A;  4DVC A;  1GSQ A;  2RII A;  4HQS A;  2O7K A;  2H73 A;  4PQH A;  4O5Q A;  4NHZ A;  1OKD A;  2ES7 A;  3QAG A;  3APS A;  1EOH A;  3F6D A;  2VM2 A;  4EO3 A;  1MD3 A;  1OC9 B;  1ERW A;  3IC4 A;  2HZE B;  1SL1 B;  1A23 A;  3KTL A;  1K0N A;  2YWO A;  2C0F A;  4WR5 A;  3VLN A;  3HXS A;  2YOI A;  1OE7 A;  1A0F A;  4E8E A;  2GQM A;  2KUC A;  2H1A A;  1GSF A;  4XCS A;  1SK1 A;  1PX7 A;  2H1G A;  1FB6 A;  3D21 A;  4OD7 A;  5AGY A;  4G19 A;  3W6G A;  4GSS A;  4HI7 A;  1URM A;  1LJR A;  4OCE A;  4XRA A;  1NHY A;  2L4Q A;  4IP1 A;  5ECS A;  2YAN A;  3DWV A;  2H74 A;  4YAP A;  2D2Z A;  3KP8 A;  1GNW A;  3LJR A;  2DLX A;  1G7E A;  4I2U A;  5LNK e;  4Q5Q A;  3PPU A;  1PKW A;  4ZIJ A;  1X5D A;  4L8E A;  3Q19 A;  3F3R A;  3M9J A;  4P3Y B;  2PWJ A;  3RBT A;  3M8N A;  1PRX A;  4K6X A;  2XHF A;  3U6V A;  1GLP A;  1K0C A;  4PQI A;  4FIW A;  3DGQ A; 
#chains in the Genus database with same CATH homology
 4POB A;  5J5N A;  3CMI A;  6GST A;  1DSB A;  1JZW A;  1XVQ A;  3WT2 A;  8GSS A;  1JHB A;  1GSD A;  2IMI A;  2JZT A;  5ECH B;  4RQR A;  2LRN A;  1VF1 A;  4QQ7 A;  4ZL8 A;  2GZY A;  3IK7 A;  4AF2 A;  3TRX A;  2MZC A;  3F4T A;  3GKK A;  3QAV A;  2HSH A;  1V98 A;  1XZO A;  2NBS A;  1AQV A;  1A24 A;  1ERT A;  2YWM A;  3H8Q A;  4K7O A;  4WR4 A;  3VWW A;  2JL4 A;  4ECC A;  2YWN A;  2H75 A;  1FAA A;  5IOW A;  2B5E A;  1G0T A;  1FB0 A;  1R5P A;  11GS A;  5DAL A;  3TKS C;  4LL1 B;  2FHE A;  2R4V A;  3OR5 A;  3O76 A;  4JR4 A;  3E9J B;  3C1R A;  4H86 A;  1BJX A;  2PBJ A;  5J9C A;  2VIM A;  5A4W A;  3L9U A;  1PKZ A;  1YEX A;  2X64 A;  3HA9 A;  4MH2 A;  2O89 A;  4KCE A;  3ZTL A;  3IK9 A;  1EEM A;  2AAW A;  4I8B A;  3GMF A;  4JU5 A;  2CA8 A;  3EWL A;  4MF5 A;  4Z2U A;  4AJ7 A;  2VL3 A;  2VM1 A;  1W89 A;  5A4V A;  1TK8 B;  4KB3 A;  2HZF A;  3GV1 A;  1ST9 A;  19GS A;  2WUL A;  4LMW A;  5E4W A;  3FHK A;  5ABR A;  2R37 A;  2F51 A;  1QK8 A;  2DJ0 A;  3K8N A;  1GTB A;  1AW9 A;  2J23 A;  3HJO A;  2BMX A;  3LYP A;  2GSQ A;  2HRF A;  3CSJ A;  4JRR A;  4IEL A;  1USB A;  1R7H A;  1J0F A;  3A2V A;  3LQ7 A;  1FVK A;  4K2D A;  2NTO A;  2EIR A;  5CRD A;  1EWX A;  2LTK A;  2YCD A;  2VD1 A;  4ML6 A;  3CSH A;  2I9H A;  1T8E B;  1WPI A;  1TU7 A;  3L9S A;  2H01 A;  3PGT A;  2GS3 A;  3APQ A;  3IA1 A;  2VCQ A;  3GIX A;  5ECI B;  4WET A;  5FWG A;  3W8J A;  4NWY A;  2H6Y A;  17GS A;  2DJ3 A;  1X9W B;  2JAD A;  1HNA A;  3IPZ A;  1SD8 A;  2DIY A;  5G1K A;  3KH7 A;  4Z7X A;  1F3A A;  1OVN A;  3ZIJ A;  3PH9 A;  1MD4 A;  1UN2 A;  2H0I A;  4O7H A;  1B9Y C;  2HRK A;  1V2A A;  1MDK A;  2RLI A;  5AIS A;  1IYI A;  2DSA A;  1WE0 A;  5B8A A;  1MEK A;  4BL7 A;  4J2F A;  3UOM A;  3KMN A;  3LGC A;  2GT6 A;  2VOC A;  2DKI A;  2X8C A;  1YF0 A;  5H5R A;  2IMF A;  3QR6 A;  4HJM A;  3MYD A;  3NOF A;  5AN1 A;  1EP7 A;  4JZQ A;  5IQY A;  3GA4 A;  4RI7 A;  2GST A;  3QDN A;  3LG6 A;  5CO3 A;  1BG5 A;  3S9F A;  2QGV A;  5ECP B;  3VWX A;  4G2E A;  3EUR A;  3A3T A;  4PTS A;  4WF4 A;  3EC3 A;  4GXZ A;  3FZ5 A;  2HRA A;  4TOP A;  3PR8 A;  2IWT A;  3A5I A;  1XWK A;  3G7Y A;  3CSI A;  1SYX A;  1TKD B;  1ML6 A;  1WOU A;  5ECM B;  1GUK A;  1PX6 A;  5C04 A;  1F2E A;  2L5O A;  4MZW A;  2H30 A;  1S3A A;  2P5R A;  4MJE A;  14GS A;  3TKP A;  1S3D A;  2CAI A;  3ZMK A;  3VWU A;  2OE3 A;  4MH3 A;  2VLT A;  4PNG A;  5DJL A;  5ECR B;  3DD3 A;  1JZR A;  3TRP A;  3KP9 A;  2V41 A;  3VPQ A;  4ICY A;  5D9T A;  4MA9 A;  1SL2 B;  2XC2 A;  4K0N A;  2WDU A;  3ERF A;  4KF9 A;  1XOA A;  1ERV A;  1RK4 A;  2FGX A;  2DBC A;  2HYX A;  4IJ3 A;  2CVK A;  5DJM A;  3TJF A;  5IO2 A;  4KUN A;  4EIQ A;  1SU9 A;  2VCW A;  4Q5R A;  1N8J A;  3TRQ A;  3GKN A;  4O5R A;  4HUA A;  3KZQ A;  1PMT A;  5CP1 A;  1AAZ A;  4AJ8 A;  2N5A A;  1GLQ A;  1HYU A;  3LOR A;  3EVI A;  3FR3 A;  5CAX A;  2LRC A;  2OBK A;  5AIV A;  4N10 A;  2CVD A;  5ECL B;  4AGS A;  3IC8 A;  1EZK A;  3EIN A;  3WD6 A;  4DSS A;  1OYJ A;  3O6T A;  4CY8 A;  4N30 A;  4RQX A;  1GUM A;  3QFA C;  2DML A;  1AUC A;  2QSI A;  4QL7 A;  1QQ2 A;  4V2M A;  4K5R A;  2XPD A;  4PXO A;  2F8F A;  2CZ3 A;  1B4P A;  2OKA A;  1LU4 A;  1H75 A;  3Q74 A;  4YH2 A;  4TW5 A;  3CYN A;  2YPM A;  2H1B A;  1SK0 A;  3KEB A;  3QFB C;  4POL A;  1A0R P;  4MK3 A;  3ZML A;  2VLU A;  5DCG A;  2FA8 A;  3H79 A;  4MDC A;  1S3C A;  2O87 A;  4XHM A;  4K7N A;  5JCU A;  4OFN A;  5G30 A;  4LA1 A;  5IM9 A;  2CAQ A;  1I9D A;  2HXK A;  1FVJ A;  1O73 A;  2A2S A;  5IMF A;  4ZIL A;  1GRX A;  2C0E A;  1PL1 A;  1K0D A;  3TOT A;  3W8S A;  5FHI A;  4CW9 A;  2RUF A;  2OE1 A;  4J57 E;  3BBY A;  4IS0 A;  2IN3 A;  4DEJ A;  3V1W A;  2OE0 A;  1XPV A;  2K8S A;  3HCZ A;  4TR0 A;  5IPH A;  2L59 A;  2DC5 A;  2R2J A;  3ZFB A;  4TXV A;  1KNG A;  1JZD A;  3J7Y k;  2OAC A;  1KEB A;  2EIQ A;  2QA1 A;  3LEF A;  3GYK A;  4X0X A;  5G5E A;  2X99 A;  1BAY A;  2DJ2 A;  5BMU A;  9GSS A;  5KOX A;  2GSR A;  1AXD A;  2CQ9 A;  3BOA A;  3ERW A;  1ZMA A;  1AIU A;  3KM6 A;  1NHO A;  4YAV A;  2ZUP A;  3FEU A;  3GL3 A;  1A8Y A;  4EIP A;  3I43 A;  1DUG A;  3IRA A;  4TR1 A;  5ELA A;  4PX1 A;  5ID2 B;  4KE3 A;  2A4V A;  3HY2 A;  3FZA A;  3ME8 A;  4ZL7 A;  4MLY A;  5DBQ A;  3UVT A;  3ZVJ D;  1WMJ A;  2CX3 A;  2EIO A;  1A2L A;  1M99 A;  1X5C A;  1CQG A;  3UL3 A;  3BCI A;  2A2P A;  2GZP A;  2M80 A;  3UEM A;  2B5Y A;  3I69 A;  1AQW A;  2G0F A;  2MMZ A;  3JCM L;  5INY A;  3CTG A;  3M0F A;  3GTU A;  1OE8 A;  1I5G A;  3M1G A;  2FCH A;  5C00 A;  1M9B A;  5F8B A;  1X0R A;  1YJ6 A;  1A8L A;  1XVW A;  3TCO A;  2H0G A;  4KSO A;  2P0G A;  2WRT A;  5B8B A;  3HVV A;  1U3I A;  3TB2 A;  3F4R A;  1A2J A;  2X8G A;  4LL4 B;  3RAZ A;  3VUR A;  3M3M A;  5D9X A;  2M72 A;  4OO4 A;  3D0Z A;  4Z2R A;  4FYC A;  1Q98 A;  3Q18 A;  2MMN A;  3DIE A;  3EU3 A;  1WJK A;  3TDG A;  5DAL B;  1PA3 A;  3VWV A;  1HNC A;  2WCI A;  4KX4 A;  5AIX A;  5GAP D;  2PGT A;  5JWO B;  5ECQ B;  5IOX A;  1TRS A;  3GX0 A;  3VI7 A;  1TRV A;  4PUA A;  2IL3 A;  2NPB A;  4K1F A;  1T00 A;  4O5U A;  1BED A;  5HFI A;  4XTS A;  1ILO A;  4KA0 A;  3E0U A;  4F82 A;  3O3T A;  3FZ9 A;  4ZB6 A;  2AB6 A;  2ON7 A;  1DE2 A;  3HVS A;  5G5F A;  3L78 A;  3SBC A;  1F9M A;  2KOK A;  4GST A;  7GSS A;  1V40 A;  3P90 A;  4TN8 A;  4PUR A;  1EGO A;  2WGR A;  4NV2 A;  5G1L A;  1G6Y A;  4DSR A;  2M46 A;  2XPE A;  1T1V A;  4ULX A;  4HDE A;  2DMM A;  5A5K A;  4JED A;  3UMA A;  3GH9 A;  1K0M A;  1GSS A;  2A4H A;  2HSM A;  5D9W A;  4ID0 A;  1Z7P A;  4ZB9 A;  2JAC A;  2KLX A;  2GQL A;  2VL9 A;  1SKR B;  1Q4J A;  4D73 B;  5DAK A;  4PUF C;  1HNB A;  1TI3 A;  1XWB A;  1THX A;  4F03 A;  4WKW A;  3VPT A;  4BL7 B;  1O8X A;  2YNX A;  5CRG A;  3F3Q A;  4MJC A;  3ZLP A;  5ELG A;  3TJJ A;  3C8E A;  3DML A;  1XXU A;  6GSX A;  4TKY A;  4BVX A;  3D5J A;  3RDW A;  6GSV A;  5EVO A;  3UBK A;  1XW5 A;  2PVO C;  2WFC A;  1F37 A;  2CV4 A;  2R6K A;  1XBS A;  3EMP A;  2RUE A;  3BJ5 A;  4MJB A;  2HT9 A;  2XBI A;  1VF4 A;  4K9Z A;  2NVL A;  1G7O A;  3ZRD A;  2IPA A;  3U5R E;  12GS A;  1XW6 A;  2FWH A;  1M2D A;  5KEJ A;  1QXH A;  3HDC A;  4EL1 A;  2H70 A;  1RW1 A;  1QGV A;  3DKS A;  1O85 A;  2AYT A;  1XW9 A;  3QD9 A;  5LD0 A;  2E0Q A;  3HD5 A;  2YJ7 A;  4HEA 2;  2C4J A;  2C3N A;  4TXO A;  2HLS A;  3SWL A;  2OBI A;  1XOB A;  4F0C A;  4E8H A;  3C7M A;  4HS1 A;  2YN1 A;  4ML1 A;  1GSY A;  3F6F A;  1ZYE A;  2GT5 A;  2REM A;  2HRN A;  2TRC P;  1K3L A;  4WBJ A;  2FNO A;  1R5A A;  4Q5F A;  1O8W A;  3G7J A;  2V1M A;  1PSQ A;  3C1S A;  2MMA A;  3BCK A;  3DXB A;  5IMV A;  3R3E A;  3A5W A;  2PER A;  3EPT A;  1DE1 A;  2V6O A;  1M2A A;  3KXO A;  2VLV A;  4FYB A;  1EP8 A;  4MZC A;  4IJI A;  3P2A A;  2AV4 A;  2QC7 A;  3ZFL A;  2DIZ A;  2P31 A;  4MMM A;  1ZYP A;  2FWE A;  4GQF A;  5F05 A;  3TKS A;  1U6T A;  4MZB A;  3GFK A;  1BQ7 A;  3GUS A;  5HFG A;  1X9M B;  1O81 A;  4FQU A;  5ECK B;  4HZ4 A;  2DJK A;  3UJ1 A;  3F9U A;  4DSS B;  3HYP A;  2YV7 A;  5D96 A;  2QKE A;  3L0H A;  3Q6O A;  3FY7 A;  3BD2 A;  4L0U A;  3GNJ A;  3GHA A;  1MDJ A;  3HHV A;  6GSU A;  1F3B A;  2H66 A;  2F9S A;  4ILF A;  4OO5 A;  1ACV A;  3RHB A;  3FZ4 A;  3FKF A;  4K2X A;  5IO0 A;  5CRH A;  5F0G A;  3IAM 2;  3IAS 2;  3RHC A;  1M7T A;  2LST A;  2YWI A;  2H76 A;  5L71 A;  2JU5 A;  3UIW A;  5JCG A;  3VK9 A;  2HFD A;  1OKT A;  1Z3E A;  1ZZY A;  3EE2 A;  3MSZ A;  4GRF A;  1O7U A;  4MPF A;  2AJQ B;  2C0D A;  3KIJ A;  1K0B A;  4NAX A;  1YEP A;  3ZYW A;  5EPF A;  2B5X A;  4FO5 A;  4IP6 A;  5H5S A;  2K6V A;  4HOJ A;  4AJ6 A;  4X43 A;  4EE0 A;  2H6X A;  4NV5 A;  2MBT A;  1TRU A;  3MWH A;  3LXT A;  2KHP A;  4ZBA A;  3FK8 A;  3ZZX A;  4POK A;  4ZBD A;  2IIY A;  2P5Q A;  4EC0 A;  3QOU A;  3N9J A;  1T3B A;  2GLR A;  1MTC A;  1OAZ A;  5J3R A;  1TK5 B;  3EMX A;  2CVB A;  4O92 A;  5BRT A;  4O32 A;  2GQK A;  1XWC A;  2LEG A;  1G6W A;  1EGR A;  4G0K A;  5J9B A;  1TRW A;  5IPG A;  4RUV A;  3N5O A;  2A2R A;  1X5E A;  5ENU A;  4L5L A;  2C80 A;  3ISO A;  4BPY A;  2VCZ A;  2IJY A;  2K18 A;  4KND A;  4KGI A;  5KN0 A;  1PD2 1;  2YZU A;  1SJI A;  3F4S A;  3VFI A;  5ECN B;  3I9V 2;  1GTI A;  1XFL A;  2B1L A;  1PQN A;  2VCT A;  4HZ2 A;  2K8V A;  3IR4 A;  3GTU B;  4QL9 A;  3F0I A;  2H71 A;  4V2L A;  4A5P A;  2IMD A;  4BVY A;  5EL8 A;  3CBU A;  3TGZ A;  3L9V A;  2CZ2 A;  5ECO B;  4TR3 A;  4N0V A;  3GKX A;  3GX8 A;  1ABA A;  1TJD A;  1SEN A;  1EOG A;  3MIX A;  3G9B A;  4KSM A;  4BA7 A;  3HJM A;  4K8M A;  4MF6 A;  3TOU A;  1O6J A;  3FMW A;  2WZ9 A;  3R2Q A;  2FLS A;  3TJG A;  1GTA A;  2L6C A;  1JLV A;  5KN2 A;  2OA7 A;  4KDY A;  2MMO A;  3KJY A;  3A2W A;  4MJA A;  3IOS A;  2FA4 A;  2X8H A;  1HQO A;  13GS A;  5EY6 A;  1TTZ A;  1THO A;  4YKF A;  3GST A;  2H72 A;  1TI1 A;  1TDI A;  3TJB A;  2O85 A;  2LJK A;  4NXI A;  2JZR A;  3CRU A;  2LUS A;  5KN3 A;  2EC4 A;  5D93 A;  1E6B A;  3D4M A;  5A4U A;  3HVX A;  5JWR B;  2GZZ A;  1R4W A;  1JZO A;  2FUG 2;  2L6D A;  4IQA A;  4MF7 A;  3DEX A;  2FWG A;  2UZ8 A;  1FOH A;  1SK2 A;  1GNE A;  2IMK A;  2QA2 A;  1M0U A;  2E7P A;  1WWJ A;  3DRN A;  4IN0 A;  1T4Y A;  4MP4 A;  2AHE A;  1ZYQ B;  2B3S A;  3ZVJ A;  3D6I A;  5HR0 A;  3HZ4 A;  3ERG A;  3C71 A;  3RPN A;  2J9H A;  4HU9 A;  4J56 E;  6GSY A;  2LNT A;  3NIV A;  3H1N A;  1A2M A;  1GP1 A;  3LXZ A;  1SKW B;  1GWC A;  1SD9 A;  5FT3 A;  4V1A g;  3KGK A;  3KCM A;  1WIK A;  1FOV A;  2VUP A;  1CQH A;  1XWA A;  3QCP A;  4RI6 A;  1C72 A;  5B6M A;  1M9A A;  4GCI A;  5DAK B;  1XCC A;  3MDK A;  3PIN A;  1B4Q A;  3KD0 A;  3GN3 A;  4IHU A;  2IFQ A;  3QPM A;  1ZL9 A;  1YKA A;  1GTU A;  3G7I A;  4ECB A;  2PVQ A;  2LQO A;  2R0P A;  1T4Z A;  2JSY A;  3QAW A;  2R5G A;  5E59 A;  2H19 A;  4BVX B;  4BWS A;  1U3A A;  1V58 A;  5D8I A;  2ALB A;  2LV3 A;  3E3E A;  1DBY A;  5G2Z A;  3J7Y b;  2B6M A;  3MNG A;  4XS4 A;  5B6N A;  4G0L A;  3P7X A;  4X4J A;  2VL2 A;  5HQP A;  2C3T A;  1TOF A;  4GQC A;  2DJJ A;  1K3Y A;  2BTO T;  2JZS A;  4GTU A;  1JLW A;  1U88 A;  4I2T A;  1KTE A;  2PMT A;  3LYK A;  4N0Z A;  3F63 A;  5HR3 A;  5ID2 A;  3GH6 A;  2YJH A;  4EUY A;  1GSU A;  2C8U A;  4ECJ A;  3RPP A;  20GS A;  4F9Z A;  4NMU A;  3UVH A;  2L5L A;  2X4A A;  2C3Q A;  2F8A A;  1IYH A;  1FG4 A;  4TXO B;  1J08 A;  1B9X C;  5F06 A;  2H6Z A;  2E2M A;  4OFT A;  4IVF A;  1J9B A;  2LJR A;  2E2G A;  3FR6 A;  3FYG A;  5IIZ A;  5G31 A;  1SKS B;  4XS1 A;  3GL5 A;  1OC9 A;  1YKC A;  4OFM A;  2HZE A;  1R26 A;  4KAE A;  4OMV A;  2HNL A;  5GAN D;  4HJ2 A;  3EYT A;  4KDU A;  4FYU A;  1V57 A;  4I97 A;  1EEJ A;  4FH8 A;  2NDO A;  1K0O A;  4XS6 A;  1LBK A;  4I6X A;  4L5O A;  1PL2 A;  1VRS D;  2H8L A;  1ZYN A;  1TK0 B;  1PGT A;  2LRT A;  2WS2 A;  4EDY A;  1GH2 A;  4ZB8 A;  2I4A A;  4JR6 A;  2YZH A;  2R0G A;  1U87 A;  2N5B A;  1M2B A;  3TKS E;  2PUK C;  3LWA A;  4NPB A;  1FW1 A;  1NW2 A;  5F07 A;  3WT1 A;  5D73 A;  4ECI A;  4Z2T A;  1SJ6 A;  5IMA A;  16GS A;  4CDO A;  4HQZ A;  4X1U A;  2L4C A;  3C73 A;  1UC7 A;  4L0W A;  1GL8 A;  1WP0 A;  4MAB A;  3HZ8 A;  1E2Y A;  1SJZ A;  4GSN A;  5JCW A;  3GSS A;  5LCZ A;  1PN0 A;  1Z9H A;  2VAF A;  1TP9 A;  2L57 A;  1EV9 A;  2H0H A;  4PQ1 A;  5KOW A;  2GTU A;  1BX9 A;  3FR9 A;  3DVX A;  5IMD A;  4YKG A;  3LSZ A;  3IBH A;  2YP6 A;  2MBS A;  1ZCP A;  2OJL A;  3DVW A;  3QMX A;  3WGE A;  2G2Q A;  4ACS A;  1WRY A;  2K9F A;  3H4K A;  3HJP A;  5KN1 A;  4IBP A;  1H4O A;  4G0I A;  1T7P B;  4YQM A;  2HE3 A;  2B7K A;  4EDZ A;  3TUE A;  1GSE A;  1XIY A;  2AUV A;  4KDX A;  1ON4 A;  2WJU A;  1W4V A;  4NHW A;  2H1D A;  2I1U A;  3ZIV A;  1ZOF A;  3UAR A;  4G10 A;  3EU4 A;  2TIR A;  1AQX A;  4ZBB A;  3TKR A;  6GSS A;  1GUL A;  4Q5N A;  4GF0 A;  3GUR A;  2OAD A;  4V1A p;  1YDK A;  22GS A;  1K3O A;  4EVM A;  4GWR A;  3A2X A;  4G9H A;  4D73 A;  5GST A;  5CYY A;  1VGL A;  1YQ1 A;  4GLT A;  4EKZ A;  5DCH A;  2V6K A;  1JFU A;  1K0A A;  5IMZ A;  4LLR A;  5DVB A;  2PN8 A;  4N11 A;  1YF1 A;  1Z5Y E;  4TRX A;  1OC8 A;  3CRT A;  4USS A;  2HI7 A;  2LQQ A;  2GSS A;  6GSW A;  2IME A;  2ZCT A;  4IQ1 A;  2LKU A;  1N2A A;  3ME7 A;  4IKH A;  2VCV A;  4MCU A;  2FD3 A;  4WF5 A;  1TXX A;  5DQS A;  3WYW A;  4PNF A;  5B7C A;  2RM6 A;  2LNS A;  2XBQ A;  3ED3 A;  4TVE A;  4BVY B;  5J41 A;  2LJA A;  4KH7 A;  3IXR A;  5COH A;  3D22 A;  1TW9 A;  1F6M C;  2GDR A;  4ZL9 A;  5CRW A;  1HD2 A;  2PPT A;  1UA5 A;  5D9V A;  3US3 A;  2V2G A;  3CXG A;  3MAK A;  2TRX A;  2CX4 A;  3F8U A;  3GKM A;  3IE3 A;  2V32 A;  2CT6 A;  2X49 A;  2GVP A;  2KP1 A;  2R3X A;  4ZXG A;  1ZGN A;  3H93 A;  4WEY A;  3DYR A;  1QMV A;  2N5F A;  3LFL A;  2DJ1 A;  1SL0 B;  5HFK A;  1FO5 A;  4DSQ A;  2YV9 A;  3WGX A;  1UVZ A;  4KCA A;  5DDL A;  3TKQ A;  1VF2 A;  2O8V B;  1QFN A;  4LMV A;  3ZIT A;  2VD0 A;  1Z7R A;  2I3Y A;  1Y6E A;  1QUW A;  1XWG A;  1NM3 A;  3HKR A;  1AC1 A;  1MDI A;  2ZNM A;  4JBB A;  2FY6 A;  4TR1 B;  1BYE A;  4YQV A;  4OWY A;  3IHQ A;  1X9S B;  2F3M A;  4IGJ A;  5CRE A;  1OC3 A;  1SYR A;  2HSY A;  1V9W A;  3IDV A;  1B48 A;  4EXJ A;  2ON5 A;  4XRD A;  4EF0 A;  3TJK A;  2B1K A;  3FRC A;  4PGT A;  2Z9S A;  4WBR D;  2DKH A;  3GRX A;  3ZL5 A;  5GSS A;  4JE1 A;  3VI5 A;  18GS A;  3UBL A;  4MPG A;  2LS5 A;  3LW9 A;  2PU9 C;  1KBN A;  1EV4 A;  3IV4 A;  1YY7 A;  3I6A A;  4CHS A;  5HR2 A;  5DQY A;  4F2I A;  4I5Q A;  5CNW A;  5H5Q A;  3IHG A;  3P8W A;  1B8X A;  4IW9 A;  1Z6M A;  2FWF A;  2WB9 A;  4MNN A;  3APO A;  4ISD A;  4TR4 A;  3AY8 A;  5GZZ B;  3WGD A;  2IFQ B;  1ERU A;  2I81 A;  4POM A;  3KMO A;  3NZN A;  2R0C A;  5J4U A;  1VF3 A;  2VCX A;  3L4N A;  2MYG A;  1PN9 A;  5IMC A;  2KP2 A;  1GUH A;  1YZX A;  3ZRE A;  4HU7 A;  4K0G A;  3KH9 A;  3D4T A;  4KW6 A;  4OCF A;  2JSZ A;  1FHE A;  4XS4 B;  3FW2 A;  1TU8 A;  4YQU A;  1Z6N A;  4F0B A;  4K5S A;  2GGT A;  3M9K A;  2VL2 C;  2B7J A;  4XIH A;  4CY6 A;  3KTB A;  10GS A;  1Y25 A;  2C1Y A;  4K7I A;  4V2N A;  3CTF A;  4BWQ A;  1NSW A;  4WXT A;  2BJX A;  1RQM A;  5JWQ B;  2VO4 A;  2RM5 A;  3UAP A;  2C0G A;  5HR1 A;  4DVC A;  1GSQ A;  2RII A;  4HQS A;  2O7K A;  2H73 A;  4PQH A;  4O5Q A;  4NHZ A;  1OKD A;  2ES7 A;  3QAG A;  3APS A;  1EOH A;  3F6D A;  2VM2 A;  4EO3 A;  1MD3 A;  1OC9 B;  1ERW A;  3IC4 A;  2HZE B;  1SL1 B;  1A23 A;  3KTL A;  1K0N A;  2YWO A;  2C0F A;  4WR5 A;  3VLN A;  3HXS A;  2YOI A;  1OE7 A;  1A0F A;  4E8E A;  2GQM A;  2KUC A;  2H1A A;  1GSF A;  4XCS A;  1SK1 A;  1PX7 A;  2H1G A;  1FB6 A;  3D21 A;  4OD7 A;  5AGY A;  4G19 A;  3W6G A;  4GSS A;  4HI7 A;  1URM A;  1LJR A;  4OCE A;  4XRA A;  1NHY A;  2L4Q A;  4IP1 A;  5ECS A;  2YAN A;  3DWV A;  2H74 A;  4YAP A;  2D2Z A;  3KP8 A;  1GNW A;  3LJR A;  2DLX A;  1G7E A;  4I2U A;  5LNK e;  4Q5Q A;  3PPU A;  1PKW A;  4ZIJ A;  1X5D A;  4L8E A;  3Q19 A;  3F3R A;  3M9J A;  4P3Y B;  2PWJ A;  3RBT A;  3M8N A;  1PRX A;  4K6X A;  2XHF A;  3U6V A;  1GLP A;  1K0C A;  4PQI A;  4FIW A;  3DGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...