2I9LA

Structure of fab 7d11 from a neutralizing antibody against the poxvirus l1 protein
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DMVMSQSPSSLAVSAGEKVSMSCKSSQTLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERAAGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 7D11 light chain
publication title Structural basis for the binding of the neutralizing antibody, 7D11, to the poxvirus L1 protein
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system/viral protein
total genus 52
structure length 219
sequence length 219
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i9lA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i9lA01
5SWZB 3MRNB 3UBXG 4ZODA 4QRTB 5GS2H 5IMOA 4WHTB 3MNWB 5MEQB 1RD6A 1IBGH 3RIAK 1NUGA 4UV4L 1N7MH 4ODUA 1PGRB 3QHTC 3AC0A 2JCCB 1YY8B 2H1PH 3QQ9D 3O8XB 1RZKC 1OARL 1WQVT 4HJGB 5TDOA 4OGYH 4XPFL 1HOCB 5DQJA 1P7QB 4MNQB 3SN6N 4HK0A 4YIQB 3VFOB 2X89D 1X5LA 2R69H 4O51B 3SPVB 4QNPE 1IC5L 1T66D 4RMTA 3PV6B 2VLKA 5EIIA 5F9WB 4P4RA 4ZOAA 1H3UA 1LGVA 2A6DA 2IEPA 1QKZH 5GRUH 1OOAA 5KN5A 3LH2H 1FL6B 1HZHL 4JFFB 4KVNH 2P5EB 2C3VA 3HG1E 3ZE0F 5C0CD 1QYGL 1H3TA 1LP9A 3DTXA 3DMMB 2MNUA 3EHBD 4KDVA 1ZSDA 4L8DA 5LKNA 5HDBF 4Z5RB 4N0YL 3RBSA 1NGQL 4KV5E 4D9RD 3IJYA 2YD8A 4KKLD 4XP5L 1IGTA 2X4QA 5HHXH 4F9LA 4TPRH 1AO7B 1G0DA 1M7IB 4KK5D 2PW2B 3W9DA 3WLWD 1PG7X 3Q5YA 2EIZB 1YN7B 4ZYKA 2QSCL 5CJBA 1W0VB 4JFZH 3VXOA 5BVPH 1AJ7H 3TPUB 4W81A 4JDZA 3VDAA 3RFZC 2ESVB 4PJBB 1NL0H 1JVKA 1T0MA 5I1LB 1YMHB 3KPOA 2IADA 3IYLW 2OTWA 1FO0H 1E4XI 4N0RA 4EDXA 1F3JB 1Q9KB 1ZVHA 5IOPA 3NAAH 2VDLL 5BZWB 2BNRA 3A6CL 1KPVB 3LKSB 2IFGA 4LP4A 1GZPB 2CDGA 5ICYB 3ULVL 5I76A 4PJAA 4JY4A 4JZOB 2JK5A 1MFEH 4JKPL 3MRJA 3RX5A 1CBVH 4XPTH 3W39A 5BMFL 4ZUWA 1BQHB 4G6FB 5EUKB 1TZIB 4YPJA 5DMKB 2ADGB 4YBHA 5EULV 4L3EB 5DFWH 4NNPL 1CD9B 1GVIA 3FQUB 2XQYK 5JIKA 5EC2B 1SVCP 3EW3B 1HK6A 4ZUTA 1CD8A 5T1LB 3GSWA 5DDHB 3QEQD 5E2UH 1XGRA 3UO1H 1X5HA 5DHVH 3T3MF 1U6AH 5D9SB 4H88H 3GMQA 2H3NB 4YNYB 1KCKA 1Q9LB 4R8WL 5AD0B 3EGSA 2IPTL 2F53E 3VFVA 3DX9A 3SDXF 3VGEA 1K5NB 5C08B 2IQAA 3F7VB 4G8GB 2X4SA 5KAQF 3MGOB 4NZTH 3ROLB 3FZUD 1GOHA 4JKLA 3VWKC 4JO2L 1NBVL 4LBEA 2VTFA 3L7FA 3BFOA 2QBWA 1LD9B 1PLGH 1X44A 3LKNB 4IRSA 1MHEB 1G7IB 2NY6D 2OZ4L 5CBAA 2PW1A 2HWZL 5GS0H 3BH8A 2Z35A 1WBZA 4O58L 4PYHA 5B3JE 1CR9L 2P24A 5SWQA 1CE6A 3FT4A 3L3JA 5E6IC 3MLPA 3MLVH 3C5SB 2DYPA 4X6DB 3HPLB 4KZEH 4L8CB 1IGCL 4JB9H 3OR7B 2ZSVB 5EO9B 4ZFFB 3DX7B 3CZJA 3QUML 4BM7A 3MA9L 2DM4A 3F7RA 1H5BA 5KVDL 1Z0MA 4KKAC 5JHLH 3WIFA 2D9QB 3VFWA 2DQHL 3WS6C 3AS0A 3IFLH 5F7DB 4L8BA 1WBXA 2BJML 4K3DL 5C07A 5IMKB 3WFHB 1YQVL 5ESVA 4JAMA 4ODVH 2V7NB 5JW4Q 2PYFA 1CQYA 1MF2H 4O00A 5CUSL 4JPWH 5B4MC 4XCEB 2EDHA 3ZL4L 4MJ6A 3GM0A 4C56E 3TYGH 3TN0D 5CSBA 3NCEB 4OV6F 4MA8H 2Y07L 3P4NA 3SKJL 4WJ5A 3BKML 3T2PA 1HCFX 3RY6C 4XBEH 4UQ3A 1FVCA 4LVHB 5GJTL 4G42A 4HH9A 4I0PB 3QEUB 5L6YH 4QRQB 3BGMB 1PKQB 1TCRB 1REIA 2MKWA 2HT2C 2PO6A 2JLLA 3IRPX 1FPTL 3PP4L 2Z91B 4NKIL 4X4XA 2MHAA 3S35X 4OZGB 3NGBB 5EZLB 4MDIA 3NCBB 5T33H 3FRPG 3WIIL 4QOKD 2XZQL 4OLVH 3HMXL 3V52H 1C16A 1JHKL 3UDWA 5GGQH 2DQDL 2BNRE 2KQNA 3RWIB 4NKQB 3O4LD 3FO2A 5ITFA 3MOAL 5CGYD 3CLFL 4GXUM 4PJAE 3OX8A 5D71L 2PXYB 3ET9F 4U1KA 1H0DB 3HB3C 4G7YH 4M02A 5HYJB 2EDFA 4QT5A 4ZS6D 5JW3H 1A6UH 5EZOH 4X98A 1B88A 5DHXB 4KVCL 1IEBA 2R29H 1A9EB 1LK3L 5KS9B 3VWJD 2JB5L 2AXFB 3HR5A 3QZWG 3K3QA 2VZUA 5JXAL 5F7HA 1AFVL 1S7XA 1Z6JT 3O6MH 1KT2B 4OLXH 3O11A 1L7IL 2EE3A 4Z7NE 2R8SL 5DT1L 5HHOA 2L7JA 1BQUA 4G43A 3WJJC 1FDLL 3VGAC 2IPUG 1UC6A 4R0LB 3NFSH 5CP3A 1SY6L 2AV7B 2JB6A 1Q1JL 3VA6A 4PV8A 3P9WB 2R0ZH 1WFTA 5F7UA 4LSRL 4UILH 5B38A 1W0WB 3MUGB 4KK6C 4ZTPL 1A4JB 5KSVB 3TYFA 2ED7A 4QXGL 5E8DL 2X1WL 5IB4B 2X9YA 1ROWA 3WL9A 3IDUA 3NIFF 3WEXB 2OI9C 4JHZA 1ODAA 4LDEB 5C71A 3D25A 1YY9C 1QLEH 1P1ZA 5HHMB 3MLSL 1QSFB 3W2DH 4PLKD 1K4CA 4TVPL 5EBMA 4G8FB 1H15B 4PRID 2D7QA 4ODTH 1UADC 2EKJA 3ARQA 1NLDL 3C6LA 4XWOC 3RZCC 1NCTA 5GJSL 4N90E 1A0QL 4XPAL 4YXHL 1BD2B 3K74B 1WICA 3VD7A 2YS4A 1UM5H 4PJ8C 2HKFL 4DKEL 2ZG3A 4YO0A 1U95A 1A4KB 1ORQB 5I6XC 4U1HB 1FZMB 3WN5A 4WNQA 2VDKH 4KKAD 4Z0BL 5IB2A 5C07E 3BVNA 4MWFA 4JZNB 3VGGA 1GAFL 5KW9L 1QBBA 1RZJL 5JXEA 5F7MC 2JCCF 4M7LL 5DZNA 1RZ8B 3ELAT 3ESUF 3RA7H 3JTSB 2NY1D 2QHRH 5I1JH 3ZDXE 5TGBA 5B4MD 1JZ3A 4JQXA 1T04B 4R4NC 4YX2L 5JQ6L 2CDFA 1KGCD 3IFOB 5FOJA 4YHIA 4JM2B 1B9ZA 4KY1L 2WBKA 5EA0H 1NAMA 3BQUA 3AREA 4I18C 5DD1H 1JL8A 3DV6A 1T1WA 4Z7VE 4BKLA 4PJGA 1JYVA 5DJCA 1S9VA 4HHAB 5DHVB 3VRJA 5DJ2B 2NX5D 5C0EA 2E8ZA 1RJCA 1D6EA 2BHZA 2XTLA 2O5YL 4ELMB 4NN7B 3MJ6A 3U9UA 3D0LA 1KC5L 1JNLL 4FQ1L 3MV9B 3HN3A 5L2JB 1G9NC 2IC2A 2VZVA 5D7SH 3S96A 4ZAKD 3GSNA 2EYSA 3L5WA 2GEEA 3MJ9A 1RSFA 1RZFH 4YK4C 2AVGA 2C5DC 2Q76B 3HG1D 1U8PA 4XGZB 2GTWA 3ARGD 4LSDA 3LOWA 4PLOB 4JFXA 1IAII 2A6KB 2NZ9C 3UPCA 5HGHB 3BPOC 1FFNA 4PRNA 1BFSA 3HB3D 4NSKA 1AI1L 2VABB 4LPTA 1A64A 4E5XB 4X8JA 1HIMH 3T1FA 4M7KH 2J7LA 1XF3B 1FVEA 2X89A 4GS7B 5EWIL 1IAIM 2Q6WB 4CKVX 3SOBL 4MJ5B 3MNZA 1CLOL 5F89B 4XH2B 1MCHA 3IB4A 4MJ4A 1I3GL 2ZOKB 1RUPH 1MVFA 2VDPH 4MHHI 1DQJA 5JW4R 1ZLSH 4HUXB 5D5ME 3I75A 2VSCA 4H20L 2P47B 1HH6A 1AHWC 5C0CA 4YHLH 4N68A 1IKFL 1JGDA 2CUHA 2YPLD 3BP6B 4IRJC 5B22A 3HI6L 3V0VB 4DN4L 3KPPA 1PEWA 4NFDA 2BX5A 1C5CH 2VDRH 4PRAB 4PBVC 1FORL 5DJXA 3QRGL 4ODXA 3L3OB 4OZHB 4XVSH 4I13B 4KHXH 1MRCL 3GNMH 2Z92A 4QXTA 4LLDA 4LLQA 3VCLA 5IJKA 4LEXH 1FSKB 3RUGA 4IOFD 3IXTB 1B0WA 1ZLWH 2XTJB 2VXVH 3OR6B 5IR1A 5D1ZB 4ODHL 1MRDL 1IFHH 1O7VA 4XMLH 3O3AA 1EHLH 4KAQH 1UJ3B 2V7HA 4ONOA 4XAWH 2GIYA 2F54B 1JI1A 3KVQA 3M1BA 5LCVH 2E5EA 5TH2A 3FQXB 1ZWIB 3TV3L 1JZ7A 4K7PL 4H0GA 1BFTA 2P45B 4K3GA 2ATKB 5EU4B 5IMLB 2X44D 4QHKJ 4ONFH 3ZKXB 1G7MB 1PYWA 4OLUH 4OT1H 1K3IA 3RZCD 1KTLB 4Y5XA 3BZEA 4RAUA 4WWKC 4KMTH 4OLYH 5SWSA 5C9JA 3IKKA 4PR5B 2FWOB 5JIPA 2UZYB 1IVLA 3EOAB 5DZOA 4LSUL 4PJEE 1JYNA 4BZ2H 5ESQB 3GMMA 4G9FD 4X6DF 1QSEE 5DEGA 4X6FB 5HI5C 4HDIB 4Q0XL 1XGYH 4HKZA 3GO1L 1A14L 2ITDA 4OV5B 4F80A 3KPQA 1WK0A 4DQOH 1UEMA 1UB6B 3Q6GH 2NTSP 4HIHB 3Q5OA 1DL7H 1I8MB 1NBYA 4WUUD 2DBLL 4U6XA 1ZANH 3VI4F 4P46B 5K9JL 4R4ND 4LIQE 1RUQH 1YEFH 1BIHA 1TPXB 2OR7A 3ARVA 3PABA 2OQJB 4M7JH 2A9NL 4M6NH 4P2QB 3ZHKA 1QBAA 2V2TA 4JLRA 3KR3H 4X5XB 4IS6A 5DD3H 1LWRA 1U8OB 4K07A 3S5LB 3KXFD 2DWDB 3CX2A 4DZ8B 3BP5A 1VKXB 1QLFA 4LLUA 4WW1A 4HUMB 4LF3A 4M4RA 4PPTA 5I1DA 5ALBH 2KBGA 5DHYB 4PREA 2IH1B 4TUKL 3FQTA 4NWTH 1TJGL 3GMOA 2C4FT 1MIEH 1S9YB 1U8LA 5A2FA 4OZGF 3TJHC 3F7YA 3PGFH 4HKXB 1QRND 3DYMA 1RIVL 4U6YA 3TLRA 3MACH 5JW5A 3TO4B 3C5ZD 3DARA 4OD2A 1Q0YL 1S5HA 3VE0B 1RUKH 3CK0H 5GGUA 1KCRH 3K2UL 1BFOA 1M7DA 5E00A 2FEEI 4W4NA 4NKOB 2XQBL 4LCUA 3LS4L 2AJUL 3KPSD 4ESKA 4MD4A 5J1SC 3VRLE 4WTWA 2P8LB 1EUTA 3QIUC 3IDMA 2XG5A 5CJOH 4H1LB 3WLBB 1MHHA 3O6LL 5DEFA 3HE7B 2WQ8A 1FRGH 1MJ7H 5FYLD 5GGRA 5TE6H 3NOIA 2CIKB 2H32H 2B5IC 3BEVA 3ES6B 3T3ME 1YPZE 3UZQA 5FO7A 2VN4A 1BEYH 4JO4H 2QKIA 5C2UB 3TN0A 3CXDL 4NO3A 1RZGB 3M45A 2B1HL 2NY4C 3G5YB 3FONB 1Z3GH 3KPMB 3GM8A 5CHNA 4D9LH 2EEDA 4S1RH 3F6IA 3P0YL 4PJFB 1IM3A 3T0EE 4EOWL 1R5WB 5ERWB 3SGKC 2Y36L 5K33A 3FO9B 3HS0A 3R8BB 9CGTA 1QFHA 1ZEAL 3V7AE 4PJ7E 3QCUH 4W4OC 3SQOL 5BV7H 2FH8A 3I9GH 1D6VH 2P49B 1IGJA 5IFHL 5C09B 3D87B 3C08L 2IQ9H 1A7QH 4U7KA 3AGVA 1JTTA 1S7WA 4M5YL 2V6HA 1DVFC 2JIXA 3PGCA 4PGEB 4ZFOB 3C5JB 2X4UB 4PJIB 5I8EB 1A6ZB 4QRRA 1KIUA 5CZVH 5FUOH 3TBWA 4JDTH 1QFWI 1QR1B 5SWSE 1JGLH 5ADOL 2X4TB 1V05A 4L3CA 2V17L 4S1QH 3N1GC 5L88L 2BRRH 5MI0B 4WWKD 5IQ9A 4OD1H 3U0WL 1TMCB 1CG9A 4HV8A 3MLUH 4YDIL 5DF0A 5EORL 4U31A 4WEUD 4JRXA 1JGEB 1CIDA 32C2B 1QFWM 4P9HH 3C8KB 4PJXE 3UAJC 3VWJA 4M6MH 3NACH 4JE4B 1J11A 2CKBH 1W8OA 3M8OH 5KSBF 3JV0A 3E6FA 2CRZA 1DEEA 1E27A 3VGBA 1EEYA 3GB7B 5JIIA 3T09A 2APBA 5JNYB 1BIIB 4MA3B 3T65B 1EEZB 4G7VL 3TIEA 1JPTH 2R0KL 4CVZB 4NZRH 4Y4FD 1QEWB 4WO4B 4ZUSA 3VRIA 1GH7A 4CJ0A 1JRHH 1U2HA 3S4SG 4K9EL 2J12B 4N8VB 1VADA 1MQKH 3T2QA 4MB5A 2B0SL 3QI9D 1BWMA 1MCWW 1G0YR 4XNZB 3FT3A 1EJOL 1NAML 3DO7A 5D2LE 3HC0B 2GJ6E 4FQXD 1NGXA 4NKDB 2EDNA 2R23A 1H8OA 4R90H 4D0CB 5TQ0L 4GMTL 4JM2F 4RRPA 2HJLA 4PG9A 3FB6B 1HQ4A 3LQAL 4QYOA 3GBNH 5DR5H 5D2NB 3LPGA 1S9WA 3T77A 2I07A 4FQHA 2OYPA 2GT9B 5IFJA 1MIMH 5KVGL 3RL1B 4MD0A 4YZFF 4YHNB 1D5IL 4OQ1A 12E8L 3U48A 5C0JA 3PL6C 3DSFH 2NY3C 1G7QB 3GSNL 5B39A 4OM0H 5DTFA 3MJ9L 4ONGH 4Y4HD 1EZVX 1KUMA 1NC2A 5EB9A 4X6CB 2Y5EA 1KTDB 3FOLB 4S1DC 4YDJB 3TJHD 3V6OA 1INQB 1UQSB 1KJ3H 3N0PB 5M94B 4ZO8A 2NY2B 2GSGA 2OK0H 4DOHE 3GIZL 2X1XR 1FYTE 5CBEA 1CICB 5IG7A 3RKDC 1AQKL 4R2GB 2W65A 5LGKA 3MLZH 5JOPD 4UU9B 4OI7A 4PRHD 4XPHL 5CMAA 1UM4H 2XACC 5MEOA 2ZNWA 1MQ8A 1BMGA 3VFTB 2O26U 5DK0A 5IHZB 1BAFL 2BOBB 4JRYB 1VFMA 1N3NA 1KIQA 4HZLA 3STZA 2XFXA 4JJHA 1G1CA 5JIHA 5C8JB 2VDNL 2DJSA 3PF2A 4OKVB 4HBCL 4RMQA 1BFVH 5DQJB 1BBJA 2NLJA 4WRLA 1X7QA 1URLA 2Q8AH 2FO4B 5JUEH 4KRPB 5CILH 2NX5A 1P84K 1BF8A 1NDGB 2YPVL 5HDLA 1DQDL 2FNBA 2UZIL 4NBYB 1B0GA 3BEWB 3SE3A 3S3PA 5E2VH 2C3VB 3ARFC 1D9KC 3MODH 2A2QT 2UWEE 3VD3A 1UCBH 1CXHA 3MBEC 4HF5H 7FABL 3KDMA 1BJ1J 1VENA 1DANU 4ZAKA 1A6WH 1R24A 4RWYH 4U1MA 2E7BA 4Z0XA 3WSQL 4N9GA 5EOQL 5IBTL 1GIGL 5GHWL 4JFPA 4JHWL 1TQCC 1F58H 3ARGA 5AZEH 1C08A 4ENEC 5GS1A 4UAOC 1MVUA 1UKSA 2F5AL 3S37H 2QLVB 3KYOB 3TO2B 3O3DA 4ZFGL 1Q38A 1R3LB 4GW4A 4JO3L 4ZYKB 4NQUA 3VXOB 4KUZL 2R0LL 1BVZA 1KEML 4JDZB 2XZAH 3GHEL 3T0EC 1BZ9A 4QHKI 1Y18B 4P5MA 1V7MH 3EO1B 5DVKA 1QFOA 1BPVA 2CR3A 3MXWL 4EI6A 5FEBA 5EOTB 2BRQA 2IADB 3EO0A 4I48B 3B9EA 3P9LA 3UAJD 4RQQB 2BVEA 5E9DA 4RIRB 1DN2A 2XY2A 3BSZH 4HX1B 3RWJB 4HWZA 2J6EA 1YEJL 3DGGB 4M9PA 1U41A 3F58H 1NBZA 2OR9L 4MAYD 5DD0L 3N1FC 1NCCH 5HGBB 4JY4B 4YHKL 1D5XB 5F1KC 2YPLA 2WBJA 1KNOA 2D7TH 4M62H 5DJ0A 4MNGE 1LNUA 2DQIL 4JFDD 4M43H 3QJHB 4QHLA 4V1DE 1II4E 3O9WB 2VIRB 3JWOC 3OAZH 5LBSH 4FABH 3QDAA 5E5UB 3UTSD 4GBXC 3MYJA 3B9VA 1ADQH 4OJFL 1DEDA 1AXTH 1EHAA 2NY0B 2XKNA 4WV1A 4FNLH 3KYMB 1HH9A 3ZKQD 1UG9A 4OIIL 3FOMB 2ARWA 1MHPH 2ATPA 3GMPA 1RIUL 3L95B 3UC0H 3SE8L 5M95B 1P2CA 1WISA 4KQ4L 1C5DA 1WZ1H 4YXKH 3KYKL 1LQSR 2YKLL 3PL6D 3BPNC 2NY3D 4LHUD 3S36X 1EO8L 1VPOL 3U7YH 1EAJA 1RU9L 4PTUA 4EQ2A 3AB0B 5I66A 3P0GB 4X0KB 3X13B 4NNYA 2YUWA 1JPGA 3IDIB 3H3PH 5L0QC 4LBEB 1NANH 1A6TA 3FN9A 3LEXB 4XP6L 4TULH 1DLHB 1MFCH 3VXUB 4WCYL 3TVMC 1JPSL 2ARJB 4IRSB 3OF6D 3TZVC 3FN0L 4G9FA 4HCRH 2A77L 5I73C 5J1TC 4LCCA 5JDSA 3OG6B 4QTIH 5CEZL 4YHYB 5CBAB 4GKNA 1FQ9C 1LO3H 2CRYA 3RJQB 3P4OA 5FV2A 3BP4A 1I7ZB 1U91A 4JM4H 1N0XH 1RJLB 5T5NG 4KTDH 1BOYA 3DHMA 3OJ2C 2ARJQ 4M61A 3UX9B 4CVXA 2WBWB 2BNUB 4HULB 2CK0L 3V8CA 1U58A 5IVOA 5J12B 3E8UL 5GSRA 4NQCA 2WLZA 3IDNB 1SMOA 3NH7L 1JNHB 4XXCC 5DUBB 2ZJSL 4KXZH 1FC2D 3N1PC 4NQEE 5CJXC 5IT2L 3WIFB 4DCQB 3VFWB 3RRQA 4TSAL 1J8HE 1T4KA 1EERB 1WBXB 2HN7B 4KKNA 3OB8A 1EFXA 4X7SL 3KXFA 5GGSA 1RPQA 1F6LL 3CU7A 3CU1A 3U30B 3CDYA 4PJFF 3H8NA 5T5FL 4MJ6B 1NCNA 3ARFD 1D9KD 1NC4B 2FEEL 3QIBA 1YEGL 1A7RH 5J89A 5KZCD 3MRDB 1YEKH 5KJRH 3MBED 1NKOA 3S3JA 1KG0A 1OP3K 1KSRA 2AXHA 4UQ3B 1JJUA 2O5ZL 3FFCB 3OXRA 5EU3B 4HFUH 1YECL 6FABL 1I9JH 2Z8VC 1UWXH 3OGOE 1BWWA 4FG6C 4YJZL 4KKCC 4J1UA 4PJHE 3C5ZA 3FB7A 1H3PH 4HXBH 5JR1L 4IMLA 5LGHH 2IANB 3RAJH 4PJIF 5H94A 3GSXA 3K1KC 3WFDL 1KACB 1IL1B 3NA9H 3UMTA 5D6CA 5GRVK 1OP9A 2AEPL 3T0ED 3KPSA 2CJUH 5GZNC 2Y06H 2NY7L 3H3BC 3UTTE 4XNYL 5D7JC 1O7SA 3OKDA 5KBNC 4Z7WA 1AE6L 3HTLX 4G5ZH 3STLB 4NQDB 5DD5L 4F2MB 5MP6H 3FO2B 1KPRB 2K7QA 2QQNL 3A67L 3OKKB 4WFHE 1X5AA 1NDMA 1DBAL 1DP0A 2Y9RT 4BQBA 3SKMB 3L9RA 4U1KB 2VQTA 5DMGD 5HI4C 1FFPA 4BSVB 2A6IA 4LQ1A 1NMBH 1WEJL 3QO0A 1P5UA 1IM9B 3JVGA 3I6KB 4F7CB 2X4OB 5HVGB 3ZTNH 4HFWA 2D4FA 3HKFA 5C0BD 4WTXA 4TUOA 5IMMA 2VC2H 3I50H 3CFBA 4Q6YA 4XT1C 4MZ2A 5L2KD 2LFGA 4M03A 1IEBB 4JY5L 3U7WH 4Z78B 5KANI 4GKSB 3BPLB 2DKUA 1TTGA 4MJIB 1B4JL 3FQNB 4GBXD 1G6RA 4HT1L 4L4VE 4KMLB 5EO0A 4B7LA 3MRLA 5ALCL 3SDYH 2R1XB 3OKNB 1O5DT 4WFED 3VGFA 1YNLH 2J4WH 1HWHB 4S1SL 3LVEA 4FFWD 1MEXL 2OTUA 3QDJE 1N5AB 5JPNA 3EUUA 2IAMA 4NQXA 1J1XH 5CSZB 3AS3A 2JB6B 5HDQL 3WCYA 4F7PB 4P49A 1FZKB 3FN3A 3BUYA 5B38B 5K9KB 1IC4H 3MGTA 5I1HH 5E2WH 1CFSA 3N9GL 2AJZA 1CFVH 4NKMA 1XIWB 3LQZA 4RNRB 3QQNA 2ICEA 2OSLB 3DOSA 2FJHB 3LKRA 3MPCA 2GJ6D 1W72A 4MX7B 1RUAL 3GSQB 4YHPA 3CVIL 4OCRL 4X6CF 4XZUB 4U6VL 2BY1A 4BFIB 1EAPA 3D25B 4J3SA 1CLZL 3TZVD 4OZIA 3GI8H 1P1ZB 2YMXL 1FZJA 5F7NC 5FOBA 3NABH 4JFEB 1ZV5A 4RFEA 1H3WM 1Q0XH 3LZFH 4LU5H 4LLWA 2NPLX 4TTDC 2CO6B 2ICWB 5LQBL 5TQ2H 2IBZX 3AY4A 2BVQB 1ACYL 1A5FL 3PWPE 4Y4FA 3L7EA 1VSCA 1KFAH 2W0LA 1IAKB 5D1QB 1HI6A 1F97A 4CU6A 2AS5M 4WW2B 3S3SA 3GDBA 4KKBC 2PTTB 1FFOA 3QI9A 1KULA 1VFUA 1XEDA 3TBVA 1CXIA 1MELA 3LN5A 3HE6D 1OSPL 3DRQB 4UV7L 1FNGB 1AXSA 5IB2B 5I30L 4ZQKA 5ID1B 4FQXA 2EC9T 4FTVA 4LOUD 3G6AB 3VFNA 1QHPA 3RWDA 3EYVA 1FYTD 1OARH 3CLEH 1BVLB 4XPFH 1T1XA 3QNXA 5FAAA 1Q9WA 3GSVA 4NWUL 3QFDB 1OWRM 1U3ZA 1IC5H 3SDDA 3OKMB 4G8EB 2I60L 5DRXA 3FL7A 1HHKA 5JHDE 3BD4A 1FLTX 1WZKA 1S7VB 2FSEA 4IRZL 3PNWA 3AREB 4I9WE 1HZHH 1XR8B 3WE6B 1F3DJ 3JWDL 3TC9A 4Y4HA 1CGTA 3V79C 3WNNA 3HHRB 3GI9L 1S9VB 2F15A 4CW1B 1TFHA 4FG6D 3MRKB 2FCBA 4KKCD 3H9ZA 3EYFA 4N0YH 4JQVC 4RAVA 2RJMA 1OAUH 4LSQH 4YWGL 4AM0A 1ZA6A 4F7MB 1L0XA 2OX5A 1AD9B 4BK5A 4Y4KB 2E27H 5GZND 2HT4C 4PJ9C 3BXNB 3P4MA 1UWXK 2QSCH 4PRHA 5FDWA 4NZUL 2FX7L 3L5WB 2GK0A 1PY9A 4LNVA 4X7TA 3AU1A 1U8PB 4D94A 2GTWB 3RWCA 4HUVB 3JTTA 1XF5B 3MJGX 4ZSOA 2J6EL 4ODWB 1MWAB 4NSKB 2AK4E 4HWEH 2HA1A 2VDLH 1V5JA 5LWYH 3A6CH 3HI5H 5C0AD 3T1FB 4JO1L 3EOBB 3ULVH 2YD9A 1OQXA 4JKPH 4RMRA 1FVEB 4BZ1L 2RB8A 2ENSA 4N8CL 5BMFH 3NFPB 4XC3L 4UDTB 5T1DH 2EDYA 4U2YA 5HSFA 4MXVF 4U05A 4G8IA 5JOFA 4NNPH 3UTOA 5J06A 1C5BH 2WK2A 1H8SA 3GJEA 2OL3A 3D0VB 1HH6B 5C0CB 4TUJB 3P9MB 4FQJH 4PP2A 3PP3H 2N4IA 1I8KA 4PGDA 4N8PA 3KPNA 3JWNC 3KPPB 5D7LE 2W60B 3GMNA 1ZT4B 3KLDA 4MNQD 1UH2A 2YOCA 4YUEL 5DJXB 1YNTA 4XPGH 2V2WA 1UZ8B 4LK4A 4K71B 3FB8A 5D4QA 1LMKA 2IBGA 1Q94A 1SEQL 3EFDL 3WUWA 4F33A 5HHPB 2IPTH 4OF7A 3B2UC 3CVHB 4JFFD 4P2RB 1DUZA 4V1DD 5ICXB 3VI3E 5BS0E 2DQTH 2W07A 5J13C 1MCJA 3L3HA 4AG4H 4MDJA 4GW1B 3WFBL 5F3BB 3DMMD 5CEXB 2AI0L 1FNSL 1U2CA 1NBVH 4O2FB 4EN3C 1G9MC 1MJ8L 1HXYB 4KUCF 3HPJB 4DFIA 5IVXE 2EC8A 4M7ZC 1EVTC 35C8H 2M8XA 4EI5C 5T3XE 5F8QC 1A2YB 2OZ4H 4MAYA 5E8NB 2BSRA 3CJJA 4O2EA 2ESVD 4K3EL 4XCYB 5I8KL 3I2CH 1HKLL 1UA6L 4JFDA 2EKSA 1IGCH 1AGBA 4FFYL 3PJSB 3QUMH 3PWLA 5ACZA 3QIWA 2ADJA 3UTSA 4HXAH 1A9BB 4LSTL 2YD6A 1DE4A 2A73A 3ARZA 4TNWK 4Z7OE 3QEQB 4A2MA 2FDBP 4WY7L 2YZ1A 1KCVL 2BJMH 4HKJB 4QRUA 3JV4A 4S10A 5DA4A 1YQVH 3QDGE 1BX2A 3TT3L 1TTFA 1JUFB 1MCRA 1G9NL 5CUSH 1XZ0A 5IHUL 5JDJA 4UNUA 1V8HA 3ZL4H 4L3ED 4LHUA 5K59E 1R5VB 3QXWA 3CPLA 2CH8A 2ZP0T 3BKMH 1CDBA 1P6AB 4M8QB 5LG1A 4PV9B 2DL2A 2UY6A 4IS6B 2VUYA 4NQED 3HUJE 5E4EB 3SDCC 5F88A 3H9SD 4ONHA 3KG5A 2B1AL 4B41A 4HLZG 1YUHB 3QXVA 3KWWA 1MCWM 2P1YA 4LLUB 3OF6A 2A6JB 2BVPA 4HIXL 3VXQB 1HDMB 3ZT7A 3VGHA 2HT4D 1FPTH 1XF4A 5J6GB 2NY6B 3MRCA 4Z7UB 1R3HA 4I4WA 5C0IB 5EBWB 4AIZA 3CSBA 2H9GB 2V5TA 3RTQA 2XZQH 5FYLL 1CK0L 2APXA 5J3HD 3EYQC 4NUGL 4UT7L 3WNKA 1HILB 2DQDH 5I2IB 3DROA 1IGYB 1DTUA 5DZLA 5K9QI 4LFHD 1JHLL 5FKPB 3RVVD 2C1OA 3CLFH 3QXAA 1JZ6A 3H42L 4R7DB 4Z77A 5DSCA 1JWMA 4LQFL 1MCEA 4IEFB 1FE8L 1AKJA 4X80L 1S8DB 2BNQD 5EU5A 4NM4H 3MTRA 5H8DA 1YC8A 1K8DB 1MHHB 1RMFH 5FECB 4I2XB 5HYQA 5J11C 5F3HB 4M5ZL 3ZO0A 1OAKH 3BEVB 3O45B 1U8HA 1LK3H 4RMUA 2AJXH 2JB5H 1UM6L 5FO7B 3D3VB 2F5BL 3QWOB 4JHAL 1AFVH 5KOVC 3MNVA 2FBJH 1OCWL 3BIKA 2AJSH 1NGPH 4JFYB 1L7IH 4LPCA 1FNEB 4ZD3L 1A1OA 1CDUA 1YEHL 5CHNB 2VAAB 4U1NA 4C83B 1V7NH 1SY6H 5FYJL 4MXWH 5C7XH 1LILA 2VXQL 4NDMA 4RGOH 5H35B 4ZTPH 3HLAA 3B4NA 2OR8A 1IGJB 4QXGH 4QOKB 5E8DH 3D39A 2D7MA 5SX5H 4YQXH 5IW3A 1VGKB 4R3SA 4WEBH 4JR9H 1OGAA 3O4LB 1Y0LA 1T22A 4EN3D 2LE9A 2VLRE 3QDJD 4OLZL 3MLSH 2CRMA 3OKEB 1ZKAA 3TIDA 1JWUB 3WJLC 4NCC2 4QRPB 1NLDH 2PN5A 3PWUB 1A0QH 4YXHH 2GW5A 5C0BA 3R4DA 2HKFH 1EA9C 4DKEH 4KK8C 4I5BB 3ARDC 4WW2F 4U0RC 2E9BA 3NFNA 4IOSD 3IKCA 1E27B 3BAEL 2XN9E 5D6DA 5HYSA 3HZYA 4HIJB 3ZMRA 2B20A 3NZ8B 1C1EL 1GAFH 1KJMB 3CFJA 5KW9H 2X10A 5CJQL 2HRLA 3PWNB 2I24N 2Y1VA 3U82B 4G80B 3C60A 5IF0A 2VQ1A 3T04D 2C1PA 5BXFB 4MQXD 4NCC1 5AZ2L 3N1MC 3TWCL 1PEZA 4NO5A 4YX2H 5JQ6H 2CLVA 3SE9H 4JEGB 2D31B 4TSCH 5GS2D 3BWUC 4KY1H 1YDPA 4L1DA 1NEZB 2X2YA 3CMOL 3NCJL 2HJLB 4R4FL 4AENB 2G9HB 2R2EA 5F9OL 5HPOA 5JQHC 1HQ4B 3D9AL 3O4OC 4QYOB 4ZPVB 2FGZA 3O6FD 3VWKB 4NQVA 1CLYH 4KROC 1T20B 3ROOA 1X4ZA 4HJ0C 3TCLA 1OTSD 2O5YH 1OWWA 4XCCL 5LAXB 1U92A 2VZOA 5D93C 1QR4A 4CUCA 4XHQA 5C0JB 1YMME 5DUMH 3T0BA 4JREC 5AAMA 1JNLH 4UUJA 4PRIB 5MEND 3I6LD 5E6IB 2HFFB 4CMHC 5J1AB 3VG0L 2J3SA 3C2AL 4Q9CA 3EYQD 1I1FA 3LB6D 1FVDB 5CGMA 4FQQA 4OZ4B 4HS8H 1INEH 1T0NB 4FQ2H 3UJIL 3HZMA 3HE6A 3DPBA 3O3BB 4XRCA 4XP4L 5CINL 3ALWA 4NRXA 2AGJH 4J3TA 4HC1H 1HHIB 1QSFD 4IIQC 1ZXQA 1S5IL 3BT2H 4AQOA 4CDHA 3QUXC 1KCSL 3I02A 3RL2A 5MEOB 4N5UA 3CZFA 3MRIB 1LVEA 4AEHH 2NY1B 4YEEA 4LPVA 5EWIH 2UV3A 4GG6B 2P5WE 1CLOH 4RMWA 1GHFL 5EO1B 1I3GH 2OL3L 2XFXB 4A6YA 2FD6H 3R0NA 2ZKHL 5IQ7H 4EUPA 3VXPA 4H20H 4AL8L 1UWGL 5HGDB 4BH8B 2W9DL 3MRQA 3TA3C 3UPAA 2AK4D 3MMEB 3HI6H 4DN4H 4QTHA 5CWSB 3VXRE 4Y16C 1B2WL 1WBYA 3SGJC 3QRGH 5TE4H 1E4XH 4Z8FL 3D39E 1YN6B 1B0GB 4GRMB 3L3GB 1M1SA 4W70A 2CD0A 1OGAE 1UENA 4ZAKB 4DGYL 1R24B 2MJWA 4YR6A 1TNNA 1UFUA 4X9HA 3VFRB 2QSVA 3MCLL 4ODHH 2PKDA 3T4AA 3MJ8B 1A7OL 3HG1B 3ULSA 4HMCA 4M8VA 1CGXA 4JFPB 1J1OH 2R1WB 1JK8A 1ORSA 3J7HA 1XCQB 3REWB 5FB8A 4W68A 3O3DB 3TV3H 5GRYA 5SX5K 1CLCA 1PVHA 1T1YA 3VJ6A 5JORA 1I1RA 4NN6C 3T3PE 4P5MB 2EDTA 5ENWB 1B90A 4YHZL 1JV5B 3MRHA 4JG1L 1MFDH 3G9AB 3NIDF 4KK8D 4YHOL 2IJ0C 5DJDA 1MFBL 3ARDD 1FG2A 3JV6A 5F1OB 4R4BB 5HBBA 1G7PB 5BS0D 2HP4A 2CXGA 2WQRA 5SWZA 3MRNA 4QXUL 4QRTA 2E9IA 1UH3A 5MEQA 2XZCH 3MV11 5BVJB 2J8UE 4F15C 3LKQA 4GKZB 1I1YB 1J10A 1NBZB 2HH0L 3VGAB 3GO1H 2QV2A 1A14H 2JCCA 4FQCL 3L3KB 1IGFL 4HJGA 2CUMA 2HLFC 3V5KB 3QAZC 1HOCA 2IH3B 5GS0D 3NMEA 4MNQA 4WTZG 1X6NA 4YIQA 2DBLH 3VFOA 2JJVA 3SPVA 2AJ3B 5K9JH 1TJIH 4E42A 1D5BB 1FGNH 5ETUA 4XVTL 3GRWH 4I8DA 4JN2A 5TJWK 3IDYC 1P69B 4XBGB 4EVNB 1FL6A 4JFFA 4X5WB 4OTXL 2P5EA 4PTTB 1XH3B 5EBLB 2A9NH 2XKNB 3QFJE 4MYWB 5CIPA 3NCYP 2ATPB 1G7HA 2OI9B 2JELH 3MROA 3AMKA 2YK1L 3DMMA 5I75B 4HJ0D 4Z5RA 4MGXA 5TE7H 4FFVD 4TNVK 2BCKB 4LRNH 2X7LA 1UACH 1AO7A 2PW2A 5HJ3B 3QDGD 1VHPA 3RZCB 1SJHB 1F3RB 3LRGA 3UEZA 2EIZA 5IW6B 4PJDE 4TUKH 1YN7A 4PTUB 3QDME 1TJGH 1AR1C 1W0VA 2ADFL 4P3CL 4XMPL 4OD3H 4NQSB 4PJ8B 1MRFL 4Z7UF 5T5NF 4P23D 2ESVA 4PJBA 4POYA 3P40A 5D1ZD 3QSKB 1RIVH 5I6XB 4XNMB 4OLEA 4K3HA 4OLWL 2YWYA 5I1LA 1YMHA 5C0RL 1FV1B 3GHBH 4NP4H 1B0RB 4JPIB 1Q0YH 4Q9QH 3L3DB 5FYKL 4PP1C 1BM3L 3BKYL 4ZO6A 1F3JA 3O6KL 2XQBH 1BQLL 4APQC 5BZWA 1KPVA 1SJEB 3LKSA 1ETZB 3LIZH 1PSKL 3AVEA 4M7LT 1GZPA 3L1OL 1CE1H 4NN5C 3IFPB 3HMWL 4M61B 5ICYA 3C9NB 3V0WL 2VLJD 4JZOA 4K8RC 4WUUB 4D0DA 3WHE1 1U58B 4U3XA 2H6PA 2WLYA 3LQMA 1EMTH 5I15H 4TNWF 4NJ9L 5DMKA 4I18B 4L3EA 2EIDA 3FQUA 5EG6C 4C55A 4L4TD 5EUOF 5EC2A 1T4KB 1MI5D 2B1HH 3C8DA 2BSTB 5CP3H 1MCFA 3G6DL 5DDHA 3K80A 3QUYC 3KXFB 4JVPA 1GGCH 1P9MA 1RURH 2GUOB 3MRGB 2YZ8A 2H3NA 2Y36H 4YNYA 1Q9LA 5AD0A 5HHNB 5IROA 1RQ5A 1QRKA 1ZEAH 1MNUL 1NCWL 4J8RA 4NC2B 2E6QA 1PX3A 2FECL 4XVUC 1OVZA 5IFHH 3F7VA 5FCUL 4YK4B 3BD5A 2APFA 4P2QD 3C08H 3SJVE 1QRNB 5I71C 3ROLA 2FLRT 4M5YH 5DC9B 3PQYE 3MUJA 5INCB 3SBWC 3G5VB 3BPOB 1SQ2N 5ISZE 1L6ZA 4TRPH 2ZCHH 3LKNA 4PRPE 3CDGB 1G7IA 5ADOH 3WKML 2EE9A 2MCG1 3QUZC 1HHHB 1WAAE 1UCTA 2AJVH 4HUUA 3WKNA 3U0WH 3OKDB 4Z7WB 1U8IB 4YDIH 4BFBD 3JWOL 4NHUB 4L9LC 5KVEH 5I9QB 3RNQB 3C5SA 3V7AG 1AC0A 1X5FA 4X6DA 3CDFA 4XBPB 3HPLA 1NGWB 4L8CA 3TO4D 5DRNB 3QWRD 3OR7A 2AK1L 2ZSVA 3D85B 3L9RB 4ZFFA 5H2BB 3DX7A 1FFPB 4OI8A 2WWKO 1AHWB 4AMKL 4YDLC 4G7VH 3V4PL 4IRJB 2GY7B 2HLFD 3TT1L 3OPZH 1TCMA 5F7DA 4AK1A 4TUOB 5IMMB 4K9EH 5IHLB 5IMKA 3WFHA 3MBXL 3M17B 3ULVF 2V7NA 1Q9OB 1ZT1A 4KFZC 1EJOH 1KB5A 4S0SD 1NAMH 2GITB 3IFNH 4XCEA 1I1AC 3ZYZA 2VXUL 2W38A 1SEBB 4GMTH 3G6JF 2DS4A 3TBSA 2MKLC 2XN9D 4FXLA 2DD8L 4FZ8H 5DJYB 2I9TB 1XF1A 4I0PA 1RZ7L 3QEUA 1E28B 3EOYG 4QRQA 3BGMA 1DQML 1PKQA 4WHDA 1TCRA 4Z7QF 5IVZA 4BSWB 12E8H 3E2HC 5D7IF 3DXAD 1AR1D 1LO0L 4WWKB 2X4RB 3GSNH 3ABZA 4GAGL 2QTEA 3T2NL 2ICEB 2Z91A 3MJ9H 3T08A 5EBGA 3LKRB 1OAZH 4NM8L 4OZGA 5EZLA 3OGCB 3MYZA 5E4IA 5C09D 4YHPB 4Y19E 3B5GA 5DJ6B 4OZIB 3T0AA 3GIZH 1D3CA 3DECA 3WHXB 3ZKMD 4NGHL 1IQDA 3AROA 5GGVL 1KTKE 1A6AB 1CGWA 3SO5A 4HUWB 4APQD 4XNXL 2PXYA 3UJTH 2DIAA 1I9IL 4RAHA 5JMRA 1H0DA 3MQIA 1IAMA 3BN3B 5BRZE 3T0VA 3RHWK 1J1PL 3QI9B 1M4KA 3WXWL 4ISVB 4ELKA 3LN5B 1T6VN 4OUUB 1BAFH 1AXSB 4JN1L 1A9EA 3BIBX 5KS9A 2DQJL 2AXFA 4ALAL 4M1DL 5FKAB 3X3FL 5F6IC 1ZAGA 4HPOL 2ZOLB 2DJ4A 1KT2A 2PYEE 2FHCA 1BHGA 1NFDE 2W9LA 3QNXB 2VL4A 2XWTB 3O6FA 3QUYD 2HFGL 5KVFH 3GKWH 4LPXA 3L5XL 2X4NA 4R0LA 4GRLC 1MCLA 2AV7A 2MSPA 2YPVH 3HNTL 1IAIH 4G8GE 5C08E 2QEJA 4NYLB 3KPLB 4JY6B 4L8SC 1KB9K 1YA5A 3MUGA 2R56L 2VWEC 5CJ8A 3ARSA 4DZBB 2R2HB 1A4JA 5MENA 3V8OA 1N4XH 3GSUA 7FABH 2P5WD 1M71B 3P11H 3GZKA 5IB4A 3WSQH 2LU4A 5EOQH 5IBTH 3VH8G 1GIGH 4RAVB 3WEXA 4Z7VB 4AM0B 5GHWH 1ZA6B 4K7PX 1KBGL 3FQWB 3WNOA 2W59A 1ZT7B 3QUZD 4JCLA 1QSFA 4ZFGH 3QEHB 2EE6A 5KTEL 3QIUB 2R0LH 1LO2L 4G8FA 1H15A 1IKNC 1KEMH 4KV5F 3GHEH 1CD1B 1ZOXA 5JLZB 5BV7C 1BD2A 3DNKA 1SM3H 5BCAA 4AQ1B 1JGVH 5DYOB 3DVFA 2B5IB 1N8ZB 4TSBL 2Q8BH 4ZSOB 1A4KA 1ORQA 5EFIB 3EAKA 1FZMA 4U1HA 2RIKA 4RGMC 2NY4B 1FO0A 3ECBB 3BMVA 2VZ1A 4PJCB 3RVWC 1YEJH 2JTDA 3Q6FB 4JZNA 2AJYL 5DD0H 2ZSWA 5J56B 4FN0A 2QSTA 1CFTA 4XAKD 1NUNB 2ZUVA 4URTB 1P4IL 1RZ8A 2DMCA 3CSPA 2FATL 2BMKB 3QNZB 5DS8B 3JTSA 1I85A 4U1SB 4UIMB 1YJDC 4WUKL 1I1AD 6CGTA 1T04A 3OZ9H 3W11C 2E3VA 2DDQH 2VXTL 3WNMA 4JM2A 2OL3B 4P9HC 1KEGL 4PP2B 4OJFH 4QGTA 5I74C 1G7JB 1XT5A 3KPNB 2F58H 1PJ9A 3MV01 1M7XA 1AR2A 3WO4B 1F13A 3O8XC 4OIIH 4WU7A 4OZFB 5D5MB 1RIUH 3BE1L 3BGFC 3SE8H 3U9PL 1YNTB 4HHAA 4C4KO 5DHVA 4KQ4H 4FFZL 3REVB 3QG7L 1RHHB 2XV6B 4H25B 5I0DA 1F8TL 3KYKH 4ELMA 4Z76B 4F33B 2Y5TB 4IMKC 4X6BB 1EO8H 1FL3B 3MV9A 4KRLB 4RISL 5L2JA 1A3RH 2JJWA 3BH9B 1CDGA 3L3HB 2LU7A 5HTSA 1JNNH 5IESL 3TFKC 3WD5H 3UBXA 2Q86B 3D69B 2Q76A 3AS1A 4XP6H 3QFJD 1LEGB 1T21A 4WCYH 1WWBX 4XGZA 1CFQB 5HYJE 3FN0H 2Q7NA 2A6KA 4Y88A 3BRGC 4M93B 5HGHA 2RHEA 3ZDZE 5CEZH 4RBPH 4MAYB 4V2BA 4Q2ZB 4LASL 5FGSA 5B39G 3GK8L 5FYJU 5KS9E 1RIHH 1RK1B 1XF3A 2EKSB 1AGBB 4LRIA 4NHCH 4M1CC 1NCDL 4MJ5A 3PWLB 1VGEL 2ADJB 3E8UH 5F89A 4XH2A 5B3JF 3LKPB 2ZOKA 3NH7H 4NFBA 4PJEB 2ZJSH 5IT2H 1ZVSB 1DE4B 2A73B 4GW5B 4XXDB 1Z9MA 4HUXA 3RQ3A 1IT9H 4TSAH 3HCVA 5FHBH 1QSEB 5E99H 2HFEB 1WCBB 1ZA3A 2G60L 4YBQC 3BP6A 3QHFL 5EZIL 4GRLD 3V0VA 3V4VL 4PRAA 5DLML 2QJDA 1QA9B 2M1KA 3PL6B 3L3OA 5T5FH 2NY3B 5E7BA 2YEZB 1LK2B 3VXNB 2Y25A 5IBUG 1KLUB 1P4BL 2F8OA 4XWGL 3QB7C 1E4WL 1UYWL 1ZLVH 4CDGC 5BZDB 2R2CA 3OR6A 4P23A 5HHME 1RZIB 5D1ZA 5CCKH 6FABH 4S2SB 1IGIL 1LP9F 5F88B 3PWVB 1UJ3A 1EHNA 5JZ7D 1BBDL 1NAKL 2Z4QB 2F54A 5KG9B 2EZ0D 5I1EL 1T3FB 3FQXA 1ZWIA 2P8MB 2ATKA 5EU4A 5IMLA 1I7UB 3G5ZB 2AEPH 4AEIH 1G7MA 4CN4A 4PG2A 3B9KC 2NY7H 1KTLA 3MOBL 3RNKB 3HZKB 3KNBB 4XNYH 2PTVA 2R4SL 2VLJA 2ZUWA 4J4PC 1AE6H 1WC7B 2ICCA 2LVCA 3QCTH 5DD5H 5I8OH 2FWOA 1YYML 3EOAA 2QQNH 3A67H 3BOVA 4KUCD 3VXUD 1OAXL 2Y72A 3EFFB 2JJTC 5ESQA 3SJVD 4U6TA 2EICA 2VSDA 3RVWD 4X6FA 3KJ6L 5IB5A 1MI5A 1JFQL 1CIUA 2D03L 3JV5A 4HDIA 3SE4A 5ISZD 2RFXA 3RDTD 4O4YH 3ARUA 1Y6MR 4OV5A 1PY4A 4PJAF 3OB0H 1UB6A 2B8OT 1KB5L 1JN6B 4XTRC 4KJPC 4UIKL 1A3LL 1I8MA 1U8HB 4JY5H 1JYXA 1TJHH 3LRHA 3UPRB 4P46A 3ARFB 1D9KB 1QFWH 1UZ6E 3FO0L 3CXHK 5KZCB 3MBEB 3CC5A 1HXMB 1RJYB 5FM5O 1AY1H 2VAJA 4JPKH 2OQJA 3BUTA 2R2BB 5ALCH 2Y7QB 1TVBB 5ILTL 2E7LC 2WUCL 1YPZB 4JG0L 4S1SH 1MEXH 1OW0A 4P2QA 5TDNA 4ELME 1J5OH 2GI7A 1G9ML 1TQCB 4X5XA 4UAOB 3TGXA 4KDTA 2DWDA 2I5YH 2KH2B 3KS0J 4Z7NF 2EDDA 4P3WA 4PYGA 1GGUA 1TDQA 3SDXB 3PIQA 1IARB 3T0EB 5TF1L 2VL5B 1MUJB 5DHYA 5CS7A 4C54A 2IH1A 3KPRE 3TFKD 4GQ9L 3MLXL 4PJ7B 4LCYB 1S9YA 4R3SB 5E08L 3FFCD 4BH7B 4Q7DA 1Y0LB 3CVIH 1T22B 1HE7A 3PXHA 4HKXA 4OCRH 2CGRL 3TO4A 1CLZH 4FOMA 4DVBB 2YMXH 4PLJC 3VE0A 4EIGB 1F4YL 3TIDB 1E4JA 4PJ5D 1J18A 2XIDA 5C6TL 2JJUA 4EXKA 5ICZB 3JXAA 5LQBH 3SKNB 1A5FH 5HVFB 5LXGL 5E6ZA 2BC4A 5IIEB 5C1MB 1T7YA 5L2KB 4H1LA 3O2VL 1HQRA 4ODBD 3ILQC 5D1XC 2R4RH 4HGKC 1OM3H 3WLBA 3PV7A 4M1CD 3RIFK 3MJ7B 1T2XA 5C3LD 2CIKA 4WEMB 1OSPH 4E41D 4GBXB 3CCHB 2E9JA 5HYSB 3HZYB 3ES6A 1JTOA 4Y5YC 3MRRA 3WFEH 2GTZB 4KTYA 4PJXB 1S7UB 1RZGA 3G5YA 1CD0A 3DVNB 4OCSH 4I3RH 1IM9D 4YGVB 1X5ZA 2ADIB 2EDWA 2XT1B 4OZHE 5IF0B 2C1PB 1W8NA 4P2OC 3V5DB 5IWLC 3KPMA 5FM4A 4CGTA 2R69L 4NWUH 1W0YT 4OF6A 4PJFA 1R5WA 2W0FA 3BPNB 1IMHC 2HG5B 3GMLB 5BRZD 3FO9A 1QKZL 5GRUL 1CL7I 3F8UB 4KVNL 3W0WE 4IRZH 4F7TA 3DXAA 2C4FU 2YSSB 1U8KB 3IS0X 2B4CL 4NRYB 2F54E 3ZDXF 5D2LB 2APWA 5L0QB 2GJ6B 2VYRE 5C09A 2D7OA 2OJZL 3TVMB 4AT6B 2WZPD 1JPST 3TZVB 2CLRA 1I8LA 4ZFOA 4KZDH 2YRPA 5EZJB 3T0WA 2X4UA 4PJIA 5HHXL 4YWGH 5I8EA 2CMRL 4TPRL 5I73B 2YD2A 1U8JB 2QSQA 2V9TA 4Z7VF 3IU3B 1ZLVK 5BW7A 4IM8A 1E4KA 2FB4H 2X4TA 5BVPL 1AJ7L 1NGYA 5DVOA 5D7KE 2FX7H 4HPYL 1EZVY 4J4PD 3S35H 4QKXB 1J05B 5GIRA 4WI8A 32C2A 1FO0L 1AGEB 2R1YB 3H2WA 5F96L 2JKXA 4CNIA 3Q2CA 2KDGA 2IBBA 2PR4H 2XNAB 1UH4A 4WFFE 4JFED 1I3RB 3ULVE 3GB7A 3RHWF 1GGIL 1FYTB 5JNYA 4MA3A 1EEZA 1DSFL 5DJ8B 5HI3D 2WWKT 4CVZA 1WFUA 3DETD 3QUYA 1QEWA 4WO4A 5D1QD 3R0MA 4GQPH 5C6PB 4BZ1H 4N8VA 5ANME 3G6JE 3K46A 2DAVA 3V6FB 4N8CH 1S7SA 3NCFB 5D8JH 4XC3H 2ICWJ 2MTPA 4NFCA 4ZNCD 4JZJC 4ORZC 1FAKT 3HC0A 1J7VR 4NKDA 1KJ2H 5IW1B 4D0CA 1AXIB 2HVKB 2PNDA 3UO1L 4LPUA 3FB6A 1BJ8A 5D7IE 5E8PB 4NNXB 3OKLB 3CSYB 5D2NA 4BQ9A 1WV7T 4H88L 5FYKU 5D5MF 2GT9A 4LPWA 3RL1A 2QQQA 4YHNA 3EFDH 1T83A 3N50A 2AXGB 4HD9A 3L3IB 4Q6IC 4YR6B 5IKCA 3HR6A 3SDAD 5F9AC 4PGCB 1WT5A 4X6CA 3FOLA 3EJZD 4YDJA 2UWEB 1K2DB 1RHFA 1INQA 3WFBH 1UQSA 4OBRA 1FNSH 2FX8H 4GG8B 4PLJD 3S34L 4GRWH 3MV8E 3QA3B 1CICA 5FXCH 2BDNH 5JORB 1GXEA 5C0AB 1JHTB 2YA1A 3MLWL 4ODSL 4UINL 1MCDA 2DQCH 5GS0L 4UU9A 5MEPB 2UYLB 3MRHB 4UBDC 2IGFH 2M2DA 3ILQD 5D1XD 4K3EH 5DJDB 1GC1H 3MLVL 1INDH 1FFRA 4KZEL 3RJDA 3U79A 1UA6H 3H6JA 4JB9L 3FKUS 5ESAB 5IHZA 3KHOA 1FCGA 2BOBA 3BPCB 4JRYA 1DBBL 1QFPA 4IJ3C 2ICES 5FHAL 3LKQB 2G2RA 5T1MB 4HIEB 5KANG 3PHOB 5EU6E 5C8JA 3IFLL 3RVUD 3H7LA 4OKVA 4PJEF 3O3EB 2HJFB 3DURA 3DVIA 2ZCLH 4P2OD 1KCVH 2BY0A 4Y1AD 5EU7C 5CD3B 2FO4A 1L0YA 3VW3H 3UJJL 4E42B 5ECJE 1MF2L 4H8WC 4JPWL 5ETUB 1NDGA 1A1MB 1OY3B 3IJSA 4K94L 2OXGA 4JN2B 4MNGB 3BEWA 2HKHL 15C8L 2X41A 4JCMA 4V1DB 3WV0A 1T80A 4QRSB 5CIPB 2DQGL 4HBQA 1G7HB 5ACMA 2IFFH 4XBEL 3MROB 3OBAA 3VG9C 1T5WB 2FZ3A 1CFNA 5FA4B 2MCPL 4AEFA 4U1JB 3FTGB 5HY9B 2B1AH 2E7CA 2X7LB 1FFQA 3GJFH 4HIXH 3KYOA 3TO2A 1KLGB 1R3LA 4X4MA 4P5TC 2WP3O 3OXSB 4P2RD 1VA9A 4UT6L 5T33L 1F02I 1FSKC 3RX8A 4OLVL 3TH2T 1FIEA 1Y18A 3EO1A 4JFHE 1CK0H 1KYOK 1OGTB 3QPQD 4Y5VC 5EOTA 4JVWA 4HEME 4EZMA 4I48A 3AM8C 3E1F1 4RQQA 5GGVY 1JHLH 4RIRA 3OAYH 1K8IB 2WMPA 1U8QB 4WDIB 1Y6NR 4P0DA 4LQFH 1QQDA 4HX1A 4QHNB 3RWJA 4G7YL 2DJUA 3MZTA 3DGGA 3GFUA 4X80H 1NBQA 2EYTB 3DHJA 5B8CC 3VMNA 5HGBA 1A6PA 4D0DB 1G7LB 1CDHA 1D5XA 1A6UL 5JW3L 5E8OB 3RWHB 5EZOL 5C0DB 2H6PB 3IGAB 4MNHB 1F11B 1JTPA 5HDOA 1G6RH 3QJHA 3O9WA 1UM6H 2VIRA 2F5BH 3VRLF 5IBUB 4JHAH 4OKDA 2H32A 3O6ML 2Z9TA 4OLXL 1XGUB 5FO8A 4MQTB 5DRWB 1SBSL 1JPFB 4ZD3H 2DMBA 3KYMA 4NQEB 4XMKL 4JJ5A 3EJYC 3FOMA 1QPPA 1YPZF 5A16B 3H9SB 5F1SA 3L95A 2A74A 4NT6B 2HTLC 5FYJH 3VXSE 3ULVC 2R0ZL 4DKFH 4DGIH 3PWJB 5I0ZA 4UILL 2YN5A 2ZPKH 2KZ1B 2VXQH 4PJ9B 4RMSA 4C4KT 4CVWA 4YAQB 4J8RB 3K7UA 2Z31C 4QWWC 1Z5LB 3N85H 1UXWB 1DFBH 1RK0B 1W72H 2XG4A 1IC7L 1BQSA 2BFVL 3B43A 2D9CA 1WLHA 4X0KA 3X13A 1S7QB 3IDIA 2Y23A 4N9OB 4PJ7F 4U6HB 3TBTB 3LEXA 1DLHA 3VXUA 1FBIH 1QLEL 3QBTB 4TVPE 2ARJA 4OLZH 1KOAA 1EH9A 3DX8B 3ARBC 3X12B 4YXLL 1UT9A 3HA0A 3ZE2E 4PJHB 5FGBA 1U3HC 3WUWG 4HUUB 4RWHA 4I1NB 2BNQB 4UBDD 4P4KC 3RDTA 1I7ZA 4TVSa 5T3XH 1RJLA 2C7UB 1MHCB 1UM5L 3C6SA 3UTPE 2BNUA 2YRLA 3UTTB 5I1GH 1JCKA 3KPRD 2NTFB 3BHBB 5H37G 4MMXC 3L6FA 1LO5B 4UB0H 2VO5A 3BAEH 3ZYIA 2UY7A 3IDNA 3K8LA 3F12B 5I1CL 1JNHA 5DUBA 5J57B 3IS1X 4DCQA 1CYGA 2VLKE 5F70A 3LEYL 3IDJB 4PJXF 5CJQH 2HN7A 4QXWA 4CVUA 5ITBL 2QHRL 3MSPA 1ZT1B 2VUOA 2CDEB 4UOW0 4ZNEA 5AZ2H 1KB5B 3HE7C 3HAEB 1NMCC 3LAFA 3QISA 3TWCH 2FGWH 4GXVH 1LP9E 3D3VD 1NC4A 4M9OA 3ARPA 1K3ZA 3MRDA 3NCJH 1N5YH 4R4FH 3TBSB 5J13B 1KJ2B 3D9AH 2F19H 3SEPA 3CMGA 1DN0B 1LE5B 3C09C 4L4VB 2Z93B 4ZFOL 1ZHKB 2FYYB 5EU3A 3FFCA 5D2LF 1T89A 2CKNA 4EN3B 5DFVC 3QDJB 5IVZB 3WDIA 4PUBL 5KVMC 5KSAC 4XCCH 4BQ6A 4M7ZB 2IANA 2D0HA 4EI5B 4LGPB 4P5TD 1IL1A 2DQUH 4PJ5A 3MRPA 4LHUG 5D7SL 4F9PA 3VG0H 1IZJA 4KJQC 1RZFL 4M3JA 3STBA 3GJFK 8CGTA 3MV7D 2EIEA 3STLA 4NQDA 4FXGB 2VR9A 4F2MA 3J8F7 4DTGL 1IQDB 2OBGA 1KPRA 2Q1EA 3OKKA 4XP4H 5CINH 1J12A 1CL7L 3LDBC 3S97C 4LHJB 4NC1E 4U7SA 4W6WB 3SKMA 2ITCA 5DJZB 3KYAA 1V3JA 2FBOJ 4CU7A 4BSVA 2NW3B 2V5MA 4QRPD 5CEYB 2PUQT 2DI7A 3INUL 1IM9A 1HIML 1LHZA 2IBZY 3UYRL 3I6KA 3RIFF 2X4OA 4F7CA 4G3YH 3R8QA 1NSNH 4RZCB 4WHYG 1BJ1H 4ELKB 1M6OA 4E0RB 1KF9B 1XMWA 1N59A 1OF2B 1VFBA 5D7KD 4Z78A 4AZ8A 3RWEA 4GKSA 1RUPL 1GHFH 4CAGA 5E7FA 2R9HC 4MJIA 3FQNA 1ZLSL 4MQ7B 2ZKHH 2ICWI 3GSOA 5JW4N 1HN1A 1NGZA 4MSWB 2R1XA 3QJFB 3OKNA 3O6FB 1C12B 4YHLL 2HFTA 1NLBL 3EJYD 3SDCB 5GZOC 1WVZA 2X4NB 1N5AA 2J8HA 1PQZB 3SCMC 3ULVD 1W2KT 5CSZA 1B2WH 1C5CL 1FAIH 2VDRL 4HG4K 1CDJA 5EDXA 4K2UL 3U6RB 2F8VA 2AV1B 2AXJA 4ZOBA 4F7PA 1OT2A 4FA8A 4KHXL 4Z8FH 1FZKA 4ZO7A 1GSMA 5K9KA 3I3EA 1I1CA 2Z31D 4QWWD 2FIKB 4LEXL 5MENB 3MA7B 1XF2B 2JJSC 1JI2A 1NJ9B 4LCWD 3GSUB 4YGAB 1XIWA 3W82A 2M26A 4XCFL 5JHDB 4RNRA 5F9JB 5AYUH 4FP8H 2OSLA 1IFHL 5H37H 4XMLL 5CLWA 2FJHA 1EHLL 3MCLH 3VWKD 1OPGL 1JZ2A 1WIPA 4MX7A 3LEVH 4L5FH 3QCVL 3GSQA 4XZUA 3K4DA 2EDEA 2UWEF 3L5JA 2BK8A 5JPMB 4QHUB 5LCVL 4BFIA 3VXMD 4D9QD 4UT9L 2KKQA 3ARBD 1QD0A 2O93L 3KLAA 1WITA 1AGDB 4ONFL 1U3HD 4JFEA 4OLUL 5K9QG 4KHTL 2R0WL 4P4KD 4ZXBC 5IBLC 3S4SA 4OAWB 1NCBH 2ICWA 4KMTL 1JBJA 2BVQA 5E6ID 3Q1SL 4EBQL 5J11B 4YHZH 1IAKA 2ZG1A 4QF1B 5D1QA 3OKOB 4YHOH 1I7TB 1MFBH 4WW2A 2PTTA 5KSBB 1MCOH 1HYSC 4BZ2L 1QPXA 1F4XH 3DRQA 2R39A 2E6JA 4QXUH 1FO0B 1FNGA 3FMGL 5ID1A 1CXLA 4R26L 4JFQB 1CZ8H 1U3YA 1ZHLB 1XGYL 3G6AA 3RGVC 1NCAH 1FC1A 2ZSWB 1CFTB 4KTEH 4ZS7H 1IGFH 2AK4B 1S3KL 4DQOL 1BVLA 1FZOB 4FS0A 1K9TA 3QH3A 1ZANL 1VEMA 3QFDA 3H0TB 1ZS8B 5BO1L 3OKMA 4F57H 4G8EA 2D4DA 4K23H 1LO4H 2VH5H 1CQKA 5EOCJ 3C87A 2PTUA 1S7VA 4M7JL 2XYCA 1YQ2A 1XR8A 2LVEA 3WE6A 3GGWB 4JANB 2WWMC 1R5IB 4HWBA 1S78C 3SDAA 4HK3N 3UP1A 4BA8A 1BP3B 1OHQA 4WU7B 3KR3L 2IANE 1KTRL 4CW1A 5DD3L 3MRKA 1T7VA 3U2SB 2HT2D 5KSAD 1XR9B 5D7LB 2SEBB 4F7MA 1AD9A 4RGNE 2V5RA 4L3AA 3O41B 4NO0B 4Y4KA 4NQDE 4WHYH 4K8RH 3BXNA 2ADFH 1F4AA 4P3CH 4XMPH 1MRFH 3W5MA 4HKBB 3PGFL 3ARDB 3UBXB 3MACL 2MQCA 1T21B 5BS0B 1JF1B 4DWHA 3G04B 4HUVA 3CK0L 1XF5A 5HVWA 3ZDYE 4F9LC 2EC9U 5FYKH 4ODWA 3BKYH 1MWAA 3O6KH 3B8YA 1N2RA 1BQLH 4LSSH 2FR4B 1CF8L 3W9EB 2DQFB 3WXVL 3EOBA 3BMWA 3V0WH 4TOYH 1MREL 1NFIB 1FRGL 5HD8C 3HC4L 5E94A 5DMIH 5HHOE 2CQVA 2LU3A 1WCQA 4OSUL 3NFPA 5F7EH 2R9HD 4LGRB 4R7NB 4G6MH 4UDTA 1JMZA 4JFHD 4NJ9H 3TJEL 2VZSA 2MOVA 1BJMA 3O4OB 3HCVB 2ZUTA 3D0VA 4TUJA 3P9MA 2FEDC 5DQDL 4KI5E 1ZA3B 1Z3GL 5GZOD 3MFFB 3G6DH 1UB5B 3SCMD 4DJMA 4KROB 4S1RL 2W60A 1ZT4A 2AABH 2VRAA 3HI1A 1FNHA 3BW9B 5D93B 2BVUA 1FL5B 1UZ8A 4JREB 1D5ZB 4KK6D 3QDGB 3QHZL 4P48A 1MNUH 1J0HA 4CMHB 1NCWH 5HHPA 1QLRB 4F3FB 3I9GL 3CVHA 4P2RA 4XB7A 4D8PB 4EUPG 2D7PA 3NTCL 5ICXA 4P23B 5FCUH 2DI8A 4ETQB 1UXSB 4PY7B 2CLZA 1R0AH 2C26A 4GW1A 3P4LA 5F3BA 2Q3AA 5CEXA 1YY9D 25C8L 4O2FA 4IIQB 4JDTL 3HUJB 1JGLL 2IMNA 1HXYA 4S1QL 3QUXB 1SYSB 3BZFB 5C0GB 2FHBA 3HPJA 4X6EB 4HZAA 2BRRL 4XWOD 5IBLD 4O9HL 1A2YA 4PJHF 3X11B 3MLUL 5E8NA 1PKOA 3MRFB 2VISA 2VLJB 4PJ8D 2F53D 3LHPH 4XCYA 4N1HB 2XWBB 3DYOA 4F58L 4M6ML 1FG9C 3NACL 4MA1C 3M8OL 4FQIL 2RQ8A 4RDQG 4YHMH 1OD9A 1GOFA 4HMEA 4IRSC 3PJSA 4NBXB 4L4TB 1A9BA 1MI5B 1KIPA 5IB5B 4AMKH 2DLGA 3O2WH 1L0QA 1YZZA 4NZRL 3TA3B 4XNQB 2RFXB 4DW2L 8FABB 3QEQA 2EO1A 4A2LA 5FM8A 1JRHL 5DMYA 3HRPA 2MFNA 1J0IA 2DI9A 4I77H 3V7MA 4HKJA 3MBXH 3MCKB 5E56A 4Q97A 5IV2B 4PJGE 1JUFA 3CC5B 3I6GB 5E03A 5F44A 1F42A 1U36A 1H5BC 2VXUH 2WWMD 4KRNA 2DMKA 1R5VA 2BY2A 2DTML 5TDNB 4LKCB 3LCYA 3GBNL 3RX7A 2J8OA 5DR5L 1DLFL 2DD8H 4M8QA 3DVGA 2DLIA 4PV9A 4XP9H 1PZ5B 5DVMA 5GRJL 1RZ7H 1MIML 2V2XA 1DQMH 3RVXC 3VMOA 1YUHA 2OS7A 2A6JA 2FJGB 3PIQB 4NN6B 3VXQA 1HDMA 3WS3A 4ORGB 1DZBA 3DSFL 1OSZA 3BRDA 5J6GA 2MWCA 1LO0H 4ONGL 4GAGH 3T2NH 3ULUL 4Z7UA 5C0IA 5IB1B 3S36H 5EBWA 4MA7H 1SJXA 2H9GA 4LL9A 3BDBA 4C56D 1KJ3L 2WP3T 1QVOB 4G6AC 4O02L 1RJZB 1ERNA 2JE8A 3EOTH 4L29B 5CSGA 1HILA 5I2IA 1S9XB 3JZ7A 3UYPA 1IGYA 3QR2A 2NZ9D 3QWQB 4NGHH 1MLBB 4F15B 1E6JH 4PY8J 2PO6C 4WWID 5FKPA 5GGVH 3TF7C 4R7DA 2KZWA 5IUSA 4XNXH 1I9IH 4PD4J 3QNYA 2VLRB 3BP7B 1UM4L 3QAZB 2BC4B 1ZGLB 1F3DH 1NKRA 1S8DA 1HQRB 2ILLA 4WI3A 1K8DA 4RGNC 1J1PH 5FECA 4HS6A 4NOBA 3UDWC 5TFSL 4YFEA 2IPUK 4I2XA 4P57B 2HRPL 5F3HA 2Z8WC 2GFBA 4A6YH 5C0CE 3NCYS 3O45A 4BYHA 3IDYB 4JN1H 3QO1A 2A0LC 4ALAH 3MRRB 3D3VA 3QWOA 4EUPH 3D85D 5EIQA 3SGDI 3X3FH 3EJJX 5HYFA 3U46B 2BNRD 4HPOH 1X5JA 5DMJB 4JFYA 3DX6B 3G08B 4Y7MA 2XN9B 1T5XA 2YXFA 4IRJD 2XI9A 1FNEA 5FDYA 2UVFA 2VAAA 1WIOA 2FIRT 2Q8AL 3L5XH 4AH2B 3RUGE 4C83A 4EKXA 2W0FB 4OCYL 1I7RB 3S98A 5E2VL 4F7TB 4KJYA 1BQHG 3DXAB 3MODL 2R56H 5H35A 4PB0L 1TETL 3ESVF 4HF5L 1CTOA 5F9DC 5I1AA 1LEIB 4LLVA 4QOKA 4LAJH 3K8MA 5GRVL 4OFPA 3ILPB 3CFCL 4NBZB 1VGKA 2CLRB 3MV7A 3BDYH 5HXMA 1ZTXL 5D70H 3IU4L 1BLNB 3O4LA 2AQ1A 2HVJB 4DK3A 1ZLWK 4BFEA 2A9ML 4KPHH 2AEWA 4APQB 1JGUL 3OKEA 4N0UA 3RWFB 1JWUA 1NGYB 3DYPA 2XZAL 4NN5B 5B8CA 2OJEA 4QRPA 5IB3B 3PWUA 4FMFA 4DN3H 1YJDH 3QZWB 5GIRB 5MERB 3IDXH 4TSBH 4LEOB 3TBYB 3T4YA 4I5BA 4IBLT 2X9WA 3S9DB 4CNIB 5DGQA 5K9OB 4NPYB 5HI5D 4LFHG 4YDVB 4FRWA 3EKCA 4HIJA 2H41A 3F58L 3NZ8A 5E95B 2HMIC 2AJYH 4LSPH 1KJMA 4FQLH 3QUYB 3C6LC 2HLAB 4G6KL 1AQDB 3MC0A 2D7TL 5IGXL 3PWNA 2AKRB 2VERN 3EO9H 2GJJA 3OJDA 4G80A 1P4IH 4U3CA 1TTUA 2DYPD 5T3ZL 3RI5K 3EDKA 4M43L 1S7SB 5BXFA 2NW2B 2UUDH 4UTBL 4N90D 1L4IA 1ONQB 4FABL 1ZMYA 3KPTA 4HWBL 3WN5C 2BXZA 3RU8H 4UTAL 1J87A 1ADQL 2D31A 4LCWA 1KEGH 1NEZA 3NCMA 2YBRB 2P5WB 4AENA 5I71B 1EXUB 2G9HA 4FNLL 1L9NA 5FUZH 2I9LB 2BVYA 2NZIA 3P3YA 5JXEC 4ZPVA 4LARL 2EXYC 3VWKA 5C07D 3UC0L 3ZHDA 3KLSA 3U9PH 1K4DB 3RVXD 2N7AA 1T20A 2NXZC 3VXMA 3QG7H 4K9EC 4J2XA 4OCXH 1F8TH 3QUZB 4JQXC 4XPBH 5LAXA 1MFAL 1U3HA 2YN3A 3P30H 4PRIA 3U7YL 4RISH 3BQUC 5IKCB 3AREC 1OAYL 4L9LB 3CFEB 4KC3B 5E6IA 2HFFA 4IHOA 3LMJH 5J1AA 5FO9B 3PE9A 4G6AD 3H3PL 3V4UL 1T1ZB 3PDOA 3MLTA 1FVDA 1U8NB 1GZQB 2F74B 3LQAC 3GBML 4OZ4A 3QRFM 1MWAL 1T0NA 2PO6D 3O3BA 5CEZE 3VI3F 3E3QE 3MO1B 4YDLB 3GIVB 1J86A 3T8XB 4QTIL 1HHIA 3WS6A 3V6BR 3QIUD 4LASH 3D18A 2VZ3A 4KTDL 3GK8H 2BXYA 4C57C 2GKIA 1RUMH 2JF1A 3MRIA 3B2VL 2A1WL 2EYRB 3LKOB 5IVXF 3FFDB 1RVFL 5INDB 4X4YB 1I1AB 1IILE 4GG6A 1VGEH 5EO1A 2G2RB 4U1LB 2NY4D 1AGFB 2NCMA 1HSAB 5ID0B 3DURB 3RY6A 3P0VL 1R3KB 3QQ9C 3OJVC 4OCWL 2J8UB 4L9DA 5HGDA 2NY5L 4BH8A 2G60H 4X83A 3EDJA 3HNVH 1ITCA 3D1MC 3MMEA 3VD5A 2O61B 5CWSA 3UTZB 3V4VH 2WUBH 4X99B 5KSAA 5DLMH 2VDMH 3IJSB 4Z7OF 2XXMB 2MPAH 3E2HB 4CN1A 1QFUH 5AWNL 5FF6B 1YN6A 3CVHL 4GRMA 3L3GA 5HHOD 3LV3B 4QRRE 4Y8AA 3TNMB 1I9JL 3ORJA 1DVFD 3VFRA 2FZ3B 1CFNB 1IGIH 3MJ8A 4HWNA 3HG1A 4P9ML 1TNMA 3QFJB 2PCPB 1DUYA 5K59F 1HYRC 5I17B 3VFGH 1NAKH 2R1WA 4CBPA 5F7WC 3RAJL 1XCQA 3REWA 5I1EH 5DO2C 4RX4D 2YUVA 4YDKL 5GRXG 4K71C 4F8TA 4GMSL 4JRXE 1KB9J 5IJKC 3HUJF 3RZWA 1ZHBA 1DQTA 5ENWA 2DQEL 3V5HB 2X5PA 1CCZA 2R4SH 4G5ZL 4K3JL 3VXTB 3HFML 4PJDB 1JV5A 4MCYB 4NCDA 5I19L 1YYMH 5C2BH 4R4BA 1CU4H 4HAFA 5F6IB 1EO7A 1G7PA 5I16B 5C3TA 3B9DA 4XCNB 1QQDB 4Q9RH 5BVJA 3HC3H 1SYVB 1PX4A 4GKZA 1Y6KR 1I1YA 3WJJA 1XGPA 1YEIL 2VDOH 3F5WA 4Y5XC 3ZTNL 3L3KA 1AP2B 4GRLB 5BQ7B 2VC2L 3V5KA 2IH3A 2GSIA 5DJAB 4UIKH 1A3LH 5IJVB 3Q3GB 2AJ3A 4L8SB 4M1GL 2H32B 2V5YA 1D5BA 5FO8B 1UEYA 3SDYL 4XBGA 4EVNA 4X5WA 1YNLL 2J4WL 4JVUA 1AD0B 1H8NA 4PTTA 1XH3A 5ILTH 5EBLA 2UUDK 4JG0H 1MJJB 2EXYD 4JJ5B 1QSED 3A6BL 1J1XL 1JWSB 1DQQB 1N0LA 2A74B 2C3GA 1ZVYA 3LD8C 1IAOB 4H26B 2AEQL 5T1KD 5C92A 3VFPB 3U0PB 4YBLC 5EN2B 4LCIH 2BCKA 1T03H 3IETA 4P3DA 5E2WL 3V6OE 4GLRI 1VFAB 1PD6A 3BQUD 4LNRB 5HJ3A 3WO3B 3FQRB 3RZCA 1SJHA 4GAFB 5BV7B 4QCIB 2BERA 5IW6A 1N6UA 2VE6B 4S1DD 4QY8B 2N56A 4UNTA 3NPSB 1GYAA 3E0GA 4GQ9H 3MLXH 5HPMB 3KJ4C 4PJ8A 4NQSA 5E2TL 2F53A 3FZUC 5E08H 4XNMA 2CGRH 3T1WA 1QBMH 4RGMB 2AERT 1FV1A 2R15A 3RKDD 3SJVB 3OAUL 1B0RA 4JPIA 3NABL 1RZKL 1F4YH 1F6AB 2FX9L 3L3DA 3PQYB 3O3UN 4LU5L 3LZFL 3WFCL 1Z9LA 1SBBA 43C9B 1XGTB 5C6TH 4PY8I 1HHJA 5CD5C 1MAMH 3CX5K 5ISZB 3RDTB 4J3OC 2BSSB 1SJEA 4PRPB 1ETZA 4JRWA 1DBML 2YD3A 5LXGH 1KGCE 3IFPA 3UTQA 3DUSB 5EC1A 3C9NA 3C6SB 3O2VH 4WUUA 3H7BB 4YFLI 1P4LB 4OQTA 1VACA 1V3MA 3L6FB 4NJAH 2CIIB 1PG7W 1HINL 2CKBB 5I74B 1I3UA 4XX1G 4I18A 3EYUL 1U93A 2NX5E 4HJJH 1UJTA 3CLEL 1PBYA 2BSTA 3BGFB 3K81A 5FM5M 3E3QC 2GJZB 1VB9A 4LSVL 4GAYB 1X5KA 4M3KB 2GUOA 3WNPA 3MRGA 5L8JB 5HHNA 4E9LA 5FCSH 1AGCB 5JMOC 3TN0C 2B4CH 4HEPG 4YC2C 1NMAL 4YEFA 1GCFA 2VNCA 4C56A 1QRNA 3JSSA 2OJZH 4HIIB 3KHQA 4ENED 1OAUL 4LSQL 5INCA 3TH3T 3G5VA 5DO2D 2CMRH 3DI2B 4NUJB 1ZE3C 4PJ5B 3MRPB 2E27L 3CDGA 4BUGA 4OGXL 4Z95H 1HHHA 1WWAX 5E9DE 1JYWA 4HPYH 4G6JL 5M7QA 4LVOC 1U8IA 4NHUA 4WI9A 3RNQA 4OF8A 2W9EL 3L5HA 4KQ3H 4E41B 4XBPA 5IM7B 1NGWA 4MS8C 3MR9A 3O2DH 4YFDB 2XOTA 5IEKB 5DRNA 5F7KC 5F96H 1JE6A 2YPLE 5CGYC 4Y19B 2ITCB 3D85A 5H2BA 4HWEL 3R06B 5LWYL 3HI5L 5DD6B 1AHWA 4J3UA 4HC1A 1GGIH 5HHVH 1DSFH 4IRJA 4CMMB 4XP1L 2OP4H 3WIHA 5SWSD 4OFDA 4ZS6C 1M6OB 3RY4A 1B4RA 1N59B 4WIQA 1ES0B 2YR3A 1VFBB 4AYFA 3RWEB 2DLTA 5BRZB 3M17A 2AP2A 5T1DL 1Q9OA 1XGQA 2BVOB 1A7PL 4PB9H 3VWJC 1ED3B 4ZPTB 3LS5L 1C5BL 2GITA 2VB5A 2X1QA 3GSOB 3LN4B 1NGZB 4HMDA 4FQJL 3F7PC 1WTGT 3WYRA 1MPAL 1SEBA 3OAZK 2PYEB 1F6FB 5DJYA 2I9TA 1NFDB 5CKAA 4XPGL 4EDWL 1E28A 3FJTA 1A3QA 3UZVB 3BWAB 4BSWA 3ZT6A 2VDQH 2XPGB 3CXHJ 3B9KB 4LDOB 1VESA 4WWKA 2QADC 2X4RA 2DQTL 1F90H 2YD4A 4G9FE 4AG4L 3NPZB 3OGCA 1QBLH 1EGJH 1EFQA 1R3JB 4GRWE 3GUTB 3TVMD 2WINB 1VDGA 5DJ6A 3IXAA 2C3HA 5TPWL 3S34H 5JOEA 3S5LG 4K7PY 3WHXA 4X7EC 4OI9A 3BI9X 2DF3A 3KLAB 4P5KB 3X14B 3IDGB 3VMPA 1A6AA 35C8L 4PLKC 4WUUE 5CD5D 4HUWA 3MLWH 4NO2A 4ODSH 3S4SB 4UINH 5EOCL 2XWJB 3THMH 2N7BA 3VGDA 4PRBB 4NQCE 1IEAB 4I3SH 4H8WH 1E0OB 3V6OC 3I2CL 3EDFA 1CGSH 2XA8L 4ISVA 3KLHC 2ZZUT 3T3PF 4OUUA 4LVNC 1G0XA 3KYNB 4HXAL 4MLSA 1DBBH 3ME0A 4R6UA 4UV4H 5FHAH 5FKAA 4WU5B 2H8PA 3KXFE 2ZOLA 4TTGA 2G75B 4YLQT 2YPKB 5CEZD 3RI5F 2FJFB 2KL6A 2XWTA 1DDHB 3QH3B 5J6HB 4X9FA 2J8UF 4OCLC 5CJ5A 4H1LG 2NY1C 4HSQA 3UJJH 3B83A 4OFYD 3OL2A 4XNUL 2J5LC 4K94H 3V6ZB 1X4YA 4NYLA 3ZE1E 3KPLA 3QQ3A 4JY6A 4IDJL 1QRNE 2HKHH 5E1HB 2PETA 15C8H 3GRWA 4HS3B 4DZBA 3U36B 2PF6A 2R2HA 3ZSTA 3SDAB 4X5LA 2DQGH 4CN6A 1QYGH 2Y6SC 2LAAA 1M71A 1GL4B 2XRAL 4OIBA 2MCPH 2DLFL 3KPSE 4KU1A 1NGQH 4Z7VA 1L9MA 3AAZB 4XP5H 3RPIB 3FO1B 3FQWA 3GSRA 4Z7WE 1ZT7A 1T2QL 5DRZA 3SE3C 3BO8B 3QEHA 3PDGA 1F4HA 5FYLE 2IG2L 4GUPA 3QIUA 3IF1B 4UT6H 5D7JD 4QHMA 1KIRB 1TIUA 1CD1A 2DOCA 1OLLA 2LAGB 3U4EA 5D1XB 5JLZA 4ZAKC 3T0DA 3JWDC 5IVNA 5DYOA 2JIXD 1N8ZA 4MS8D 3B5HA 4PJDF 4QRRD 4Y5YB 3EZ8A 3ARGC 5DI8B 2BOCB 5GS1C 5HI4D 4ZOCA 5EFIA 4FQPA 2VMFA 1N2RB 3ECBA 4PJCA 3EYSL 4IOIB 2B39A 3H9YA 3Q6FA 3CH1B 4P2OB 4LLMB 1OL0A 4NM4L 4Y1AB 1KCUL 1RMFL 2VOTA 5A2JH 5FK9B 2DB8A 3UZEA 4JRXD 4D3CL 1KPUB 3SGKA 1DJSA 1OAKL 2VLLB 5E94B 2BMKA 3QNZA 5DS8A 2AJXL 3D2UD 4AIOA 3VFUB 4U1SA 4UIMA 4W4OA 2FBJL 4BQ8A 2DLEA 3FB5B 3UCRA 3X3GL 2AJSL 1NGPL 4NRZB 3VFSB 5F1NB 3R1GL 1SBSH 5FGCE 1G7JA 5FYJE 3FAWA 2P8PB 2GCYB 4XMKH 1DVFA 3PHQB 2WBJC 2W0KA 1V7NL 3HI1B 4OZFA 4MXWL 4LKXB 5D5MA 1F45A 3CFDA 4MCZA 3U4AA 3FCTB 4N8VG 3REVA 4GFTB 4R8WH 5C7XL 1UKTA 1RHHA 4RX4A 4H25A 4RGOL 4Z76A 2GAZB 2Y5TA 4UMGA 4X6BA 1FIGL 2QADD 1MCKA 1CGUA 2K1MA 1FL3A 5CP7B 4OZIE 4IOFC 1UVQB 1IC7H 4YQXL 1HEZA 3BH9A 4WV1C 1XCTB 2CLZB 3BIAX 2BFVH 4WEBL 4JR9L 3NN8B 1QZ1A 4JO2H 5DXWA 2Q86A 3D69A 4RDQF 5I18L 5I75C 1HCVA 1LEGA 1FNLA 4LLYB 1CFQA 2ORBL 1P7KB 4YXLH 4TTDD 1CS6A 2HWZH 1NC2D 1JZ5A 4Q2ZA 2VISB 4H1LH 4O58H 4WTZA 1A7NL 1CR9H 5AG8A 4OQTL 4KKBD 5DWUL 3ZSSA 5LGJB 1RK1A 4FTVE 5TF0A 3KLHD 2K7PA 1WAAF 4JZJB 5J4MA 1R6VA 3MA9H 1KIPB 3LKPA 5I1CH 5KVDH 4PJEA 1CVRA 1ZVSA 4GW5A 4LCCC 4ZDHB 2H2PC 4XXDA 2DQHH 3T2OA 3QG6B 4BZYA 1T7ZA 3SGEI 1NFKA 1MCPL 3LEYH 2IPKB 1QSEA 1TZGL 2HFEA 1WCBA 3DUHA 4K3DH 4QLRA 5ITBH 4BQCA 3BX7C 5T1KA 5EPMB 1GC1C 1QA9A 3SE9L 3PL6A 4J23A 4TSCL 4Q6IB 1GPOL 2YEZA 1LK2A 2ZUYA 2EH8L 5CKGA 3VXNA 1QSZA 2Y07H 3SKJH 1KLUA 4Z6AT 3S88L 2Y6SD 4PBWD 3DVGB 3SY0B 1BOGB 4FXKB 5BZDA 5GJTH 2OMNA 2HJKA 5JOPE 1RZIA 3V9FA 3ARWA 4S2SA 1CLYL 4JFOB 2G5RA 2V2XB 4OBSA 2NXYC 4KI1A 1J8HD 3PWVA 2WANA 3BGAA 3QULB 1KJVB 4PRHE 4RFNC 2Z4QA 4GJTB 4PUBH 1AIFB 5KG9A 4R97C 3E6HB 3WS3B 1A47A 5DUML 1T3FA 1OSZB 4PJ9D 3PP4H 3QIBC 5E8EB 2P8MA 3TPKA 5DK3A 1I7UA 2J88L 3G5ZA 4NKIH 1U8MB 2L4OA 4ZSOE 5AUMB 1HSBB 3WIIH 1MY7A 2Q7YB 3RNKA 3HMXH 3HZKA 3KNBA 1T2JA 3NIGE 4EIZC 1JHKH 4PJBF 1OTTC 1WC7A 3KPRB 4HS8L 1INEL 4PJCE 4FQ2L 4S11A