2I9PA

Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with nad+
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
293
structure length
293
Chain Sequence
MPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-hydroxyisobutyrate dehydrogenase
total genus 108
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.31: 3-hydroxyisobutyrate dehydrogenase.
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2i9pA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2i9pA01
2B4RO 4AJNA 3GZNA 2NVBA 2QHXA 4P22A 3RAJA 1PGJA 2X6TA 8ADHA 2OP0A 5JDIA 5DN9A 1P0CA 3WG9A 5MDHA 2CVZA 3C7DB 1NX6A 4KQWA 4QECA 4BNYA 2NACA 5HS6A 4PN3A 3I9LA 2WD8A 3R3JA 2RHRA 4JP3A 1LDBA 2I6TA 3PFFA 5BQFA 3ZU4A 3HJAA 2IXAA 5CPBA 1QYVA 1P77A 3RBVA 3A1NA 4NBTA 1Y5RA 3QSGA 4CMEA 3NGXA 1OZAA 4AJPA 3U49A 3Q0EA 2ZCUA 3AU8A 5THKA 1A71A 2GN4A 1R0SA 4HUJA 4Z3DA 3JQ7A 1HRDA 2NU8A 3MJ4A 3ANNA 3PWZA 4BO9A 3ETDA 3LC1O 4R5MA 1SAYA 4ALJA 4CODB 1GZ3A 4M1QA 2HUNA 4PLHA 5AXCA 1EUCA 4DQXA 2O4CA 4LCEA 2C0CA 1PWZA 2GDZA 1B16A 1GDHA 2D8AA 4DVJA 4OIMA 1BVRA 4NR0A 4JN6B 2PLAA 2B4TO 4Q3DA 4K28A 2P2SA 1ORRA 3ZWNA 3DXFA 1YB4A 1I3NA 3MJSA 4QFCA 4QO8A 1E3IA 2H63A 3GDFA 1E1KA 1FMCA 4QT0A 1YDEA 1HYGA 1NPDA 1EZ4A 4OH1A 4E13A 1WPQA 1RKXA 1NBOA 2J5KA 3RBXA 1YVEI 1I3MA 4HFJA 1WMAA 5ITWA 5G0SA 2AEMA 2ET6A 3V2GA 5MGBA 1B2LA 2PD4A 4PZEA 2B0JA 4JBIA 3F4LA 4DWVA 4Z0HO 1PZHA 2D5AA 3AFNA 3WWZA 4BB5A 1HSOA 1DFIA 2I5PO 7MDHA 3ONEA 4J1NA 5JCJA 3U5TA 1I2ZA 1WZEA 3M1AA 3WQRA 2AG5A 1WDKA 2UUOA 4Q3NA 2YV2A 3FWNA 1VC2A 1Y8QA 2BMAA 3MOGA 4NNJA 4II2A 1LLCA 3T7CA 3PPIA 1QV7A 4G5HA 3CPSA 4IUYA 5LDGA 3ZWAA 3MEQA 4L76A 4O0LA 3GAFA 4WUVA 3ZWCA 1CRWG 2IXBA 2JCXA 1DRUA 4YQYA 3QVTA 4WCFC 4PLGA 4BKUA 3FPLA 4UVIA 3OEYA 1ADBA 1LA2A 1DFGA 3KB6A 3VTZA 2RH8A 3GEGA 4RO0A 3LYLA 3Q11A 1X7DA 2WYUA 4RDIA 1UXGA 4MKXA 1H6DA 1I3LA 3HFGA 4FJ2A 3SJ7A 4J16A 5ER9A 1SB8A 4ZQBA 5EL0A 3SC4A 5U4QA 2PD6A 4Y6RA 4PG8A 1J0XO 3OJ0A 4CM5A 2C29D 3KO8A 5G0VA 4LK3A 4GX1A 4J2OA 3DBVO 1X7GA 3JD4A 1FDUA 1A7KA 1SC6A 2C82A 3D5TA 1UDBA 3M2PA 3SXPA 2YV3A 2DAPA 2C5EA 1VSVA 1SNYA 2PR2A 4F3YA 1E7MA 4XWYA 4WNCA 1ZSYA 4IPTA 5K6AC 3PYMA 5GZ6A 4NQZA 3I9KA 4JIGA 3C7CB 4JK3A 2PD3A 2O7QA 4OQZA 5TNXA 1ZXBA 1EVYA 4IQGA 3GZNB 2IZZA 2G82A 4IY1A 1ZVMA 4GVLA 2GCGA 2NU9A 1BXKA 4QXMA 4XJSA 1HE5A 2VZ9A 1MG5A 2H9IA 1Q0HA 4IMRA 5CG2A 3H6KA 1Z7BA 4CLOB 1IUKA 4L4SA 4BNKA 4YAEA 2OOSA 1DB3A 4RF4A 5TX7A 2W2KA 3VPHA 3PYLA 4IJVA 5CHEA 4WLUA 1WDLA 4R16A 1B3BA 5CFZA 3ZWBA 1ZK1A 4GLOA 3S8MA 3BMOA 3WQSB 1ZBQA 4BGEA 4J4BA 2X0IA 3GMSA 3GT0A 1WWKA 4DLBA 1E7WA 3K8ZA 2D5CA 3ETGA 3I9JA 4LGVA 4NU5A 4CMGA 1MB4A 3RSHA 3VH4A 1A5ZA 4NK5A 4OSOA 2Q50A 1DBVO 3NRCA 2PV7A 3OECA 3TZQA 4DLLA 2VHYA 4BNXA 1F14A 4AG3A 3WR5A 3DR3A 3D64A 3GHYA 5HWSA 3OFSA 1QXSA 3AJRA 3PHJA 1VJTA 4YT5A 4Z0TA 1UP7A 2Q99A 2DTEA 3KSZO 1PR9A 1N8KA 2GYYA 2X22A 3M1LA 3MJCA 5DP2A 3OETA 4LW8A 4NG5A 4Q9NA 3QWAA 1P31A 1I24A 1R4NB 1AGNA 1YS4A 2B37A 2V6FA 2ZB7A 5JNLA 2PKQP 3L6EA 3MJTA 3Q3CA 4WPGA 1NVGA 5T57A 4PFJA 2X5JO 4R3NA 5DT9A 4DREA 5JXWA 4MKRA 1IOLA 4DBZA 2VHVA 5DOZA 3OEWA 1E0DA 1QYCA 2VCYA 3GPIA 5F1PA 4CM3A 4ZQFA 1FJHA 3DAFA 4FFOA 1QLHA 4RPKA 3ROMA 5A3JA 2VNSA 1SPXA 3RQSA 5L3ZA 3IIEA 4B3JA 5G4KB 2CDBA 2PKQO 1MX3A 1IYZA 4XZ3A 1MC4A 1DIHA 4WNIA 5LC1A 2PWZA 4BS9A 3BMNB 1VE9A 3PRJA 3IKTA 2JD0A 2LDXA 2V65A 2Y68A 3BYZA 2I65A 4CUZA 5ICSA 1U3UA 4XGNA 1LDEA 2EF1A 3QHAA 2XXJA 3ZWYA 1K2WA 1Y8RA 4UVEA 3GF4A 4WLVA 5L4SA 2PK3A 1WVGA 4PZCA 3ANLA 1SB9A 3W6UA 4H3VA 2X4GA 2Y05A 4D3DA 5L7TA 3HB5X 1PR3A 3WS7A 3I4FA 2C2XA 4O6VA 4J7CA 4W7HA 4BKOA 4YCAA 3K31A 2PGLA 3FR8A 2PGJA 4Y98A 4JCOA 3NKLA 4YT2A 4TKMA 5JMPA 1V6AA 2WD7A 1P74A 3GGPA 1T1SA 5C7LO 4XQEA 1TI7A 5L40A 3P2OA 2VUUA 4RVDA 5C37A 4Q39A 4BGUA 2O7SA 4XYBA 3IOYA 4RVHA 2GGSA 1C14A 1UZMA 4B8WA 1AHHA 2EW2A 5L4NA 1M66A 3ADPA 1ZUD1 3QIVA 2IEBA 1YQXA 3PDJA 4JJIA 1HWYA 3PGXA 4XEHA 3ETEA 2R00A 4LCJA 3MTJA 4XQGA 1I01A 1I30A 2OGUA 4E2XA 3WJAA 1B8UA 3V1TC 2X0JA 3QV1A 3HDHA 1MXFA 1U3VA 5F5LA 3VPSA 5KVSA 3PVZA 3LT0A 1ZMOA 3PJEA 2Y0EA 1LC3A 4GVXA 3JYOA 2IEDA 1O89A 3OIDA 4XRGA 1IPEA 3DAGA 3INGA 5ES3A 4E5MA 3GVHA 1ML3A 3VVCA 1PJCA 5TLSA 4PCVA 1NASA 1P45A 2O50A 2DM6A 5ILGA 3S55A 6LDHA 1UXIA 3ULKA 4G2NA 1LSOA 1I36A 4L73A 2EKQA 1YDWA 2W4QA 2Q49A 3FNEA 1GQQA 4E6PA 1LSJA 4CQLB 4U6SA 5I9MA 2BH9A 1B8PA 3PTZA 4AICA 3PZBA 3JQDA 4B3IA 3K5PA 1PQUA 4NHEA 1ZH8A 1QSGA 3RUIA 3NT2A 4YB8A 2WEKA 1QP8A 4WLNA 1G1AA 2HMTA 1HLDA 1WNTA 4D3SA 4IIVA 2ZTLA 4II3A 3LT1A 1TXGA 5JE8A 1SCUA 2Y93A 3C8MA 3AI3A 5C7IO 3GGGA 4UEOA 3GDOA 1TLTA 5IZCC 1T26A 4BO3A 5THQA 4DC0A 3ENKA 2YHUA 5EINA 5JPIA 1WAMA 3GFGA 2X9NA 2ZIZA 4F46A 2PGDA 5KJFA 2Q4BA 3TWOA 2OXIA 5DULA 1JDJA 2PKRA 1ZIDA 2NTJA 3RASA 4L74A 4WE3A 1DJQA 5EQFA 4I5DA 1P9LA 1PQPA 5BR7A 2ZQYA 1PU2A 1JVBA 1E7YA 2B5VA 1YBVA 5F1OA 4RGBA 2GD1O 1E6EA 4F6LA 3WGOA 5JYEA 1F17A 4IS2A 1J6UA 3ASUA 3DOCA 2HRZA 1DO8A 1K0UA 4TQGA 5JDIC 4TVBA 5JW6A 3HDJA 4BNWA 4FSHA 2WYWA 3UGKA 2WSBA 1RPNA 3DFZA 4AJ4A 3SJUA 5I7VA 2Q3EA 3HHPA 4XB2A 4RL6A 4IQ8A 4DTIA 1NWHA 1ZK3A 1ZNQO 2GSDA 2PZMA 3BTUA 3IC5A 3RBZA 1ARZA 4RORA 2DUWA 1KOLA 4A7PA 1P1RA 1I8TA 4GGOA 3RUCA 1I10A 2X23A 2F00A 3NTQA 5JY6A 2Q2QA 2OORA 3WSVA 3OJLA 4CLEA 3GVXA 3RUHA 3TQHA 5H82A 5CG1A 3DFUA 1GUFA 1P1JA 4CL8A 4PG5A 1SO8A 1CF2O 4MIEA 1NYTA 3PXXA 4UVHA 3AM4A 3DTYA 2NQ8A 3O8QB 1QKIA 4HWKA 4P38A 1U4SA 3OQ6A 3Q6IA 4YJFB 2EV9A 1Y1PA 3HNPA 4I5EA 3D3WA 3DZKA 2Q2WA 3H4VA 3RC2A 4XYLA 4YVFA 2G76A 1VL0A 4J49A 3WLFA 5JAZA 1DC3A 1YE3A 1E3WB 1FK8A 3JQCA 4P4GA 4MVJA 1T24A 1ISFA 1B14A 1YBMA 4HKTA 3COSA 3AM5A 1KERA 4M87A 5HBRA 4YRDA 3K92A 4HNGA 2WMDA 5F1KA 3I52A 1R66A 1UJMA 3CXRA 3OH8A 3PJDA 1JU9A 3PP8A 4P8RA 3GLQA 4OOFA 2P4HX 4BNFA 3L6OO 4TKLA 4GSLA 3ZW9A 2HMWA 4URFA 4B7UA 2RH4A 4ZHSA 2BFAA 1Z82A 4ND3A 1A4IA 1Y81A 2ZK7A 4R1SA 4PLFA 4QUKA 3DZGA 2J3IA 1NQTA 1YKFA 3ZNQA 3JCZA 4PLWA 4D41A 2IRWA 2NNLD 1ONPA 4J1TA 3AK4A 3D3WB 3QQPA 4BNZA 3JD2A 4NDNE 5TSDA 3WBBA 2ZYDA 1I2CA 1OOEA 3CIFA 5AXDA 2I3AA 2YHIB 1GU7A 5T8KC 1BGVA 4KWHA 1KVUA 1O94A 1UUFA 1KIFA 1T2EA 4TWRA 4INAA 4PLCA 4ROSA 4KMSA 2I9PA 3ZWOA 4JXKA 4YT4A 5B4UA 3RU9A 1RJWA 1DAOA 4B3HA 4M89A 1E3LA 2FZEA 1GUZA 4LMPA 4RJTA 2Y0CA 2HMSA 1N9GB 4IINA 4ZN6A 4BGIA 3D0OA 3R6DA 2D1YA 3AI2A 3QVOA 4TZTA 3UH1A 4BO5A 4ZJUA 2SCUA 1QMGA 3RC1A 3O03A 1L1FA 3H65A 5TT0A 4OKNA 5JMWA 4B8ZA 3W4IA 4S3MA 1Q0QA 3G79A 4BMSA 4CV0A 3C1TA 4YRAA 3HWRA 3ZV3A 4E2WA 1JLLA 3PJGA 1UDAA 4PLZA 5H83A 4NJMA 3LF1A 2X86A 1YJ8A 5CEEA 2NU6A 1A27A 1LQUA 1JA9A 2VHXA 5G4LA 1UAYA 3OJFA 2CUKA 4P4NA 3JQ8A 1VRWA 1PL6A 4YQZA 1A7AA 4BKQA 3GVPA 3PWSA 2UUPA 4PLYA 4EJMA 1K6JA 4JP2A 2EIHA 3FCOA 4D79A 1ADFA 3DOJA 3PDUA 4GX5A 4BQRA 3QA9A 2VWQA 1NHGA 3AFMA 1XSEA 2CZCA 4QTZA 4RF2A 5KTKA 3KYCA 4ALIA 3D5QA 2BF7A 1NQAO 1NFQA 3V1UA 3VOSA 3WGHA 1QYXA 2VN8A 2XOXA 3D3EA 3V2UA 1LDYA 3AY6A 3EVTA 1KEUA 3UCFA 1LRJA 2Q4EA 2WJPA 3A4VA 3AI1A 3JQAD 4XRRA 5A03A 2UYYA 1D4FA 3PIDA 5IDQA 1I33A 2BD0A 4YR9A 2W2LD 3TRIA 3FBTA 4CMIB 1W4ZA 2HAEA 3INTA 1HSZA 3DMYA 3BMQB 2FZWA 4J1SA 2OL4A 2YUTA 1ISIA 4QX6A 4IZIA 4XB1A 2D2IA 4J2HA 4EDFA 3R1IA 3VHRA 4GQAA 4BO0A 3VVBA 4I8XA 1GUYA 4ITUA 5B4VA 9LDBA 2QYSA 3ZHZA 5I7SA 4H16A 5BNTA 1ZJZA 1PZGA 2QZZA 3EY4A 3NUGA 3MZ0A 1GEGA 4NU6A 1TT5A 3RJ5A 1NPTO 2UDPA 1NAIA 1ZJYA 3SBOA 4BO8A 3K30A 4FDAA 2EGHA 3BXXA 2POQX 4PG4A 3UVEA 4CM9D 1GV1A 2JFGA 2D59A 3G17A 4XIYA 1SMKA 3LC2O 4RLHA 2O3UA 1R16A 4EJ0A 3SLKA 3PQEA 1GV0A 5JDCC 3TN7A 1JWAB 4UUPA 1A9YA 1NR7A 3B6ZA 2YFQA 3WIEA 2Z5LA 1ZZEA 4OKIA 3L4SO 3WMWA 3OJEA 5KOIA 4H7PA 3ZNOA 4NJMB 1CQJA 1LEHA 2XPCA 1YB1A 2VUTA 4DYDA 1QRRA 1X7HA 2NLOA 5AXBA 1BVUA 4H15A 1DLIA 5EMHA 1W73A 3EZYA 4L75A 4XQCA 4PIVA 1ZSVA 4F6CA 4GWGA 1IY8A 4P4LA 3GG9A 3WMXA 1C1DA 2D3TA 4J3FA 3P5SA 2C2YA 1V3TA 2P9CA 5JY1A 4CQMB 1E6UA 4CV1A 1ZKMA 2DC1A 3OA2A 4CMCA 3TF5A 3L77A 4OXNA 3PK0A 3WX0A 3EDMA 2P5UA 2VUSA 1C3VA 3WDSA 3QWIA 4GGPA 2J3KA 1ZMTA 2A9FA 4KDEA 4N7RA 4CLRA 4EEXA 2DPHA 3GZ4A 2ZKLA 1GZ6A 2FSSA 4Z3KA 1FDVA 3RJ9A 2ZYGA 1MFPA 1JAYA 3DL2A 4EEZA 4KP7A 5F21A 4Z9XA 1M75A 2R2GA 4D46A 1NP3A 1U28A 3W8EA 2GN9A 2CNBA 4MVJF 4TRRA 2EGGA 4YJFA 2FWMX 3H5NA 4TRJA 4CQMD 5B4TA 5COQA 4O59O 5KVCA 4KDFA 2EKLA 5F5NA 2BELA 3GNSA 1QV6A 9LDTA 1MGOA 5G2OA 1DOHA 1HDRA 4EGFA 1UDCA 1LQTA 2EHDA 2IZ1A 2E6UX 3ITKA 3PFWO 3BMCB 4Y8VA 4CQLA 3QRWA 4BKPA 4AJKA 2P9EA 4CV2A 2QG4A 3E6AA 2W2LA 4CR7A 3QWHA 1U5CA 3WWYA 4IJUA 1VI2A 5C7OO 1GFSA 5ENVA 2RIRA 3CSDA 4U8GA 1E7QA 5JO0A 1KVTA 3ZW8A 5HRUA 2HRBA 3PHHA 4IZHA 3VPXA 4BNHA 1Y6JA 3BTSA 2HJRA 4NJOA 3ROQA 3H3FA 4D0SA 5ICMA 3AY3A 3JQBA 1XLTA 3UW3A 4DIBA 1YXMA 2EXXA 3CEAA 3NDIA 3TPCA 1BXGB 3G49A 1NHWA 1GEEA 4EI2A 4BB6A 1F06A 1LXCA 2EW8A 3CTVA 4IDDA 2Y1GA 2FPIA 1HETA 1VJ0A 2GRAA 3QY9A 4XYMA 4HX5A 4NFHA 4MIOA 3EMKA 1OI7A 3C1OA 1PIWA 1DFHA 5GMOA 5L7WA 5I7FA 3NT5A 5L95A 4CMBA 3LLVA 4Q3AA 3BA1A 4UREA 1FF9A 3FNFA 3ZNPA 3E18A 1E92A 5JSFA 3OSUA 2VWHA 1YO6A 1BXGA 3TZ6A 1TA4A 4LRSB 2X5KO 2QZ9A 4A73A 1PEDA 5DOVA 1HL3A 2WM3A 3VPFA 1E77A 1HTBA 3O9ZA 5A9TA 1GPJA 1F12A 1NVMB 2HLPA 2YDYA 3GEMA 3CZRA 5FI3A 3BZUA 4BV8A 5CDUA 3OBBA 1OC2A 1NPYA 3FWZA 4XYGA 2PH5A 2FR1A 5A02A 5JCXA 4HFRA 3WICA 2GLXA 4TRNA 2IYPA 1X14A 2E48A 3LF2A 2HKIA 4PLVA 2YFHA 3KEOA 4LVUA 1PX0A 3CMMA 1Q7BA 4RLSA 1KEWA 1MXHA 3H7AA 3TL2A 1VKNA 4BVAA 4E3ZA 2DTXA 4RPGA 2YY7A 4UUOA 4OAQA 1LI4A 3BIOA 4LN1A 1TT5B 2Q2VA 5A5FA 1U3WA 3LC7O 4YYZA 1MLDA 4RVUA 2AW5A 4RDHA 3QVWA 4QFDA 3JYQA 3EGOA 3DBRA 3RIHA 2QQ5A 2NVUB 3B20A 4CUKA 3GNTA 2E49A 3BHMA 1XQ1A 2Y1CA 4RV9A 1YJQA 1U2GA 2JHGA 3BTVA 1LBEA 4HNHA 3NTRA 2FN7A 3W6ZA 2OP1A 3DO5A 4BIIA 1C0LA 5AOVA 1H6BA 1D1SA 1N5DA 4IDGA 4IDBA 4B4UA 4MVJE 3N74A 1PGQA 1R4MA 3AY7A 3WQQA 4ALKA 4KZPA 3ZN2A 1GQ2A 1N9GA 3OJOA 1ISJA 4YJHA 2OZPA 4JJGA 1GYPA 1ZCJA 4W99A 5I8ZA 4D43A 3L6DA 3FF4A 3K2EA 4GKVA 3VDQA 4BNMA 2GUGA 3DBHA 5JS6A 1FDWA 3KTDA 2WE8A 3AOGA 1DLJA 1HE3A 3HG7A 3DZFA 1F0YA 1IZ9A 2Q1WA 3I6IA 1L7EA 5JCJD 4A0SA 2YYYA 2DBZA 3H9GA 1C1DB 1KYQA 4NMHA 4DA9A 3AUAA 1PJ4A 2CDCA 3IP1A 3F6YA 4CLOA 4ND2A 5K0ZA 5FWNA 2BI7A 4Q3EA 4LSWA 3GOHA 4R68A 4DLAA 3EUWA 5DP1A 4YJHB 4FOOA 4CL3A 4MPDA 1IHYA 4FC7A 4NFYA 4R3WA 1YRLA 2Z1NA 5BSEA 2GASA 4Z6KA 4DUPA 1YH3A 1EMDA 5FYDA 3E9MA 4X54A 1W6UA 1SOWA 1JWBB 4E5PA 3Q2KA 4Z9FA 4U6QA 3X2FA 4B79A 4DRYA 1KC1A 3VKVA 3VZQA 4K6CA 3DC2A 2FP4A 4Y6SA 2NV6A 4MVJI 4AJ2A 3V1YA 3AM3A 3I5MA 3E5MA 3ZCXA 3HDQA 4IDFA 4JBHA 3HADA 1R4NA 2NTVA 5KWEA 2Q45A 4XIJA 5IZ4A 1V9LA 1EFKA 3QVSA 3NEPX 1DEHA 3KV3O 5T5QA 3INRA 1RYDA 4E5NA 3VAZA 1LDMA 3RC9A 2PFGA 4L9RA 3TJRA 3NDJA 1MV8A 3OM9A 5JDCA 4NBVA 4IXWA 4R1NA 1WDMA 5T67A 3UAGA 3EAGA 3TZKA 2VRBA 4HV4A 1G6KA 1HYEA 2WD7B 2A92A 4JX8A 1GL3A 3HN2A 4PZDA 1D7OA 1WLYA 5IFLA 3PLRA 1ENZA 3B70A 4E2YA 3KZVA 4J9VA 2Y1OA 4CM8A 3A28A 4RPJA 5ILOA 2RAFA 4XJTA 5GY7A 2FMUA 4GH5A 1QORA 4ZQEA 4DC1A 4EUFA 2I99A 4NIMA 1QLJA 4UAGA 3ZV5A 3IL2A 5HTOA 3GHHA 1QYDA 3GN1A 2J3JA 3HDYA 2BI8A 5TT1A 2ZATA 3KSUA 4W4TA 1YGYA 1DC4A 5COAA 1LJ8A 1CETA 4PLPA 4OJNA 5FEUA 1BDMA 3ASVA 1GZ4A 2DBVO 3TFQA 4AJIA 3O8QA 1EVIA 2ZB4A 3GG2A 4GKBA 3PZRA 4JLWA 2VOJA 3WGGA 4DQVA 2VYVD 2PH3A 4I9NA 2VYND 4EW6A 2J3HA 3SVTA 3EZLA 4E2ZA 1BW9B 4OMUA 3QWFA 3F1LA 3KYBA 5G0WA 3OICA 2V6MA 2C20A 2XXBA 1GQYA 2AHRA 5B12A 1OFGA 3UKOA 1E3WA 3DBLB 1Q0LA 3IDSA 2IE0A 3CUKA 4Y9DA 1DIRA 1I2BA 3FBGA 1AUPA 4CM1A 1YQGA 3ZNNA 1LU9A 5L51A 3JD0A 5BSFA 3C85A 4NZ9A 2EWMA 3PYXA 1ENYA 3OMLA 1V8BA 1YBAA 4OGWA 1GADO 4XDZA 4OM8A 3O38A 3MWEB 3L4BA 5F3RA 1Y5MA 1XCBA 3MWDB 3ENNA 4R4JA 1Q2XA 4I1IA 2Y1EA 3LU1A 5EJ2A 4DIOA 4OHUA 4IGEA 3JQ7B 3Q9NA 3WBFA 1HKUA 2AQIA 4XR9A 3FD8A 3EC7A 2HSDA 3DONA 3TOXA 3C3XA 7ADHA 4W7IA 4CLHA 4EZBA 3G0OA 1LDGA 3TZCA 4A2CA 1KY4A 2G0TA 2VNAA 3H2ZA 3ZH2A 5I8WA 4PRKA 1GCOA 1PJ2A 5EERA 1BXZA 2A4KA 3GH3A 3RUEA 3B1JA 1XKQA 4XCVA 1EQUA 1UH5A 2ZJ0A 3KVOA 3F4BA 2DU8A 1ZO8A 4QO7A 1C0KA 4TMFA 3D4PA 3V2HA 1AE1A 4MIYA 4RF5A 1EQ2A 3RVDA 2HQ1A 3WNQA 2GO1A 2O48X 3NV9A 2EKPA 3CE6A 2PA3A 4WCFA 4J4TA 3MTGA 5JAIA 3DZJA 4YAKA 1V0JA 5BNIA 1IPFA 3I6QA 1YL6A 4WLFA 4MOWA 4OXYA 5COBA 2NM0A 4XR4A 1IZ0A 2Y0DA 4WJZA 2B4QA 4DXHA 4GI2A 3NX4A 4E30A 3GC6A 4FQ8A 4OOEA 4RZIA 4L0QA 1XU7A 2V6BA 3KXDA 1NQOA 3NAQA 1EDOA 4UULA 4BMVA 5L9AA 2ZJ1A 4OL9A 4CM9A 5GZ3A 5KNLA 1NFRA 1FDSA 4CM4A 3E82A 3F5QA 3DHYA 3ANMA 4YJGA 2Y99A 1T2FA 3WTCA 1MUUA 1UZLA 3GPDG 1K6XA 2O3SA 4ESOA 5DCYA 4DGSA 2Y66A 4O1MA 4FFPA 4ZVVA 1IHXA 2O3TA 1NM5A 2JCYA 1QR6A 3UXYA 1MC5A 2W2KB 1CJCA 2IDZA 1DIBA 3WTBA 3UICA 3DZHA 4IJKA 1E3EA 3VC7A 4IDAA 4GMGA 1DPGA 3JV7A 2VYVA 3A14A 1GYQA 5IDWA 3GN2A 4HFMA 1AXEA 2QRLA 1HDOA 4YBZA 2C59A 4CM8B 1IULA 1HYHA 3F46A 1ISHA 4A10A 1HT0A 2QRKA 3QVXA 4BNTA 3WGIA 3T4XA 3LVFO 1T2CA 5KJEA 2Y1FA 3AOEC 3TFOA 3LZ6A 4BV9A 4ZGWA 1E1NA 5JAQA 2ZCVA 4BGVA 4LRTB 4PVCA 3W4KA 4CM4B 3MJVA 1C1XB 3RUDA 3KRTA 4MVJM 2DUUA 3DDNA 5DF1A 3I1JA 1VKOA 2CSUA 4RVSA 1EEHA 4XD2A 1I32A 3RU7A 1L7DA 1ZEMA 4FBGA 2QIOA 3K96A 1XDWA 4XQ9A 1HDZA 1KS9A 1J49A 4CMKA 1VJ1A 1JVSA 2WTBA 1HDGO 4XDYA 5A9SA 5BT9A 5L7YA 4CLDA 3H2SA 2VZ8A 3WXBA 3OIGA 3ICCA 3KYDB 4GLLA 2IYOA 1Z75A 2HK9A 3NYWA 5KVQA 5JC8A 1GPDG 4DBVO 3WYBA 2IZ0A 3L07A 1HLPA 3HE3A 1M2WA 3GNQA 3FNGA 3D1LA 2W90A 3LLSA 1WMBA 1HXHA 4DMMA 3K9QO 1CQIA 2I76A 2VYNA 2AE1A 5IF3A 4A26A 1IL0A 4HBGA 1NNUA 1PS9A 2H5LA 1WXDA 2X58A 4UVGA 5IZCA 4XX0A 1LX6A 2AXQA 2HMUA 3L4BC 1GTMA 1ZFNA 2EP7A 4FOSA 5JYDA 1FXSA 3ZHXA 3GY0A 4EITA 1N1GA 4O63O 1B26A 1Y8RB 2O3QA 1E5LA 1ZSNA 3GA0A 4M86A 4DMLA 3F5SA 3GEDA 1J4AA 3ON5A 4R1TA 4HFNA 4NBWA 5DCUA 3E03A 5KJCA 4J0EA 3IP3A 5A04A 3FR7A 3ADOA 3TSCA 4M49A 5H81A 4BNNA 2VZ0A 5FF9A 2EP5A 4W9NC 3ZWVA 5GZ1A 3GUYA 3ZGYA 2AQ8A 2A35A 1XELA 3AUTA 2P91A 4GWKA 1LLUA 1EE9A 4EYEA 3FN4A 1XWFA 4PVDA 4GX0A 4N54A 1P33A 3GRKA 1Z6ZA 2GERA 1SEPA 1E1MA 3LQFA 3UUWA 3H9UA 2VHZA 2X7HA 4PLTA 3EHEA 5IG2A 1H9BA 4J7UA 2C7GA 3CKYA 5DDIP 3D4NA 4TROA 1UP4A 2CVQA 2ZQZA 3H8VA 1H6CA 1U3TA 1RM3A 1E6WA 2AE2A 1EVZA 2AQHA 2ZTMA 4CR6A 1P1KA 3VTFA 3WYEA 2BHLA 4B7XA 1ADGA 2X5OA 3WLEA 4DL9A 3JQEA 3LT4A 5DBGA 2UAGA 2JAHA 4NBRA 1BMDA 1LSSA 3QW2A 5A1TA 3PQDA 5I9NA 5IDYA 3JSAA 5TIIA 5HM8A 2CDAA 2GZ2A 3B1KA 4YPOA 1T4DA 1EBFA 2CY0A 1E3JA 2FOIA 2DT5A 2A94A 1NQ5A 3DZIA 3IMFA 5EESA 4AJHA 4NH4A 3PHGA 3DMTA 1U8FO 2F1KA 5TRTA 3ZHYA 1KEPA 1G0NA 4C7JA 1M76A 4FFNA 1CDOA 1U4OA 3ZU2A 4TVOA 4AJEA 1KBZA 3H3JA 3KSDO 1E3SA 4R9RA 1NWCA 1YOVB 2GZ3A 3FRJA 4KQXA 3W8FA 3PEFA 1T2AA 1FDTA 3JQ9C 2FY8A 3WFIA 3BHIA 3JQ6A 5L4LA 3BMOB 4ZQHA 5CDGA 4AL4A 3RFVA 3LT2A 4YWJA 4YACA 1GYRA 1XYGA 2J8ZA 1BWSA 5LDHA 3VZPA 4MKZA 3OP4A 1X13A 4E12A 2BGKA 4ND4A 4CV3A 1ZEJA 4YA6A 5KCZA 2JCVA 4R1UA 3ZWMA 2YV1A 3JYLA 3GVCA 4RZHA 4WASA 3FSRA 3TOZA 3TDKA 3ROKA 4WCFB 1DC5A 3LK7A 4NK4A 2C07A 1ZK0A 1H94A 3FI9A 1XQ6A 3JQFC 1LRLA 2UVDA 5JC1A 2OMEA 1UP6A 3ZWWA 1SZJG 1XHLA 3F1KA 5TJHA 2JKVA 2YZ7A 4GSKA 5ER6A 4Q3BA 4F45A 1RM5A 1N92A 4S1VA 4YTEA 4ONEA 2NQTA 1Z73A 4U7WA 4K26A 2GR9A 4MP6A 3U4DA 3NDRA 3FTPA 1AHIA 4OO3A 1DIAA 1SOVA 1XG5A 1EK5A 1RWBA 2D4AA 3ORFA 1B0AA 2G5CA 1KVQA 2V6GA 3Q9UA 1Q7CA 3VH3A 4N5NA 1ENPA 4G65A 1D1TA 1KVRA 1RM4A 3I23A 3T4EA 3QLJA 4IMPA 4FS3A 4R9SA 1PZEA 5HS4A 3BAZA 2BFPA 1A4UA 1MP0A 4AVYA 2HK8A 1T1RA 3KETA 4ND5A 1U7HA 2VT2A 2BRUA 1P1IA 3BMNA 4K6FA 4ID9A 5TC4A 2AQKA 3ZV6A 4AJLA 3JQAB 4E0BA 3M6IA 1EUZA 1UR5A 1IB6A 2V7PA 4CM6A 3D7LA 1C0IA 2G1UA 3L9WA 4FFRA 1E7RA 1VL8A 4E5KA 3DHNA 4JNKA 3WIDA 2Z1MA 1K6IA 4J91A 3GR6A 4WOKA 5JFOA 5KKCA 5TS3A 2FR8A 4XGIA 4RVFA 3SC6A 4LSMA 4WGGA 3H9EO 2DBQA 2NUAA 5EN4A 4YDRA 3L0DA 4CJXA 1TEHA 3OQ1A 3GGOA 4R41A 3E1KA 5KKAA 2E4AA 4Z9YA 1BRMA 1HDCA 4U0JA 4XGKA 2W8ZA 1F8FA 3GFBA 1GAEO 2O2SA 4G81A 4ILKA 2AA3A 1B15A 2GN6A 3PQFA 3GRPA 4I5FA 2QW8A 1VPDA 2WE7A 3PI7A 2CMDA 1BSVA 4OYRA 1BHSA 2TMGA 5LCXA 1MG0A 1S7CA 1HZZA 5CP8A 2HDHA 2EJWA 2C54A 2PZLA 3BTOA 3CMCO 1QG6A 3STHA 1Z45A 3FPCA 3E9QA 1OMOA 2R00C 3P19A 3I83A 1XIVA 2VQ3A 3C24A 3VZRA 4D44A 4AFNA 1V3VA 4C7KA 1VM6A 2DLDA 2YQ4A 3OA0A 3V8BA 3WYCA 1TB4A 3IKVA 4BNGA 2R6JA 1EE2A 2JJYA 4MP3A 4QEDA 1BDBA 4MJLA 4BKRA 4BNJA 1AN9A 1RYEA 3RFXA 1LLQA 1HZJA 4FCCA 4YJGB 2OHXA 3NTOA 3GDGA 4BMNA 1I3KA 4WEQA 2AEJA 2FRDA 2OUIA 2YJZA 5KJ6A 3S2GA 1X0XA 4N5MA 2DVMA 1U2DA 2VTDA 1BG6A 4JBGA 2WWRA 4XA8A 5JBIA 3FNHA 4MDHA 3WNVA 5L45A 4RPHA 3S2EA 4RF3A 5AQ1A 1Y8QB 4Q3CA 1DJNA 1R4MB 5DBIA 4BL5A 3N58A 1V35A 4KUEA 3GQVA 1SBYA 3A9WA 3UOGA 3OIFA 4D45A 2VRCD 3JQFA 2NSDA 3PIIA 3CH6A 3RI3A 2HMVA 3VPGA 5I9LA 1N7GA 3KEQA 2I3GA 3UCXA 4OQYA 3UF0A 4CM7A 1R12A 4RQTA 3DQPA 1ONNA 3DB2A 1PS0A 4IXTA 2BFOA 1M67A 2CD9A 1A72A 4YJDA 1P3DA 1CWUA 3CINA 1X1EA 4DYVA 4FJ1A 3WFJA 2FPGA 2NWQA 1DXYA 3R0IA 4BO6A 4WKGA 4M54A 3JQ9A 1V3UA 3IJPA 3MOIA 1LUAA 3ZWPA 4CLRB 1HDYA 1PGNA 1M6HA 3ONFA 2EERA 5FI5A 1D8AA 2QX7A 3GK3A 3GVIA 4N18A 1JKJA 1EDZA 3JQGA 2J5QA 2JD2A 1PJLA 4FPXA 4MVJD 4DPMA 2JD1A 3I9OA 5CEJA 1VLLA 4IJWA 5G4KA 3X2EA 3QE3A 1XEAA 5U1PA 1JKFA 3IQDB 3TL3A 1PS8A 2I66A 4LMRA 2IODA 2B83A 2I67A 2GZ1A 4OSPA 5ENDA 2YQ5A 2VHWA 3U09A 4R51A 5IJZA 4E21A 3HFSA 2LDBA 2JFHA 3E5RA 3DEYX 3DBRB 2PZJA 5TGDA 1E7SA 3Q1LA 2C7VA 5ITVA 3A06A 3KUXA 4IBOA 1PJQA 4ZICA 2VWPA 5FFFA 2ZB3A 1YONA 1B8VA 1X15A 3N7UA 1IE3A 2BGMA 5CPFA 3U4HA 3JQBC 2JL1A 1UZNA 5T6BA 3WJ7A 3DTTA 1F8GA 3PHIA 4DPLA 2FHSA 3UHAA 4IS3A 3F47A 3RUFA 2CFCA 3W8DA 2VT3A 1OC4A 2O2YA 3GUCA 3WGZA 3WB9A 3ZHBA 1O95A 1DRWA 4IDEA 5A5EA 4BNUA 4FC6A 4WCDA 4RCVA 3ZV4A 2QRJA 4FW8A 1I5RA 1P1FA 1PTJA 4GMFA 1NTOA 1OAAA 2FSVA 1T2DA 4WK6A 1Q7GA 3KM0A 1VSUA 2O4UX 3DAPA 2WYVA 4J43A 4W82A 4CMIA 4HP8A 5U9CA 1PGPA 3PWKA 5IN5A 3C7AA 2RBEA 3DWFA 1Y9AA 1ZK4A 5TF4A 3B1FA 4EUHA 2FR0A 1O8CA 4RQUA 1M6WA 5A9RA 4J6FA 4FN4A 3GAZA 1O0SA 2RCYA 1AXGA 3PJFA 2AG8A 3BHJA 1NR1A 1K5HA 1B7GO 1MFZA 3RD5A 2VRCA 4I08A 1JW9B 5IXYA 3ZU3A 4ZU3A 3ABIA 4XKJA 3IUSA 2BLLA 3ICPA 1A9ZA 1BW9A 4BUCA 4R5HA 4D42A 1X1TA 4MVJH 3QJ5A 5L53A 4U5QA 5AXAA 2HK7A 2PZKA 3VKUA 1ID1A 5B1YA 1J5PA 1TT7A 3K6JA 1JN0A 4CQMA 1B3RA 2GN8A 4GPD1 4J4HA 3AOEA 2E37A 4K9DA 3AWDA 4GAEA 2ILTA 3C1AA 2VWGA 1JKIA 4J0FA 1R6DA 4XYEA 2DQ4A 4MP8A 4PGFA 1BTOA 1U7TA 2OFPA 1UXJA 4IGFA 4DIFA 3CTMA 4HXYA 4K1LA 2X1HA 2CF6A 2H1SA 5DCWA 1R0LA 3EK2A 2DFDA 3G3EA 1UXKA 2DBRA 3K2BA 2ZTVA 5TQVA 4IIUA 2BKAA 2BGLA 3KBOA 4ZQGA 4FB5A 2NADA 2B36A 3F9IA 4RVGA 4TSKA 3VDRA 4BO1A 3I9NA 1N2SA 1HDXA 3P7MA 4WLEA 4E31A 5KJ1A 3L9XA 5B37A 3E8XA 4NBUA 3ZZNA 1ZK2A 5K6AA 4JJFA 2ZTUA 4TRMA 4B4WA 4FGWA 2AEFA 3NJ8A 3RROA 4J1QA 4CUJA 3RC7A 3U0BA 5C5IA 1ULUA 4FR5A 2PY6A 3RCBA 5A05A 4D0RA 1H2HA 2DFVA 1Y7TA 4HADA 4CLXA 2HJSA 1P1HA 3UN1A 2X9VA 2TMDA 1GCUA 1XU9A 1U8XX 2XF8A 4BO7A 4A03A 4MVJG 3F3SA 1CEQA 2Q1UA 4C4OA 1JQBA 3HZZA 1O5IA 2B5WA 2FPPA 3W4JA 4L8VA 2H6EA 3OQBA 4BNLA 5CAEA 3VH1A 2X0NA 1KY5A 5BSHA 3WGYA 4I5GA 1LTHR 1WP4A 4WECA 3JQAA 3QWBA 1LLDA 1O6ZA 4HY3A 1NXQA 2NVUA 3I3OA 5CDSA 1JTVA 4YAIA 1P44A 3G1UA 1DHRA 2HU2A 2Q46A 4MO2A 1E1LA 4RPLA 4BO4A 4CMJA 1YQDA 4CR8A 1NVTA 4AJOA 4BNVA 1H93A 5IN4A 1R0KA 2O23A 3SEFA 1MA0A 1CERA 2EJVA 4IM7A 5C3MA 1K89A 4O5OA 3FHLA 2P4QA 4R54A 5DBFA 4BO2A 3JYNA 2JFFA 3K73O 4E5YA 3QP9A 5DZSA 4MVJP 3BMQA 3DBHB 1W8DA 2HCTA 2VTEA 3KHUA 1PZFA 1LSUA 4OXKA 4L4XA 3PGJA 1LNQA 1C1XA 2J6IA 4KTVE 2GF2A 2CVOA 4LISA 3UFXA 2C5AA 2DKNA 4L4RA 4UEJA 3U62A 5ADHA 2Q1TA 2W98A 3ITDA 4YAGA 4KUGA 1RM0A 4J7XA 2UV8A 1DDOA 3KYCB 2QYTA 3H9QA 3RFTA 3KLPX 1ADCA 8LDHA 4TZKA 3TZHA 3AUUA 2O3RA 3D4OA 1UAGA 2DTDA 4W9NA 5KIAA 5CDYA 2P68A 1EK6A 3U4IA 2OBYA 1DHTA 4E33A 4J90A 3AUSA 3MJEA 5CDTA 4MINA 3DZBA 1OBFO 1H5QA 1KETA 2O3JA 2BFMA 3I4CA 2PNFA 2Y67A 4AJ1A 4EBFA 2RHCA 3O26A 3HN7A 2X8LA 1PJ3A 2X9GA 1O9BA 3M2TA 4WLOA 2AMFA 3RUAA 4WEOA 4UEKA 2XAAA 3S2IA 3LSYA 3WGQA 4GX2A 1Z74A 1H9AA 1Q1NA 2E82A 1TVEA 4EUEA 4U0KA 3WGTA 4B4OA 1GD1O 3PLNA 4NI5A 3UCEA 6ADHA 5EIOA 3ZU5A 4UUMA 3MCVA 1PJBA 5A06A 5T8KA 2WDZA 1D3AA 1HEUA 1NFFA 1KEVA 3H5AA 1EVJA 3BMCA 2YDXA 4DQUA 4JROA 4ZA2A 3AU9A 3O4RA 4ZD6A 3ST7A 1DRVA 1U5AA 5JO9A 2OO5A 1T4BA 1S6YA 1HF3A 4PG6A 2NVWA 4KWIA 1K3TA 3S2FA 4D3FA 1CIVA 1R37A 4BHTA 1SEVA 2VOEA 3H5RA 4BOYA 3JTMA 4A27A 3EVNA 4Y6PA 2YHIA 2X0RA 3SX2A 3TNLA 4KUHA 5KVVA 1XR3A 1H0KA 2OBNA 5J23A 2EG9A 4FD3A 3KOUA 4QQRA 3WOHA 1NAHA 2Y1DA 2ZB8A 3IAHA 4AJJA 4LVCA 1PL8A 3ONDA 4YT8A 5IAAA 4YEDA 5IXSA 4FJ0A 3HB4X 3P2YA 1EBUA 1T25A 4YAJA 1ZW1A 1VL6A 4R01A 5TJ9A 5A4DA 1HE4A 1JAXA 3JQGB 3U3XA 1ONOA 1GR0A 4ZRMA 4EJ6A 3DHEA 1PSDA 4UUNA 4GL4A 4ZRNA 3I9MA 4KOAA 2D0IA 3SLGA 1YL5A 3RKUA 4W6ZA 4R69A 1YOVA 1YWGO 5EPOA 1U9JA 4FGSA 1ZXLA 5BSGA 3AW9A 3HSKA 4N5LA 3HUDA 3ZWXA 4Z0PA 1ENOA 2J5RA 1EFLA 5G0TA 3VZSA 1N1EA 1P0FA 5A9SB 1EUDA 3EYWA 1E5QA 3JQ8B 1H6AA 4IDCA 1X0VA 3Q2IA 4J9UE 3NT4A 3KYDA 1WZIA 3PHLA 4YRBA 4FIZA 4ND1A 1ULSA 4IQ0A 2DPGA 3OHSX 5CEFA 4JGBA 1PJTA 4PG7A 1QYWA 2NTNA 1Z7EA 5A3VA 1PL7A 2P9GA 3DMTC 4YXFA 2GPTA 3IS3A 5JAMA 3HQ4O 3ZDFA 5G0UA 3WSWA 5DNAA 5IDXA 3FTNA 1W0CA 5AYVA 4A5OA 1KVSA 2B35A 3NGLA 5K9ZA 3V5NA 3IUPA 2HO5A 3S1LA 2Z95A 2B69A 4I9HA 1Y9EA 3DOOA 1CYDA 5JLAA 4FFMA 3RKRA 1R15A 2ZYAA 4M55A 4D7AA 4B7CA 4ALMA 1H2BA 3T7EA 2EEZA 3H9JA 4M8SA 1PWXA 3E9NA 5AVOA 4PRLA 4BNIA 1HE2A 1LDNA 2CF5A 3CZMA 2GNAA 4B4VA 2NU7A 1YB5A 1XGKA 1ISMA 5HA5A 4I9UA 1KC3A 3E48A 3NJ4A 1U1IA 4GBJA 1LC0A 2Q1SA 2YW9A 3IJRA 1YL7A 4QSMA 3VH2A 4CPDA 1C0PA 3DBLA 1PQWA 1N7HA 4ALNA 2JAPA 2PTGA 4E32A 4E4YA 3ZI0A 3ROPA 1LRKA 3JD3A 4DPKA 1PGOA 4FFLA 1G0OA 3RWBA 1DSSG 3W1VA 4BQPA 1ISGA 3OF2A 4CMAA 3LDHA 4UVDA 3EW7A 2P5YA 1XA0A 2G17A 1UXHA 2JHFA 5EQDA 5T64A 3U4CA 3G1TA 3R3SA 3U9LA 1PJSA 1DAPA 3JYPA 1I0ZA 1GY8A 4NFSA 4JQCA 4KTTE 4ALLA 1WW8A 5BNFA 4CMHA 3GMDA 3KLMX 4Y67A 1DIGA 5I7EA 4NPCA 1DC6A 4WOJA 4CMEC 3JD1A
chains in the Genus database with same CATH superfamily
3VNQA 1L5YA 1L5RA 4IGAA 1KGSA 4OPMA 5EGSA 4AJNA 4ZJYA 3G9XA 4P22A 2D1SA 4RD1A 3WLLA 4EHLA 1BKYA 2IC5A 4NCAA 3WG9A 3WO1A 2H92A 4UHKA 3C7DB 4LDAA 4GR4A 3TLGA 3RFUA 2IF0A 1FFBA 4ZQIA 1GKYA 1Z68A 4YUYA 2J5XA 2X1VA 4MLZA 2RHRA 1RHUA 4JP3A 3IPRA 1T36A 1WO8A 3PFFA 4EJSA 2IXAA 3H8WA 4PGHA 1BEEA 4P0TA 1QYVA 1W96A 1XKXA 2X4DA 4R9UC 3T1YB 1B42A 1GO2A 1M8KA 3FYSA 1Y5RA 3LPDA 4RIGA 1G4HA 1QBGA 4RH3A 2BT4A 3R5SA 1UT5A 1OTHA 3KZNA 1J2TA 5ALQA 4KPUB 4ZV4A 1F6BA 521PA 3TEMA 3U49A 1DV1A 1I1OA 4XFKA 3RV3A 1B0UA 2NZJA 3S1AA 2P6PA 3EPLA 1HRDA 2J3DA 2ZIAA 3MJ4A 3PWZA 2NU8A 4DSNA 4ALJA 4R5MA 2HPZA 4H4CA 4BTEA 4PLHA 4L78A 1GGEA 2O4CA 4NDZA 4BWVA 3QIAA 1N5MA 1QZUA 3I34X 3QKRA 3RSZA 1QDEA 2RHDA 2XQJA 2GK3A 3H6HA 4DVJA 5C5EA 3KU1A 1UJNA 4N4AA 3FZQA 3PTLA 4EPRA 4NR0A 3N53A 4R8VA 3LYHA 3TGWA 1BVHA 2MSDB 4K28A 3GLRA 2Q6LA 3T3NA 4MR8B 3ZWNA 1T8TA 2B8NA 3DXFA 5FOUA 1UMBB 4YMSA 1YB4A 2Q3CA 2R6DA 1SD2A 5ADVA 2J6HA 4REQA 2ZJ3A 1E3IA 3GDFA 4RIIA 1EDEA 1PNOA 1FMCA 2I4MA 2V3WA 4MGZR 3U7QB 3F6RA 5HXAA 4AT1A 5B58T 4OQPA 3UMGA 1HFEL 1RKXA 1DG1G 4G4SP 4G24A 1CJMA 3R0QA 2QMEA 2YJTD 3TEFA 1XXLA 1FFXB 2IZ7A 1OYVA 2BMJA 2JLRA 1ZBDA 2ZRDA 5CYOA 3V2GA 5JFGA 4LK2A 2A5JA 5FPPA 5C5DA 1Z6QA 3B5JA 1GL7A 1E9CA 3F4LA 3PL1A 5AJUA 3ZY3A 4BEWA 3RF7A 2GS9A 2PX2A 2V3VA 5GOZA 4TKVA 1G3IA 2DJ5A 3ZLTA 1TQ4A 7MDHA 3KEMA 3CSUA 1PNTA 1L5HB 3ONEA 4GECA 4H0NA 2IPNA 1J24A 1GHTA 4J1NA 1WTCA 1WZEA 3IT1A 3HXQA 2BONA 3WQRA 2F8MA 3V42A 4XWWA 5EKUA 2R6HA 1NATA 4A1OA 3O9VA 4NNJA 4II2A 3T7CA 1QV7A 3CPSA 1VA4A 3PQ2A 1B1CA 1RWQA 4I9FA 2DF8A 3CZPA 3HVJA 3MEQA 4L3VA 4L76A 4O0LA 2K2QB 4PZZA 4BXOA 4WUVA 1RYYA 1WNFA 2IXBA 1NI4A 1RAAA 1RAEA 5DHQA 4CCYB 1O0BA 3M4NA 3FPLA 1V4VA 2XVAA 3Q6NA 1DFGA 1SXJC 3KB6A 4LZLA 3TK1A 4LZOA 1ZMXA 3AINA 2PZGA 3OHPA 3R3XA 2FX5A 4D4HA 1YKGA 1XN4A 1NDHA 2GZSA 4RO0A 1BHQ1 3SQNA 4L72A 3Q11A 4DG5A 5F73A 4QOIA 1H6DA 1IBRA 1NNSA 1RBMA 4UUQA 4CVNA 3QVKA 4KFUA 3SR3A 3CRQA 2AYXA 4HRXA 4NOJA 1XTBA 5BXQC 1QYIA 2PQ6A 1RHKA 4X3PA 1KYXA 1PFKA 5F64A 2R1TB 3IH5A 5ALSA 3KR2A 5KO2A 3RS5A 1KOFA 4Y6RA 5JTTA 2EP8A 4CEIB 2O2XA 4CM5A 2C29D 3KO8A 4Y2HA 5G0VA 3R74A 4ZOQI 4EY8A 4RIEA 2ZRQA 4OJYA 3HZHA 1FDUA 1A7KA 1SC6A 4FZVA 5B53A 1DJLA 3WY9A 4OHKA 2DKFA 2FZKA 3SXPA 1PV2A 1RQLA 5LNK6 1VSQA 4FYXA 1SNYA 1CQXA 1Z2CA 4XWYA 1JDUA 4WNCA 1UF9A 1YQ9A 4Z99A 1HFWA 5K6AC 3REQA 3TO5A 1VB5A 2GBGA 2QG6A 1U3CA 3AHGA 2Z8ZA 4L6CA 4OQZA 1B43A 1RRVA 4L3OA 1UBRS 3KDSE 3NBZC 3SHQA 1ZVMA 3PPYA 1OA0A 2ZJBA 4OLHA 1KU6A 1QVVA 1RPJA 1UC5B 2IELA 1QFJA 2RGNC 3OIWA 2Y3IA 2ZRGA 1MQ8B 5GGYA 4IH9A 1FW6A 4AQ7A 4MMXB 2AN5A 1Y3IA 1GFZA 1JQKA 3EGVA 2H54A 3AKCA 4DANA 3ZLVA 2QW1A 1NBMA 2VDWB 5AJZA 1Z7BA 5AT1A 4CLOB 2NTEA 4CKXA 2QTRA 2ECPA 3E7WA 1DB3A 4E09A 3OAAD 4EW3A 2W2KA 2IY7A 3LLMA 3VPHA 1WDLA 5KNBH 1B3BA 1B74A 1RQXA 1YKSA 4BFVA 5CFZA 4GLOA 3T7RA 3S8MA 3OZVA 4RD4A 3R0ZA 1ZBQA 5CBPA 2JVKA 3EZ9A 3G02A 4FQ5A 2X0IA 4RVNA 1XI2A 4GT1A 3NH9A 3G7NA 4BASA 5IFKA 4V3CA 1WWKA 4GI1A 4LGVA 5F51A 2D5CA 1MO5A 1J8YF 3I9JA 2AYZA 1S1CA 3ZDZB 5BP7A 2F64A 5DM1A 4F3CA 4OSOA 1ZJ6A 4U02A 2BGJA 4LHYA 2YN2A 3G2IA 5FTWA 3LUBA 2FFJA 1IOZA 3QENA 1AB6A 2C31A 4DLLA 2VHYA 4P82A 3U80A 4EA6A 1Y3BE 4BNXA 4FSDA 1NIJA 3UOWA 1U8UA 2AG1A 3WZ2A 2XE8A 5HWSA 3WHKA 5K05A 2P75A 2CXHA 3W6NA 4KFSA 3PEYA 3N87A 1VJTA 2JBHA 1Q11A 2C0QA 2V0NA 5BURA 3KKZA 1TAUA 3KQQA 5KCMA 3MJCA 3FSEA 4LW8A 5BW4A 3LWDA 4D8WA 1PEKE 2HRCA 4NG5A 4Q9NA 4Y2VA 5H0IA 4DDTA 5E2IA 4QBGB 4PICA 1DMSA 1UFRA 2VF7A 3N5KA 3HBFA 4X1IB 5GOTA 4YXWA 1V8PA 2HBRA 1F1JA 2VT6A 2ZB7A 1QHXA 1O5TA 3O1IC 3O5AA 2FN3A 3T15A 1QHHB 3C48A 2CJWA 3F7NA 3UXEA 1BMQA 4PO9A 1JSXA 2G28A 3SGLA 5DT9A 3OEHA 4MUBA 4PSAA 1YQEA 5JXWA 2DR2A 3OQOA 3BL6A 3KZ1E 3OEWA 1YZHA 5IC6A 2ZI9A 3DKRA 2JVJA 1EQAA 1FJHA 3DAFA 1QLHA 3HBAA 3AVUA 2FMTA 4K0RA 2QR2A 5ALRA 4B3JA 3D5EA 2PUDA 4EB6B 3ZY5A 3QHPA 4CU5A 4C2TA 2PKQO 2P0YA 2V8OA 1IYZA 3PRHA 1OR8A 2GN2A 4BS9A 3QKRB 2IL1A 3IKTA 2LDXA 1LPNA 3RJTA 1RWVA 2Y68A 5IAGA 5A3QA 4CUZA 3FTEA 1U3UA 2AJTA 1SU6A 2P4UA 1WEKA 3FOBA 2BGRA 3DAHA 3PFCA 3V8QA 1LDEA 4HK4A 2HSZA 2R1TA 4UBIA 1AK2A 1BO6A 1K2WA 1VGRA 1FFAA 4RL4A 3FSGA 4PQFA 3VJKA 4YRIA 4DV4B 4UVEA 1T6XA 3OX4A 2W6PA 5AWFC 2AOUB 2AZDA 4HBZA 1N0WA 4NG4A 2NP7A 4MGHA 4BFZA 4H3VA 1SB9A 3W6UA 2OE2A 4KSCA 2X4GA 3EASA 2Y05A 4IUBS 4DUGA 4PM4A 3UK7A 1PZXA 2XIQA 3GLHE 3K1TA 3DQZA 3WS7A 1U0BB 2BHNA 2A9OA 5KYGA 4YCAA 2GCIA 2CWWA 3E84A 3K31A 4EK9A 3JWHA 3EX7C 3UEOA 2CT8A 1ZUNA 4ZHQF 1V6AA 1I94B 3CUTA 4LNUA 3ZGLA 1XYVA 2D74A 1A96A 2L42A 4HEA6 4UBLA 3FDXA 3IAS1 5L40A 4OQMA 3QKTA 5ALLA 3HO1A 4RVDA 3WL8A 1GOTA 6YASA 3V7YA 1JR3A 4TTIA 4DDUA 1W36C 2JANA 2QR5A 3G8BA 1QHSA 4Q39A 1P9RA 5FBWB 3VC3A 3ZZTA 4EH1A 1DQRA 4J29A 2PU7A 3LXUX 1RMTA 4XD7D 4ZTUB 3ZTTA 4ER7A 2EW2A 1W49A 1ZUD1 5EE5B 3R4VA 3K4PA 5LP1A 1CEEA 3X1ZA 2E5WA 3AEQB 4JJIA 2GXUA 1ZH0A 4PEVA 5DRTA 1A4RA 4XASA 3E7PA 3OAAA 3GJQA 2QMQA 1EP9A 1NYLA 2QUIA 5FWXA 5D3QA 2C7OA 4XQGA 2X3FA 1KKLA 1XEWX 3AXSA 4E2XA 2Q7XA 3WJAA 3A2KA 3Q88A 2ECKA 2X1MA 3RAGA 1U3VA 2REXB 1D03A 3NIBA 4WVFA 1CR1A 5KVSA 5JISA 5F5XA 3RS0A 1W9HA 4GVXA 2G6TA 4KLRA 1U9IA 1YS2X 4B44A 1WM1A 3DAGA 1KK0A 4LY3A 3AVWA 3B5IA 2CL5A 2P9BA 1L4GA 5KYNA 3WIOA 5KB3A 2Z4RA 3VVCA 1WE2A 2P3OA 1GSHA 5TLSA 2NZYA 1PG0A 1MA3A 2Q5HA 3F71A 4PCVA 4WIAA 5CAEB 1SN7A 3S55A 3C6KA 2RGAA 2JHPA 4NNPA 3ULKA 3WB1A 3GARA 1I36A 3B2NA 3CZ4A 1VCMA 3AUJB 2FZ4A 4Q7KA 5JQGA 3T5AA 2RB5A 2A9JA 2W4QA 3M5WA 2W6MA 1LSJA 1U3DA 5B2ZA 4AY6A 4U6SA 5I9MA 4GYWA 3PTZA 4OXQA 3HXMA 5I4BA 3JQDA 2IW1A 3WLNA 3DS8A 1PQUA 1EA5A 5IASA 4L2IA 1FU8A 1NF3A 4NHEA 3CKMA 2D1TA 4U7DA 1R0BA 1IQRA 1YBFA 3HWWA 4D4GA 1G1AA 2H4ZA 4K9NA 2V4ZA 1OPRA 4IIVA 3JZIA 2O5VA 4II3A 1VG8A 1GLVA 3D8UA 3SM3A 2QX6A 1QP0A 3SZ3A 1G5TA 3WGJA 5JE8A 2D13A 2CYBA 5BW6B 5C7IO 4BMOB 5DRYA 3ZCVA 5IZCC 1T26A 4BO3A 3MWJA 3WGUA 1W5TA 1ZRSA 3OZFA 4JEUA 3BB1A 3ZQJA 1IEWA 3AP3A 5ALNA 1K8RA 5JPIA 5EINA 1T3SA 5D3MA 3O2NA 1THGA 2PGDA 1GSIA 1W85A 2Q4BA 4ME6A 1Z88A 5DCLA 1ACMA 5DULA 2OXIA 5BVHB 2H4XA 4XPIB 1DUIA 1ZIDA 1Q84A 2HC9A 2PKRA 2BE7A 3G9UA 3HUTA 4WE3A 4XUDA 3CGGA 2WIDA 3L1KA 3KL4A 1G60A 1G42A 2ODPA 2ZQYA 3TW8B 3I5UA 3DMFA 1VZ2A 3ZCRA 1TF5A 1YBVA 4PF1A 1IUOA 4RGBA 1NW3A 3EFOA 4F7DA 4F6LA 3TKAA 1L0BA 2ZS8A 1KMMA 1H2EA 2JEZA 3DVSX 4DMUB 2I3BA 3ASUA 2HA7A 2IW3A 1K0UA 1TYEB 3IEKA 4YP0A 1JP7A 1OU4A 3RS3A 3E1SA 4TVBA 4RMHA 5JMOA 4FT4A 4XARA 3HDJA 2WYWA 3OZWA 3Q8LA 2W0SA 3UMCA 2FPWA 2PL1A 1Z15A 2XE7A 4RL6A 2ZVDA 3KYIB 1NWHA 2P6UA 1IY2A 1TFUA 3WE7A 4AP9A 4BU0A 3VPBA 1NI5A 1VQ1A 5KOJB 1PFGA 1JL3A 4C88A 1VKZA 3C87A 4KAJA 1MVLA 1ABBA 4OUKX 5AKHA 5EJ9A 1WBBA 3M4YA 1I1HA 1P1RA 4YUAA 3IV6A 4G86A 3RUCA 1W35A 5EHXA 4HDQB 2V45A 2A5YB 1I10A 3FGZA 5D6OA 1E1RA 4UD2A 3FCXA 1LPSA 2OORA 5C52B 1XQVA 1ZONA 4NPAA 5FD8A 4IUCS 4LQLA 3VGJA 4QTYA 4XWOA 3DZ8A 3GVXA 1KSFX 1ZGBA 4OHOA 2VS1A 1DC7A 5H82A 3AERA 4FFDA 3RUHA 4ZZ1A 1JWLA 3D3NA 1SBNE 2C1EA 4YBRA 1P1JA 3K2IA 4CL8A 5IUJC 3RNOA 2ASVA 3SD7A 1SO8A 2C4WA 1DX6A 3O31A 4I5IA 3VR3D 4QYSA 1X2EA 2MR6A 1FIUA 4GS5A 3AM4A 1US8B 1NT2A 2NQ8A 4HWKA 1QKIA 4MQMA 4P38A 2QTGA 1QNFA 1U4SA 2VI5A 4R1QA 2QBYB 3NFRA 2YW2A 3QU4A 4PC7A 3RYTC 3RJMA 2DHQA 4ARCA 1P9WA 3RC2A 2PG3A 3AG6A 3LDFA 2A5GA 3C6MA 4NYJR 4R6XA 5EZYA 4J49A 4ZVLA 5TDHA 2WYHA 3CIOA 3EVGA 4KMMA 5SZHB 3GGJA 3BZBA 4P4GA 4MVJA 1ZKDA 1T24A 1BKDR 4RK7A 4WBNF 1B14A 5FUQA 5HKBA 7REQB 3RJZA 5DXFA 1KERA 4M87A 5HBRA 1A8HA 3OJCA 4HNGA 5EJFA 4CFYA 4EA7A 1S9DA 2EC5A 1FRZA 1UJMA 2B0CA 3MINA 4TYPA 1UEIA 1KDRA 1VYTA 2BKVA 4J6EA 4C05A 3LUKA 4GSLA 5SZJA 4URFA 3PNQA 1OT5A 4C89A 5AVTA 2FN9A 3OZUA 1PR5A 1A4IA 3ACBA 3BH7A 4ND3A 1JMKC 5EPUA 4NMWA 4BBPA 1UQUA 2J3IA 2V97A 3LOPA 3QLVC 1FDIA 3JCZA 3RVBA 1QX4A 1NUQA 4JWTA 2HSEA 2WKSA 4GP6A 2IU4A 3C6BA 4PLWA 3OE5A 4KVZA 4X6XA 5FI1B 1U4NA 3MGCA 1J09A 1I7QB 3DLAA 2YVUA 4NAUA 5TSDA 4ZO4A 1ODSA 3MNFA 2R25B 4AMUA 3RH0A 3TOSA 1OOEA 2FSUA 3T94A 4IO0A 3JALA 4TPKA 5DGIA 2JC3A 4YIKA 3FPAA 5GV8A 3JXEA 3QF4A 3UBTA 4OHBA 1F1BA 1ZR2A 1XX6A 4ROSA 4FP9A 4KI0A 1WSBA 1XZDA 3GCXA 4KMSA 4JXKA 1CZLA 4D8XA 4BQFA 5BWCA 2ZUVA 1RJWA 3FUCA 1ZA2A 5AKEA 3ZK8A 4B3HA 4BVKA 3EVCA 1GSOA 4LMPA 4U9HS 4D74A 4YIHA 3RRMA 4XM2A 5LA6A 2O8CB 2HMSA 4FHZA 1H4QA 1PP4A 4IINA 4MCIA 2F67A 4BGIA 3QX3A 2IH4A 3TX2A 4H7FA 5DFAA 3A25A 3CEPB 4UDXX 3UH1A 4ZJUA 1OU0A 1QMGA 2SCUA 1L5VA 2Z2YA 3A9SA 3NHBA 3O95A 4PS1A 5FULA 5HF8A 2H9AA 3CVYA 3L8GA 5J40A 5JMWA 4X64B 2PS9A 2O5CA 1IN1A 3EVDA 1LLFA 3K9WA 4X3OA 1N4AA 3G79A 1QX3A 1E4YA 3WOVA 3L0IB 2V6IA 3C1TA 1HOXA 3MSXA 3WWDA 4IH1A 3HM9A 3VC2A 1KI1A 3A36A 1UDAA 3K1AA 1QV9A 5LSAA 1M7GA 3DWEX 2XQIA 4DIDA 1X1DA 4L3WA 2GEJA 3TMYA 2XXAB 1UAYA 3KXKA 3OJFA 4TWIA 1KO4A 3A58B 5D3KA 1VRWA 1CNFA 2J7KA 2YJ3A 3QLEA 1U0NA 1DRKA 4BKQA 4NULA 5FUBA 2C4UA 3ANSA 2EIHA 2XLCA 1KP3A 2FZGA 4KSYA 1M0WA 4GX5A 4BQRA 5CH3A 1S2DA 1E62A 3AVOA 1M2OA 2ETVA 3FDZB 4I3HA 3QA9A 4D6YA 1FVHA 3DXZA 1RXIA 3V4VB 1E20A 1NUPA 4PFQA 3NASA 2RAUA 2VSXA 3SYRA 2PFKA 3KOXA 5A6VA 1QF6A 1NFQA 1RWOA 2D00A 3OM1A 2ANCA 3IGFA 2PO7A 3EWIA 2VJPA 3EISA 3RYCA 1LDYA 2OCDA 2YV4A 2ZUWA 2HIGA 3PPVA 3SU8A 3R76A 3AI1A 5A03A 1XAJA 4CIBA 5L3SB 4C08A 4ENWA 1D4FA 2TSYB 1I33A 4DQDA 1VFPA 1BRTA 3FBTA 4II7A 1W4ZA 3VYSB 3OC0A 5K0FA 4FEEA 2L17A 2WJ4A 1GZUA 3INTA 4Y9TA 5C4MA 4PO1A 1CFJA 1E61A 3AMVA 3BMQB 1K27A 2YUTA 3HHEA 1ISIA 1E2GA 4IZIA 4HLQB 4J1SA 2QAGA 3VU0A 2D2IA 1DDGA 4O3MA 1U9ZA 3JY6A 1ECGA 3MGAA 4J2HA 2CFRA 4EECA 5HQ3B 1K92A 2VQSA 2NZ2A 4G5GA 1OVMA 4OMCA 1ZJJA 4Q3LA 2B8JA 3VVBA 2GLTA 4ACAA 5AM1A 1Z34A 1TU4A 4YDQA 3ZHZA 4I1OA 1ODFA 1ZJZA 2HF2A 2GOYA 2QZZA 3EY4A 4ITVA 3PITA 4ND6A 4X93A 1GEGA 2EIXA 2UDPA 4BO8A 3SBOA 3L84A 4X44A 3M6LA 1VMAA 4YRZA 2FQYA 4HT3B 2POQX 4PG4A 3O82A 3IT3A 1GV1A 1QCCA 1QTNA 2NV0A 4GW3A 1X1AA 4XIYA 3C8HA 3CCFA 4PAGA 1R16A 4RLHA 4EJ0A 2WWTA 4HH1A 4INZA 3TD9A 4MA0A 4D9FA 2FK8A 2IY8A 1RMQA 4EI9A 3I01M 4V0SA 1EVLA 2O57A 1NR7A 1RC8A 2BHRA 4KW7A 2EVWX 2YFQA 3R7LA 3WIEA 2WT8A 4Q0MA 4F9FA 4LYAA 3WMWA 3PQ6A 4K6OA 2IS6A 4H7PA 3HEBA 4DM7A 3ZNOA 2FUKA 1TTPB 2PJZA 2VPYA 3S2ZA 3ET5A 2ZWMA 4I3GA 1DEKA 1CE8A 2ODQA 2XRFA 3DC7A 3G5TA 4S12A 4D97A 3PA8A 1KDPA 4XQCA 3D9QX 4PIVA 1JQDA 5EXSA 4F6CA 3GG9A 3QOXA 4A0GA 1CR6A 1SUSA 1X6VA 2P9CA 5JY1A 4JI0B 1E6UA 4M0FA 4ARSA 2MINA 4LPSA 5IYZF 3S1AB 1U9YA 1NXXA 1XXHB 1ZKMA 2C3PA 3TYXA 1WOMA 3MIIA 3PXUA 3TF5A 1SGWA 2VCEA 2YZMA 3CR7A 2LXNA 3QI7A 3WX0A 3WL5A 3CUEF 2ZYVX 3LVBA 3TQTA 2R5WA 4EG3A 1ZW6A 3WAKA 5SZKB 1URPA 2YS7A 3HKCA 5FUVA 3FJYA 3SG0A 3QBVA 1B6GA 2NYRA 3VZCA 1XV5A 4QTXA 1JHAA 3WMEA 1C9JA 4CLRA 2MCFA 3DKPA 3GZ4A 2ZKLA 2XGSA 3PL5A 2O0LA 1OHHA 3EZGA 4J76A 1UOQA 3N39C 1JAYA 3DL2A 5HMMA 2XUIA 3A4MA 3SJAA 1J90A 2NXJA 1XTUA 2SKCA 3RWMB 1TUBB 5BSUA 4B3SB 4KE7A 1KJQA 3W8EA 1E9EA 2GN9A 4AKHA 4ZDJA 4TRRA 2EGGA 4EX6A 4TRJA 4NECA 5B4TA 1XE3A 3C7TA 3LWZA 1G4UR 2WINI 2IU0A 1KXJA 3LNCA 5TF0A 3OEED 2D6FA 4EEKA 1V3QE 3B9BA 3MT0A 1G21B 1D2AA 1QV6A 1EK2A 4L8FA 5ARCA 4A8TA 3A1FA 2IGTA 4LX8A 1T6ZA 4P3OA 1NOIA 1T5SA 3IUEA 4JA0A 4QNRA 1UDCA 4EUNA 4F06A 1XJ0A 4XIGS 4B5LA 3D0QA 2E6UX 3MTIA 1IG3A 3PFWO 2JLVA 1ATIA 2C77A 2H52A 1E2MA 2RC6A 4AJKA 1SCUB 2BFFA 1MABA 2CUZA 4PYJA 2Q5JA 2QG4A 3HB1A 2QRZA 1G8FA 2GPSA 3F3YA 4ZAWA 1FNMA 1M5UA 3QWHA 3T06B 3WWYA 1ULHA 4CR7A 4JYAB 1D1QA 4GI3A 5H02A 4F3TA 5K3DA 3T9FA 4YRNA 5HW0A 3P27A 4G37A 1GFSA 3IAS6 4OHCA 5EXTA 5AI6A 4DB4A 1ZCZA 1KVTA 5I01A 5CW2A 4LYYA 3AV0B 4IKOA 3H86A 1SFRA 1VPTA 2C9YA 2P40A 3VPXA 3IUMA 3LX4A 4YP9A 4BNHA 1Y6JA 3BTSA 3EIWA 3G5AA 4NJOA 4UASA 3H4IA 4UCFA 4D0SA 2C8LA 4D81A 3JQBA 2E89A 3TIIA 3TTXA 1J42A 4G9EA 1YOBA 2WPDD 2VSYA 3KKMA 1NW9B 3W2GA 3P9IA 4URVR 1EHIA 2OO7A 3LP6A 3MQFA 3TPCA 4ZAFA 3ABOB 1XL0A 5BN5B 4HRAA 2PS3A 4JOSA 2W2TA 2BGGA 4Q4HA 1C4OA 1YTUA 2OV4A 1N6NA 2C2BA 1R1DA 2GCOA 2X2EA 2JAQA 5EMJA 4BB6A 2EW8A 2YRFA 4PAQA 1NTRA 5F1YA 3G88A 2XYVA 2ZBGA 4W1SA 4H6PA 1QG2A 2FPIA 4IG4A 3L8FA 1MN6A 3C3WA 1W4LA 1VJ0A 3HBNA 3R20A 4L85A 4NONA 3W5HA 4ZCMA 4XYMA 3HCPA 4NFHA 2H65A 1ZL0A 4JNCA 1MR3F 3BWCA 3H2HA 3R44A 2JK1A 2ONJA 1G5RA 3U7JA 4WQMA 4DMCA 3H04A 4MR9A 1PIWA 1DFHA 1S01A 5GMOA 1QRUA 2QTZA 4OI0A 4OAPA 2BISA 4C6HA 3NT5A 3GRYA 3OCWA 1TGVA 5SICE 1DKOA 4UREA 1FF9A 3GXBA 4N0MA 1XTVA 3SIWA 4BQSA 4BE7B 3E18A 4D2IA 2B94A 8ATCA 5EP2A 1ZZGA 4C7BA 1Y1LA 2X8AA 1NVVR 3L8DA 3QX7A 2FPMA 2C5BA 4FZJA 1BXGA 4HAVA 3TZ6A 4B3BA 5AM4A 1UMCB 2H1FA 1UKAA 2X5KO 3C6XA 4LRSB 3R5HA 3CWQA 1DKQA 1QAOA 3P26A 4JCCA 4XI9A 5DOVA 4A73A 1N2ZA 2A30A 3RYFA 3N3BC 2VZEA 5ICGA 1SCAA 2A0XA 1I9GA 2GUWA 1KZHA 1NJ8A 3GFPA 2V1UA 1PAUA 4P83A 1RNLA 2OCKA 1U0EA 5CVEA 3CZRA 3PUZA 4BV8A 1AO0A 1FU4A 2JGNA 4RXUA 4BE4A 3FWZA 4UZSA 4FFSA 5EJ6A 1CUVA 3H1AA 2QP9X 1IQPA 2G0AA 2ZYWX 3IO3A 3RHTA 3ZVRA 3GRVA 5BSVA 3JVUA 4TRNA 1GAXA 3JYHA 4ENUA 2IYPA 1L6RA 1AKWA 1G5FA 3KUUA 1BKSB 4GF5A 5H9VA 3U3KA 2YFHA 5HKAA 1EFDN 5CA0B 5KTOA 2EFEB 3PUYA 3AJEA 4RHTA 4R7ZA 4RLSA 5DTQA 4BZXA 2J07A 5B64A 4D4KA 4CI9A 5HOQA 1SUWA 2JGFA 1JF8A 2DTXA 2YY7A 3AIIA 3QF4B 4RPGA 4G9BA 3JASB 4WI1A 1E98A 5JS2A 1F4VA 1XCPA 3RR2A 2Q2VA 3ZS8A 1DAMA 4A23A 3KR9A 3K6KA 3SWWA 5E9WA 3W9BA 4URXR 1N3IA 1E3QA 1E1CB 1L5OA 1NJ1A 4BTVA 4HS9A 4KDRA 1AHPA 3H1TA 3KTFA 3K71B 3RS9A 3W79A 1USKA 3EOZA 4IMIB 4MNTA 4F21A 4ZGGA 2EJTA 2NVUB 1RHJA 3BHMA 5ADUS 2Y1CA 4Q47A 2FG6C 4RV9A 4RV5A 1XRMA 1WCXA 2GEFA 2YWGA 3IHKA 2FN7A 3NTRA 4IIHA 1E1QA 1HYQA 4P80A 4MWGA 4X7RA 1EFTA 5J5VA 2BGTA 2HRDA 1P2BA 1MAWA 2WHEA 5AK0A 4JX9A 3L7NA 4WBSA 3TIFA 1ZD2P 4YUXA 1CB0A 4IDGA 4JI5B 1DBRA 3CF0A 3EQ8A 3RM3A 3LD9A 1HGXA 1O4WA 4QXAA 3ZYCA 3I5XA 1XD2A 2R1UA 5HOEA 4M8NE 4DJAA 4MWZA 4I1UA 1RSZA 1N9GA 4YJHA 3W7BA 3GXOA 3WDMA 2ZKIA 3KK0A 4JJGA 2OGZA 5BWNA 2ZAIA 5FBRB 2PSFA 2LKDA 4W99A 5LYYA 3MD0A 4D43A 3K2EA 1CC1S 3GFOA 1YB7A 4A6PA 2E4UA 3DBHA 3S7ZA 1TVKA 3A9VA 1A4XA 1Y6QA 1S89A 1KFKB 1C3OA 3OE1A 4WFJA 5C8YA 1TPZA 2NV2B 3GRFA 4AS1A 1F0YA 3HGQA 2Q1WA 2H1RA 1L7EA 3FSGD 4LF7B 1NBMD 4A0SA 3ER6A 3S68A 3JX9A 1BS2A 1TFRA 1OZHA 3VYWA 4NMHA 4YC7A 1U0GA 1QGUA 5BOSA 5FOXA 1XZBA 1TTHA 3IP1A 4M6WB 3LUDA 2Q3LA 3F6SA 3PKZA 4I6GA 4Q3EA 4RZUA 4A6EA 4DLAA 1ESDA 3Q3EA 3EUWA 5DP1A 4I1YA 5TGTA 2AUTA 4LPKA 4XLTA 4HNUA 5LQSA 4MPDA 3U13A 4YCNA 4F84A 3HO6A 3GPBA 4FC7A 2DGDA 2HH9A 1IAQA 3DT6A 1JR4A 1AHNA 1YH3A 3HKCB 4HYTA 3E9MA 4JB0A 4N8EA 1CZUA 3NTUA 1A2QA 4NZZA 4Z9FA 1EVQA 4U6QA 3CW8X 1QDLB 3X2FA 4A2WA 4DRYA 1SQ5A 2AZTA 1B41A 2X4LA 2FP4A 2EF0A 4O5AA 1QAMA 2NV6A 3KOWA 1BA2A 3AH8A 2D2EA 3T9CA 3V1YA 2F8TA 1C30B 3TLCA 1N6PA 3HJFA 1CRZA 4LF6B 1GIAA 5IBPA 3I5MA 4R8LA 4Q9KA 3ZCXA 4B9AA 3HDQA 3QV2A 3ROFA 2BHTA 4IDFA 3LRXA 2VZLA 5KWEA 3B48A 4X20B 2I2WA 4UHEA 3RS2A 2WHXA 4WZBA 1N8TA 5T5QA 3KIPA 1KYVA 3DV2A 4ZQCB 1LBSA 1T8RA 1ZA1A 3FTQA 1Y9DA 2J5BA 4DNFA 4KAXA 4YI3A 1E2DA 3KZXA 1LDMA 3ZJUA 3ONVA 5A6SA 1O94C 1Q1QA 4HG2A 4RPCA 1JB9A 2JHAA 5DYWA 4HNQA 4N9QA 2XWPA 4KQJA 4NBVA 4FINA 4AECA 3NBAA 4KWEA 4KVFA 4R1NA 2AVNA 3AEKA 2YYAA 3DT8A 3UAGA 3TZKA 2VRBA 4HV4A 3EGCA 2A92A 2R68A 3K2QA 1GL3A 3HN2A 4PZDA 3KHSA 4JXJA 4X6LA 1WZ2A 4BFTA 2V3CC 2VKQA 2RDMA 2G70A 4TTQA 4QUJA 1RJ9A 1TMOA 1VE5A 2Q9UA 3T35A 1Z4PX 1M83A 3E61A 3OZIA 1KP9A 1TCBA 4AWXA 2OM6A 2RAFA 3QNUA 4GH5A 4C20A 1EWVA 1QORA 4ZQEA 4EUFA 2I99A 1RTKA 3EODA 1Z5OA 4QOHA 1WULS 1SVUA 4L57A 1WHSA 4UHCA 4L2IB 2LZ0A 1QYDA 1UBEA 3AEQA 3GN1A 2BCGY 3IVCA 3NHUA 3P9NA 1REQA 4Q16A 2GRJA 4RMIA 4GE3A 4X61A 3M33A 1J5EB 4CXMA 2ZATA 1QGUB 5BOSB 4K9LA 4R2LA 4Q00A 2JIZA 4DGQA 3HU2A 3DAYA 4OQNA 4RJLA 2EW1A 5DT2A 1CZRA 4U2DA 4DFDA 3ASVA 1JEYA 1GZ4A 2JFBA 1TZBA 4N0QA 3TXYA 3WGGA 3EGEA 2VOJA 4UFOA 3L7JA 2GYWA 5GONB 3FCCA 5L3SA 4KIUA 3AEUB 4QU9A 4BAGA 4CI0B 2QWXA 4AUKA 4W9MC 2FXVA 1KZ7B 3SVTA 2CBZA 2OZLB 3D2BA 3NQ41 1M2KA 1OAKA 3Q0TA 3G0DA 4MUJA 4OVKA 5EWJB 5EQJB 3M3DA 2P11A 2BDTA 5EZYF 3OLXA 3KYBA 1ST2A 4XFJA 1FPQA 2CLEB 4CIAA 3FPJA 4N7JA 1E3MA 1EP1B 5KMGA 8ABPA 2ADMA 5K45A 3IQXA 1QNLA 1ZI6A 3O0TA 4I9GA 4F5ZA 1Q0LA 4Y9DA 3HDVA 1NC3A 2GPWA 3OIUA 3A27A 1DIRA 1I2BA 3FBGA 5DXJA 4IL5A 1SIOA 2QZSA 3PSHA 1NRJB 1E2EA 3I4LA 3ZNNA 3CS3A 3CVUA 1M3SA 2WSMA 3EXHC 1AKRA 1MIOA 2JGDA 4NZ9A 1UANA 4OBXA 4O4HF 5FNZA 2RG1A 1PFVA 1TJ3A 4TLAA 1MZPA 3FYHA 5CK5A 2IJGX 3QKIA 4FVTA 4LDZA 1GADO 1YAJA 4OM8A 4XDZA 2B8TA 2FUG1 2VF2A 3IODA 3MWEB 5F3RA 3CRNA 5FBZA 4CDRA 1XCBA 3LLCA 1AK1A 2VNKA 1HR0B 2Y1EA 1PG5A 2HY7A 3LU1A 1C2YA 5EJ2A 3KD2A 1QG0A 1ISRA 1H8ED 3I58A 2YCBA 4OHUA 4O4IB 4TS4A 3JQ7B 1T9CA 3WBFA 2QTFA 5HUHA 4ZANA 4XR9A 3X1KA 4HLNA 5H1YA 5BYBA 1E99A 3DONA 1FTSA 1XMJA 2FP4B 3OOHA 2OSVA 3C3XA 4TTRA 1D1PA 2OGSA 4U1RA 5HCIA 4CLHA 3PUJA 2IOYA 2PPLA 1UBJS 3PEUA 4MHSA 2YWHA 1KY4A 2G0TA 1OX6A 4HDRA 1UFKA 4P36A 3H2ZA 2F9MA 3ZH2A 1PJ2A 1PCXA 1XOIA 4BBZA 1BXZA 1SXJD 1NZDA 2A4KA 2ZJ7A 4C9BA 5JSQA 3DEAA 3B1JA 4R2MA 1XKQA 1YZ3A 4XCVA 3AZPA 1EQUA 4MKHA 4HNVA 3II6X 1HA3A 2XDAA 4EPVA 3AF0A 3EA4A 3DPSA 3F4BA 3IEVA 4X6YA 4AXBA 1WHTA 1EGAA 1D07A 1KBOA 2WTNA 2XT0A 3D4PA 1IATA 1PZMA 4ROTA 5AVWA 1IN5A 3T5PA 2UYGA 4N5HX 4UKDA 2WU4A 1EQ2A 4QUDA 3TS1A 4JC4A 3GIWA 1AB5A 3M9WA 3RVDA 2AZMA 1AN0A 3QUSA 1GNTA 2FWAA 4XUCA 3WNQA 3WNBA 4FT2A 2O48X 3N8KA 3NV9A 4I81A 2PA3A 4PU0A 3P9PA 3TAUA 4BGDA 5J5CA 4YAKA 5JAIA 3Q15C 4GR5A 1IPFA 1CE8B 3HCAA 3RB8A 3B7GA 3E2PA 3K1AB 4MOWA 1KYZA 4YDHB 5COBA 3QVUA 4FZRA 1S5PA 3IT2A 2BBWA 3QELB 4DYHA 7ABPA 3DF9A 1NW6A 1RCFA 4N6NA 3U4GA 1V1RA 5EHNA 5IKPA 4FQ8A 1KXZA 2XYHA 4C04A 4UE2A 3UAVA 2P8SA 4UM5A 1Z56C 3D2LA 4CTOA 3KE8A 2ZJ1A 4Y0NA 5LXTA 1FNBA 4CM9A 3LHKA 4YPVA 3JU3A 2XOEA 2BBTA 3FYCA 4DN6A 2Q5EA 4INPA 4CM4A 2OHGA 2PH7A 1ESNA 3F5QA 4YJGA 3ZJTA 2Y99A 3WTCA 1T35A 7REQA 1ZD5A 4ESOA 4Z5XA 1PSZA 2R44A 2DHEA 4LYEA 4AN4A 4Z1OA 4O1MA 4FFPA 4L8GA 4L27A 3T12A 3UUEA 3K32A 1IHXA 3VGPA 2R65A 1C41A 3V7WA 3WQHA 1NM5A 2FSFA 2HU5A 5AKKA 5DEIA 4U2KA 1MC5A 4YQEA 4EATA 4YY3B 2G67A 3HEAA 3IQGX 4PR0A 5JQGF 1E3EA 3FGOA 1Q0SA 1BDJA 4GMGA 1TW2A 4FD2A 2RHMA 2ZWPA 3GN2A 4HFMA 3RTBA 2QRLA 3EGWA 1PLLA 4LBYA 5JSZA 3IB3A 1Y8ZA 3DO8A 1YZGA 2DWQA 3GEBA 2VSNA 4MYSA 1HYHA 4A10A 1ISHA 3ELDA 3HVHA 1HT0A 3GRUA 4HZUA 3NXKA 4WN9B 5CLHA 2ZBDA 5DTMA 3WGIA 1T2CA 2G25A 2Y1FA 3AOEC 5AW5A 4BV9A 1SOMA 2ZCVA 4UBNA 3EIUA 4LRTB 4G36A 4PVCA 1GKIA 1QIHA 2W70A 2DUUA 2EFJA 3DDNA 3FB4A 3MLAA 4DDMA 2CJWB 2BGWA 1J0EA 3QSYA 2EBUA 4BP8A 2VQEB 4A15A 1Z6YA 5IKMA 1I32A 3QUCA 1QTIA 1VCOA 2RKWA 1L7DA 1RKQA 1ZEMA 4HZIA 4L6AA 4O4LA 1KDZA 2VPWA 1RFLA 2QIOA 1XDWA 4JUFA 1ATZA 2C94A 2FW1A 4XQ9A 1F38A 1G20A 2CXPA 1J49A 1A76A 2NZVG 1GQSA 2NZXA 3CT6A 4G8BA 4HQRA 3I76A 1M74A 4EAAA 1WKCA 3F8TA 2EJBA 3U16A 1EESA 4BUJA 1UBNA 1JVSA 4B32A 4ZYYA 3BD9A 3NHMA 5A9SA 3BUSA 3DDSA 4JL8A 4ZCSA 2LVBA 4DWOA 2I33A 3ESDA 3TVTA 2GVDC 2VZ8A 3OIGA 4YUWA 1EH5A 2R47A 4KWCA 2IYOA 2XZPA 2JJ8A 5J1TB 3WYBA 3WL7A 3IEIA 4GOJA 4FWIB 3HE3A 3GNQA 5CFLA 1S2MA 3LRPA 4AG5A 1GPNA 1VHLA 4YRFA 3K9QO 5C9ZA 3V4OA 2I76A 2VYNA 2AE1A 5IF3A 3U31A 4A26A 1LBIA 3PE3A 4U39A 1EJ2A 4CQNA 3F97A 4OP2A 1WXDA 4L28A 4J07A 4CF7A 1LX6A 2AXQA 1L2TA 1U8YA 3L4BC 2VPQA 1JEQB 5KOHB 2C83A 4KO1S 5KNCA 5A3RA 5AJHA 3ZHXA 4A3SA 2YFKA 5CT5A 1N1GA 1XRRA 5FP0A 1B26A 1O95C 1AF7A 1RHMA 2O3QA 3A6GA 3UA3A 4M86A 4DMLA 2OXCA 4PV7A 3NG1A 4FOLA 3N0RA 1SK9A 2ZIUB 4LQDA 4MWDA 3D4IA 5A04A 3VU9B 4G1EB 1VG1A 3AO0B 1TZCA 2NVOA 1NSYA 1EM8B 1D09A 4Q48A 4LNAA 1O57A 3KQNA 3DL4A 3O4JA 4ZIRA 3RODA 3ZH9B 1KJ8A 3CF4A 1N5RA 5FUMA 4TUYB 3V2IA 2P91A 4ZI7A 3PENA 3GP8A 1LLUA 5KYXB 1IEVA 4RV4A 3OJWA 2PRZA 3B9PA 3TXAA 4BMZA 5HZGA 3ZDCA 1CY1A 4YMVA 2C4KA<