2I9VA

Structural role of y98 in pyp: effects on fluorescence, gateway and photocycle recovery
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDQQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Structural role of tyrosine 98 in photoactive yellow protein: effects on fluorescence, gateway, and photocycle recovery.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2i9vA00
2KDKA 1DP9A 3LIEA 2R78A 3D72A 3H7WB 4HP4A 4EESA 3UB7A 4HJ3A 3A0SA 5TBMB 2Z6DA 1OJ5A 4K08A 1T18A 1BYWA 2VV7A 4L9FA 4GHIB 5F69A 1D06A 5AVEA 1T1AA 3A0RA 1Y28A 4WUJA 2H28A 2QJ7A 3NHQA 3P7NA 2QKPA 3VE3A 4EW7A 5HDSA 4NXEA 3E4PA 1GSVA 3MXQA 4XT2B 1UGUA 3LIDA 1XJ2A 3LICA 1KOUA 4NXBA 1OT6A 1T1BA 4HP9A 4LPZA 4JGOA 2QJ5A 1S66L 2CMNA 4RQ9A 1UWNX 4E04A 4HY8A 5DKKA 2ZOIA 1S67L 3MQQA 3C2WA 4HH3A 3E4OA 5EFWA 2A24A 3UB9A 2OWJA 4I3AA 1LT0A 2B02A 3MFXA 1G28A 2VEAA 5AVFA 3PYPA 1NWZA 5J3WA 3H82B 3C8CA 3F1NA 3CWFA 2VV6A 4MN6A 3BY8A 2JN7A 4BBVA 4JGQA 2ZOHA 4BBTA 4EEPA 3IS2A 1ODVA 1V9ZA 1UWPX 1S1YA 3K3CA 2V1AA 4R3AA 2V9AA 5KIZA 4HQAA 4EERA 1LSXA 2PYRA 3LIAA 4GS9B 4LLOB 1OTDA 2BASA 3NOUC 4R70A 2I9VA 3NOPC 1S4RA 2PR6A 5HDCA 1MZUA 3H7WA 3RH8B 2WKRA 1T19A 4KUOA 5HZHA 3UMDA 5TBMA 1N9LA 2ZBBA 1XJ6A 2OWHA 4GHIA 4F3LB 3GECA 3RTYA 1TS8A 1T1CA 3E4QA 2GJ3A 5F5YA 3LIFA 3B33A 4I5SA 5DJUA 1XJ3A 5DJTA 3K3DA 4WLAA 3PHYA 3EEHA 3NJAA 4HJ4A 4MN5A 3KX0X 3EWKA 3ICYA 4XT2A 2QHKA 4H6JB 1V9YA 5HWTA 3LUQA 2D01A 4WF0A 4I39A 5G4YA 2JHEA 1XJ4A 5F68A 1P97A 1OTIA 3F1OB 5J4EA 2PD7A 2P7JA 2Z6CA 4R38A 3F1PA 3UE6A 4DJ3A 3FC7A 1S1ZA 1VB6A 3NOTC 2K7SA 2YKHA 3HJKA 5HD5A 3T50A 5J7EA 2M1CA 1DP8A 3H82A 3MR0A 3SW1A 2VV8A 3LI8A 4BBUA 2V1BA 3BWLA 3IS2B 1TS6A 2W0NA 4JGRA 2L0WA 4EETB 1LSVA 4KUKA 3VE4A 1GSXA 4I3IA 1OJGA 2PYPA 4PKYA 1LL8A 5HDDA 3UB8A 2V0WA 3ZQ5A 3MJQA 2V0UA 1XFNA 2L4RA 1EW0A 1N9OA 3FG8A 5IU1A 2W27A 5HWWA 3H9WA 2D02A 3LI9A 4PKYG 4L9GA 5DKLA 3G6OA 4I3JA 4GW9A 4GCZA 3UMEA 4L9EA 4LRYC 2KX6A 3GDIA 4YWZA 4EXOA 4KQDA 4F3LA 4EEUA 5HSQA 4LRXC 2YKFA 1OTAA 3CLOA 5HD3A 1F98A 1XFQA 3A0VA 3MQOA 4I38A 2PD8A 1DP6A 3LYXA 4WL9A 2EA9A 1TS0A 4H6JA 1P0ZA 4M4XA 1GSWA 1OTBA 5G4ZA 5A8BA 5F6AA 4B9OA 4HHDA 2A24B 1OT9A 4EQ1A 3OLOA 5IS1A 1DRMA 1D7EA 2VLGA 1TS7A 4R6LA 3F1OA 3F1PB 4HNBA 4HH2A 2QWSA 2PDRA 1X0OA 5I5LA 1OTEA 3CAXA 3F1NB 4HI4A 4JGPA 4HOIA 3ULFA 3LIBA 2J80A 4NXGA 2HV1A 3UB6A 4HIAA 4WN5A 3HJIA 2OOLA 2PHYA 3IBRA 1F9IA 1N9NA 2L1MA 1LSWA 4HJ6A 1JNUA 4NXFA 2WKQA 4GS9A 3BY9A 4LRZE 1WA9A 2INWA 5HWVA 3VOLA 2PR5A 2WKPA 4DJ2A 1S4SA
chains in the Genus database with same CATH superfamily
3TG9A 3ZYTA 3LIEA 5HARA 4P0MA 2R78A 4UHUA 2EFUA 5CERA 4E3LA 4HJ3A 4K91A 1VETB 4K08A 3WS1A 1BYWA 3KSFA 4Y3IA 4GHIB 5F69A 2RL3A 4X25A 1FR1A 2M7UA 1D06A 4CQHA 5EE8A 3UY6A 4OQHA 1LL5A 3PBRA 2ZQCA 4MCWA 2ZQ9A 1GHMA 3A0RA 1Y28A 1JWPA 1YKDA 1BSGA 2A3UA 2H28A 1BLCA 3VOZA 4YINA 2QJ7A 3P7NA 2QKPA 3VE3A 4DE2A 5HDSA 4XT2B 3W4QA 1XJ2A 3D9YA 1K6SA 2H0YA 5FATA 1W79A 1IYQA 1L0GA 3AGDA 4QY5A 2XA7M 2CMNA 4PM5A 5IT5A 4DMZA 1S67L 1OPXA 2C5WB 4N9KA 1Z6FA 4RVAA 2JE5A 1K57A 1RGYA 4LV2A 2M7VA 1PFLA 4HBUA 1PWDA 3PYPA 1BT5A 5E2EA 4O8GA 4K0XA 5J3WA 3H82B 5FQJA 1H0MA 1K55C 2HF6A 1MWSA 3R7WB 3TSGA 1CK3A 4FTXA 2ZC4B 3TOIA 5CTNA 3UO9A 5FQMA 4PM9A 5EOOA 3IS2A 1V9ZA 4N1XA 1NZUA 1BTLA 3K3CA 5A90A 3HLDA 5HX9A 3N8RA 2V9AA 4R4RA 2JKGA 2K2NA 2EX8A 1TD5A 4FSFA 2VX8A 4IUHA 3BQ8A 2KLIA 4UQIM 3FPWA 3OOVA 5FDSA 1I5QA 1PZPA 4XUZA 5JYOA 2HP6A 4GDBA 2GZAA 3RH8B 1IKGA 1YLPA 3DW0A 3LR3A 3WS0A 4S2OA 3UMDA 1FIKA 1H5XA 1F2KA 2JKFA 2W1TB 1VETA 4OQGA 1H8MA 5K5BA 4GHIA 4XXRA 5J8XA 3GECA 3Q82A 4MLLA 1FCNA 1W63Q 3QP8A 5F5YA 4I5SA 4BLMA 3LO7A 5DJUA 3N8LA 2V20A 1XJ3A 3CPTB 3K2NA 4GD8A 5HL1A 3QP5A 3PHYA 1IYOA 4X53A 1L0DA 2Y2HA 3KX0X 4S2JA 3ICYA 4XT2A 1Z09A 2QHKA 3LUQA 4KQOA 2VGJA 1J9MA 4KQQA 2ZC6B 4R3JA 1KGFA 1P97A 2QPNA 2P7JA 3CJMA 4B93A 2Z6CA 4R38A 3B3XA 3QP6A 5AJGA 4EU0A 3UE6A 3SOIA 3UNWA 2ZQ8A 1K54C 3S22A 3V39A 1JWZA 3TW8A 4JF6A 3BM6A 3MQ0A 5HD5A 2ZQDA 4XUXA 5HW3A 3G35A 2DMWA 5GHZA 5HL6A 1NY0A 1DP8A 2XDMA 3H82A 4NK3A 3ZG0A 4E6WA 3SW1A 3R7WA 3W2ZA 3LI8A 2ACGA 1G68A 3MMHA 3UDXA 1IKIA 1LHYA 4R23A 2W0NA 3MXSA 4JGRA 4OLGA 4CLCB 4KUKA 4EETB 5TGFA 4EWFA 4G3WA 3V67A 4IHQA 5GLAA 4S2NA 1LI0A 1I2WA 1BLPA 1KDWA 3UB8A 4GD6A 1ACFA 3LR5A 3ZQ5A 5HAIA 1TEMA 3S7OA 4IBXA 4KG5A 2XA7S 1XFNA 3ZHHA 3I7JA 1ESIA 4FH2A 2ZMFA 1JVJA 1Y54A 5DKLA 3N6IA 3NECA 4GW9A 3E2LA 3CZDA 3IQAA 1K54A 1JTGA 4L9EA 5HPFA 4II7A 2KX6A 3GDIA 3RXXA 3U2AA 2W1TA 4P6BA 1SKOA 4EXOA 4KQDA 3UDFA 3BW6A 5HSQA 4CJNA 3O5YA 1O07A 3CPTA 1CJFA 3CLOA 3P09A 4KZAA 3WWXA 3A3FA 4IVIA 3O88A 1PRQA 4G3KA 5HD3A 1F98A 4JF5A 1PW8A 3LYXA 4WL9A 2EA9A 4M4XA 3P01A 1OTBA 3IBJA 1GA0A 4P6ZM 4Z9QA 3PXPA 4DF6A 3M2JA 1OT9A 4UQIS 1G6OA 3OLOA 4EBLA 3PTEA 3VP2A 5FI2A 4R1GA 3IX4A 4HH2A 1X0OA 4KZBA 2Y2KA 3LR0A 5DTTA 2JBFA 4LV0A 3F1NB 4CLCE 3ULFA 3ZG8B 3IX3A 2OLVA 4KZ7A 1SKFA 3MKFA 4KZ5A 2WK0A 3A3JA 5CECA 4NXGA 1MWUA 3KSGA 3UB6A 2WYXA 2XSSA 3VP4A 3DAVA 4WN5A 3GRJA 4KZ8A 2OOLA 5EPHA 3S1YA 2XFSA 1F9IA 4OLDA 3A3DA 4H8RA 4QWOA 2J8YA 3OPHA 5DVAA 2X02A 3LEZA 5CEBA 4ZJ3A 2FZ0A 4HJ6A 4GLQA 2ZL1B 4UAAA 1JNUA 3HUOA 4S2MA 1L0EA 2PBYA 5DFYA 2XR0A 2JKTM 2W3HA 3VV4A 5CGXA 1KE4A 2LB5A 4JBFA 5GLDA 1WYBA 4LCLA 4Y0OA 2EX6A 3H7WB 3T4JA 1DJCA 3UB7A 3BQAA 1OJ5A 2ZMAA 5M1AA 3HLGA 1T18A 5DFXA 1ONGA 4BQMA 2WADA 1E3UA 3ZCZA 3C7UA 1T1AA 2UWXA 2PRFA 3C5AA 3HVFA 4ZRRA 3LFVA 2ZD8A 3MKEA 5FDHA 2JKRI 4E3KA 1NRFA 3CHWP 2XD5A 4EW7A 1H8YA 2XLNA 2Y2PA 3LIDA 3DBAA 1KOUA 1OT6A 4HP9A 4LPZA 4X68A 1DY6A 2JCHA 3O3VA 4RQ9A 1UWNX 4E04A 4OP5A 4HY8A 1PI5A 1LI9A 3ZVWA 3O86A 1BLHA 3NIAA 4Y0TA 1ERMA 2Y2QA 3UB9A 4OPRA 4X6TA 1LT0A 4FUWA 2B02A 3BECA 4HBTA 5AQ9A 5HPIA 4LV1A 3OPPA 1N4OA 3SZTA 3HREA 4D60A 1FCMA 3O87A 1K0KA 4ID4A 4ZBEA 3F1NA 5CHUA 4O01A 2XD1A 3VSKA 4WEKA 1KE0A 1CI9A 5EVEA 2VV6A 4MN6A 3BY8A 3S7PA 3BFCA 4BBVA 4JGQA 2ZOHA 4O7DA 4ZJ1A 1S1YA 1RCJA 4M3KA 2XFTA 3B42A 3BFGA 1AWIA 3Q81A 1K25A 1E3UD 4HQAA 1YLWA 4UA6A 1YSPA 5U47A 2WKHA 3G4PA 4QU3A 4EUZA 2ZL1A 3T1SA 3LIAA 4GOGA 2Q0OA 1ZC2A 4GJ4A 1L0FA 4R70A 1K6RA 4DN0A 2ZM8A 4ETZA 3KO6A 5BOHA 5EVIB 1K57C 2GDNA 4JF4A 4S2KA 3H7WA 5FEGA 2J9PA 4GKUA 5C5KA 1YLJA 3VFFA 1H8ZA 1N9LA 1XXMA 2J3TC 4IEDA 1XJ6A 4GN2A 3HUNA 4MBHA 2Y59A 4ARZB 3VP3A 1TS8A 2WAFA 2GJ3A 3LIFA 2B95A 3T12B 3ZVTA 5HAPA 4NETA 1XKZA 3VSLA 1CEGA 2Y2JA 3N7WA 3LEQA 5DF7A 4HJ4A 4X55A 1STZA 3N4IA 4DDSA 3EWKA 2ZMVA 4OPYA 5FI7A 2Y2GA 4DE1A 2HZ5A 3Q7ZA 1ZTUA 1I2SA 4IVKA 5FQIA 3T4SA 4UEYA 5G4YA 1S6RA 2V1ZA 3QNBA 2VZWA 1M6KA 2EWWA 4KZ4A 2PD7A 3SS4A 3E2KA 1YLTA 3F1PA 1QMEA 4F94A 1ESUA 1G6AA 3SS3A 1ERQA 2HJEA 4GDNA 5EVIC 1ONHA 3FC7A 1S1ZA 4U0XA 2B5RA 3GV9A 2K7SA 3HJKA 4U0TA 3SH8A 4KZ9A 1PWCA 5M18A 3HUMA 1NYYA 4D2OA 3FYZA 1QMFA 4KG2A 4OONA 1PZOA 3AGFA 2V1BA 3HLCA 1BUEA 2OV5A 4JKTA 3MZDA 4BL2A 3OCLA 4BMWA 3VE4A 5EECA 1OJGA 3SH7A 2OAQ1 4N92A 4PKYA 1ZG6A 3Q7VB 5HDDA 3C4PA 3OC2A 2VGLS 3CMZA 5GHYA 4KG6A 3N8SA 3E98A 3MJQA 4OQ0A 2PU4A 4UA9A 2L4RA 3C4OA 3TJZC 1EW0A 1N9OA 2XQZA 3IX8A 3DTMA 3CUEC 5CRFA 2Y2IA 5M19A 3LI9A 4PKYG 4L9GA 2EX2A 5EVIA 4GCZA 3UMEA 2EWVA 4Y7PA 2WGIA 4LENA 3LY4A 3NCKA 1F5MA 2EXBA 2VJWA 3FZCA 4DDYA 3IXHA 3WS2A 3OCNA 2FFFB 4ARZA 3IWOA 3HBRA 4Z1WA 1XA7A 2PT7A 3VOYA 2J3TD 5GL9A 4ZTKA 3MBZA 5E2GA 4Y2FA 4WM9A 4S2NC 2GNXA 3BRMA 4R0QA 3EGDC 2WGVA 4I38A 1MPLA 2ZC7A 2W3DA 2PBDP 1P0ZA 3BYDA 1GSWA 1XGJA 5G4ZA 5HFOA 2O0YA 2H0TA 4MDZA 2A24B 1NJ4A 4B4ZA 3MFDA 1DRMA 1D7EA 2VLGA 3CUEA 4R6LA 3QP2A 1SDEA 2XH9A 4MMNA 4HNBA 3IH9A 2QWSA 2UV0E 1W63M 2PDRA 5I5LA 3HLWA 2Y91A 3DTIA 3G31A 5KSHA 3KYZA 4CPKA 3P98A 5EVID 1JTDA 3RFBA 5F82A 5F83A 2W3EA 4HIAA 3IXBA 3HJIA 1M40A 3IBRA 2H10A 1YLYA 3G32A 1IFQA 1N9NA 2RCXA 2L1MA 1LSWA 5L8MA 3W8KA 1TVFA 1TDLA 4NXFA 3ZG9B 1S0WA 3B47A 4LRZE 1WA9A 1FCOA 5HWVA 4BL3A 4B88A 2KDKA 1YPRA 1DP9A 2O9BA 3MSHA 1YLZA 2PAVP 2ZM0A 4OVDA 3ZG7B 4HP4A 1HD8A 5TBMB 2Z6DA 1K56A 3S4XA 2W1RA 1W7FA 2VV7A 4Y17A 5AVEA 3V3SA 2ZQ7A 1P9RA 1RP5A 3MF0A 1D1JA 3VP0A 5FAPA 4MBFA 4NXEA 3E4PA 3MXQA 1UGUA 4CLCC 3BFFA 3QNCA 2OSUA 3UDIA 3WRZA 4DKIA 1YM1A 1VEUB 2BTFP 3ZNTA 3PBTA 3EQUA 3Q07A 5FQQA 2HP9A 2XRNA 3G30A 4MN7A 5DKKA 1K4EA 3RJUA 3MQQA 3C2WA 4U3TA 5CGWA 3E0YA 5EFWA 4EQIA 2A24A 4I3AA 4KZ6A 3MFXA 2Y79A 1G28A 3PBNA 4N9LA 3RXWA 2VEAA 4AFIA 4R4SA 5AVFA 3T1QB 1NWZA 3SH9A 1GHIA 5GHXA 1K4FA 1G5UA 4BD1A 3S7QA 3IH8A 4PAUA 5CX7A 4EV4A 2Y2NA 5EUAA 4Q0IA 1EI5A 1K56D 4BBTA 4OKPA 1UWPX 3GMWA 1HVBA 4QY6A 2V1AA 5FL3A 1SCWA 3OBFA 4UA7A 4CLCA 1MWRA 5KIZA 5FI6A 4EERA 5CHMA 4JPMA 1LSXA 4GB7A 1ALQA 4BWIA 2PYRA 2BLSA 4Q0HA 1CF0A 4GS9B 1BZAA 4X56A 3IF5A 4LLOB 2XGNA 2ZC3B 4JXSA 4MNRA 1MKIA 2I9VA 1RGZA 3G2ZA 2Y2LA 5LBRA 1S4RA 3GTCA 2Y4AA 3BFDA 2WKEA 5A93A 1MZUA 2IWBA 1MY8A 2WKRA 1T19A 1JWVA 4RYEA 1C3BA 3ZDJA 4ZDXA 2VKSA 1EROA 5TBMA 4E3MA 1HZOA 2HGVA 2ZBBA 2OWHA 4PPRA 3ZG5A 3RTYA 1VM1A 3EEAA 1XP4A 3E4QA 4LCMA 1FILA 3NC8A 3T4QA 3B33A 4ME4A 2WZXA 4OOMA 1XGIA 1XA1A 4WLAA 3NJAA 3ITAA 3T4KA 1Y4OA 1YSQA 3WRTA 1N9BA 3C38A 5HWTA 3JPUA 1IYPA 3C30A 1VEUA 4I39A 4ETXA 2JHEA 4CLCD 5F1GA 5CEDA 5CXWA 4DXCA 1OTIA 3F1OB 5FQKA 3UPPA 1PNEA 3S7NA 2OLUA 2FFYA 1GHPA 2HDRA 4WEJA 1O7EA 4QB8A 4LGWA 1SDNA 2IWCA 3NOTC 3ZGAB 2YKHA 3FKVA 1SZVA 2Y8HA 3W4PA 2NUPC 3MR0A 3KSHA 3KYEA 1MXOA 4KENB 1LLBA 2O9AA 3A3IA 1DJAA 4LV3A 3IS2B 1DJBA 2HDQA 3QP4A 4K0WA 2ZLYA 2P04A 2R9WA 3R4KA 3OPLA 4E3JA 2PYPA 2WUQA 4Y0UA 1KE3A 3WS4A 1FQGA 4OH0A 3KYQA 4P6ZS 2FH5A 3FG8A 2W27A 3NDGA 5HWWA 5GLCA 5DF9A 4I3JA 3UE1A 1ES2A 2PU2A 2Y2OA 3VFHA 2VA0A 4LRYC 2Z2MB 2W3GA 2QYBA 1LL9A 1VHMA 2MJ6A 3FKWA 4YWZA 3UE3A 3ITBA 4EEUA 5DTKA 4LRXC 5EM1A 1FR6A 3MXRA 1GA9A 2YKFA 1L2SA 3T1RA 1NZOA 5F1FA 1Q2PA 1TF1A 1HTZA 4OOLA 5EM0A 2EFXA 3PBSA 4DE3A 4RA7A 1H3QA 3G2YA 3HLFA 2PD8A 1YAXA 3PR6A 5A8BA 4B9OA 1U60A 1FOFA 2W3FA 3HLBA 4DRTA 4WYYA 1TS7A 1KVLA 3F1OA 3EOIA 1OTEA 1ES3A 2JKTI 2X01A 1YT4A 4HI4A 4HOIA 4G3VA 5FQ9A 1KVMA 3JYIA 2J80A 2Q9MA 2BG1A 3V3RA 4Q0JA 4PM6A 3IXGA 2HV1A 3VP1A 2ZC5B 2J7VA 4GNUA 4QPRA 4ZJ2A 2WGWB 3UN7A 3NBLA 3V50A 1W5DA 4Y13A 3LCEA 4EBPA 4NEED 3JVUA 1OMEA 3PAGA 4S2LA 1IYSA 1ZG4A 3G34A 3UPNA 3DWZA 1HLUP 2H5SA 2WKQA 5FA7A 2I72A 3GVBA 5L2FA 2VGKA 1Q2QA 2PR5A 2WKPA 2WAEA 4DJ2A 1S4SA 3LGOA 2Q9NA 2EX9A 3MS6A 2G7UA 4MEZA 4P87A 2Z2LB 3D72A 3IT9A 1FSWA 3PBQA 4EESA 1KDSA 2A49A 3BJNA 3A0SA 4KQRA 3IWIA 4JXVA 4L0LA 3HCYA 3FWLA 3IHBA 4ZAMA 4L9FA 4IUKA 1CEFA 3BLMA 4EUVA 1EWZA 2R9XA 5A92A 1NRJA 4S2PA 1K55A 2O9CA 3CG5A 4WUJA 1SKOB 4FD8A 1KGEA 3NHQA 1W8YA 1NXYA 3GR2A 5MC7A 4WZ5C 4RX3A 4C6YA 5TJJA 1ES5A 1GSVA 3EQVA 1MKMA 3LICA 2JC7A 3T4OA 5FAQA 4NXBA 4HEFA 2HPBA 1T1BA 2XROA 3LR4A 4JGOA 2QJ5A 1S66L 3T4LA 5KZHA 3LY3A 4B4XA 1FSYA 2ZOIA 1A0KA 3HLEA 3M6HA 4Y15A 4C75A 4HH3A 5DTSA 3E4OA 5GLBA 3IHAA 2OWJA 5D3OA 5AQAA 4E6XA 2JKRM 5FSRA 1W8QA 4NG2A 4E3IA 1MC0A 3MZEA 2ZJ9A 5FASA 2X71A 3DTEA 4JXWA 3C8CA 4P85A 3T1XA 3OPRA 3L9KA 2IA2A 3CWFA 1WE4A 3IF6B 3HL9A 5AQBA 2JN7A 4X1MA 4PHTA 4EEPA 4JXGA 1ODVA 3FPVA 3L7HA 3EGXC 4WZ5A 2WGWA 4R3AA 3D4FA 3W4OA 2WKIA 2WZZA 2AVXA 3IXDA 3Q7VA 4BJPA 2HP5A 2V2FF 3QHYA 2P9VB 1OTDA 3UPOA 3NDEA 2BASA 2EXAA 3NOUC 2GX5A 3NOPC 4YOFA 2C6WB 1GCEA 2PR6A 3ISGA 5HDCA 1ZHHB 4IJGA 1NYMA 1ES4A 4KUOA 2HJ9C 5KSCA 5HZHA 1PYYA 3ZFZA 1TDGA 4PMAA 4HESA 2OAP1 1BULA 4F3LB 5A91A 1PW1A 5I94A 2B18A 1T1CA 4FOFA 4X1LA 2J3WA 4NKPA 2QZ6A 4YFMA 3DWKA 4PM8A 3IF6C 5DJTA 1SHVA 3JVVA 2ZQAA 3TE8A 4A5RA 3QP1A 3K3DA 3EEHA 3IWQA 2KOIA 4KZ3A 4E3NA 4MN5A 3M2KA 3PAEA 4FH4A 4QJGA 4YNRA 5FEFA 1YMSA 4H6JB 3ZNYA 3UE0A 5CHJA 4E3OA 3KSIA 1V9YA 1MBLA 2HDSA 2D01A 4WF0A 2E8JA 2Y2MA 1PWGA 1XJ4A 5F68A 3SS5A 2J9OA 1L3LA 5J4EA 3FV7A 4C3QA 2Y55A 5TR7A 5L07A 2O99A 2IWDA 5E2HA 1XPBA 4S2IA 4DJ3A 5AQ7A 2CC1A 1VB6A 5EV0A 5TFQA 3OZHA 3T50A 5J7EA 4OOYA 2M1CA 1J3WA 1KGGA 2XEPA 4DXBA 3IF6A 2VV8A 3A3EA 4BBUA 3BWLA 1TS6A 2ZM2A 2L0WA 1LSVA 2NUTC 1GSXA 1XX2A 4N1HA 2XF3A 1IEMA 4I3IA 2LB9A 2HDUA 1E4DA 3BFEA 1LL8A 2K31A 3TRCA 2P74A 3NULA 2V0WA 3NY4A 2V0UA 3GQZA 3GSGA 2P9VA 4X69A 4Y5FA 5EVLA 5IU1A 2G2WA 1PIOA 5IHVA 3H9WA 2D02A 4WELA 3D3OA 3G6OA 3C7VA 4OPQA 5JYPA 3V5MA 4OPZA 4ESPA 1MWTA 3UB5P 5DF8A 2P08A 4QD4A 1NLZA 1AXBA 5EOEA 1YMXA 5L09A 1E25A 2DNSA 4F3LA 4WMCA 4Q8IA 3BEBA 4WBGA 1P9WA 4QHCA 2DCFA 4O0PA 1OTAA 3MZFA 5KMWA 2G2UA 1XFQA 1K38A 3A0VA 3MQOA 1CQAA 1DP6A 3NI9A 1NLYA 5FAOA 1TS0A 2VGLM 4H6JA 5E2FA 2E8IA 3AGEA 2V8CA 4DE0A 5F6AA 4HHDA 4IBRA 2QMIA 4EQ1A 5CGSA 5CTMA 5IS1A 2VK3A 3DTKA 1IOUA 3F1PB 5G18A 3M6BA 3CAXA 3CITA 4FCFA 1PI4A 4JGPA 5E43A 3T4TA 2V8FA 4LFUA 3LIBA 4MBKA 3PBOA 1CI8A 5HAQA 1ZKJA 4OQIA 4RX2A 5L10A 4OP8A 1IELA 2PHYA 3VMAA 4BENA 1VQQA 4EBNA 4GZBA 4PM7A 4WMCD 1WYCA 2DRWA 3WS5A 3BLSA 4GS9A 2A2LA 3BY9A 4JLFA 3CI6A 2INWA 4WZ4A 4BD0A 1YQSA 4R3BA 3U4LP 2XK1A 3VOLA 1BLSA 3Q1FA
chains in the Genus database with same CATH topology
2KDKA 3ZYTA 1DP9A 2O9BA 3LIEA 2R78A 3D72A 3H7WB 4HP4A 3T4JA 3PBQA 4EESA 3UB7A 4HJ3A 3BJNA 3BQAA 3A0SA 5TBMB 2Z6DA 1OJ5A 4L0LA 3HCYA 4K08A 1T18A 2W1RA 5DFXA 1BYWA 2VV7A 4L9FA 3KSFA 4Y3IA 4GHIB 4IUKA 5F69A 4EUVA 2M7UA 1D06A 4CQHA 5AVEA 1NRJA 3PBRA 1T1AA 4MCWA 2O9CA 3A0RA 1Y28A 4WUJA 4ZRRA 1YKDA 3LFVA 1P9RA 2H28A 3MF0A 2QJ7A 3NHQA 3P7NA 2QKPA 2JKRI 3VE3A 5MC7A 4EW7A 5HDSA 4NXEA 3E4PA 5TJJA 1GSVA 3MXQA 3EQVA 1UGUA 4XT2B 3LIDA 4CLCC 3DBAA 1MKMA 1XJ2A 3LICA 1KOUA 3T4OA 4NXBA 1OT6A 1T1BA 2XROA 4HP9A 4LPZA 3LR4A 3PBTA 4JGOA 3EQUA 2QJ5A 1S66L 3T4LA 2XA7M 2CMNA 4RQ9A 1UWNX 4E04A 4HY8A 5IT5A 2XRNA 4MN7A 5DKKA 2ZOIA 4DMZA 1S67L 1OPXA 3MQQA 3C2WA 4HH3A 3E0YA 3E4OA 5EFWA 2A24A 3UB9A 2OWJA 4I3AA 1LT0A 2B02A 2Y79A 1G28A 3MFXA 3PBNA 2VEAA 2M7VA 4AFIA 5HPIA 2JKRM 5AVFA 3PYPA 1MC0A 1NWZA 4O8GA 5J3WA 3H82B 3C8CA 3F1NA 2HF6A 2IA2A 4O01A 3R7WB 3CWFA 4WEKA 3S7QA 4PAUA 2VV6A 5CX7A 4MN6A 4Q0IA 3BY8A 2JN7A 3S7PA 4BBVA 4PHTA 4JGQA 2ZOHA 4BBTA 4EEPA 3IS2A 1ODVA 1V9ZA 1UWPX 3FPVA 3EGXC 1S1YA 3B42A 3K3CA 2V1AA 5FL3A 4R3AA 3OBFA 4CLCA 2V9AA 5KIZA 4HQAA 2K2NA 1TD5A 4EERA 4FSFA 1YSPA 2VX8A 1LSXA 4IUHA 4BWIA 4BJPA 3BQ8A 2PYRA 4Q0HA 3LIAA 4GS9B 2KLIA 4UQIM 4LLOB 3FPWA 1OTDA 4GJ4A 2BASA 3OOVA 3NOUC 4R70A 4DN0A 2I9VA 2GX5A 3NOPC 4YOFA 5LBRA 4ETZA 1S4RA 3KO6A 2PR6A 5HDCA 1MZUA 1ZHHB 4IJGA 2GZAA 3H7WA 3RH8B 2WKRA 5C5KA 1T19A 4KUOA 2HJ9C 3LR3A 2VKSA 5HZHA 3UMDA 5TBMA 2W1TB 1N9LA 2J3TC 2HGVA 2ZBBA 1XJ6A 2OAP1 1H8MA 5K5BA 2OWHA 4GHIA 4F3LB 3GECA 3RTYA 4ARZB 3EEAA 1TS8A 2B18A 1T1CA 3E4QA 4FOFA 2GJ3A 2J3WA 1W63Q 4NKPA 5F5YA 3LIFA 3T4QA 3B33A 4ME4A 4I5SA 4OOMA 5DJUA 1XJ3A 5DJTA 3JVVA 3K2NA 3TE8A 3K3DA 4WLAA 3PHYA 3EEHA 3NJAA 4HJ4A 2KOIA 1STZA 4MN5A 3T4KA 3KX0X 3EWKA 2ZMVA 1YSQA 3ICYA 4XT2A 2QHKA 4YNRA 4H6JB 3C38A 3KSIA 1V9YA 5HWTA 3LUQA 4KQOA 3C30A 1ZTUA 2D01A 4WF0A 4I39A 3T4SA 4UEYA 5G4YA 4ETXA 2JHEA 4CLCD 1XJ4A 2VZWA 5F68A 1P97A 1OTIA 2EWWA 3F1OB 5J4EA 2PD7A 2P7JA 4B93A 2Z6CA 3S7NA 4R38A 3F1PA 2O99A 5AJGA 4EU0A 2HJEA 3UE6A 4WEJA 4DJ3A 3FC7A 1S1ZA 1VB6A 3NOTC 3HJKA 2K7SA 2YKHA 3TW8A 3MQ0A 5HD5A 3T50A 5J7EA 2DMWA 5HL6A 2M1CA 2Y8HA 1DP8A 3H82A 2NUPC 3MR0A 3SW1A 3R7WA 3W2ZA 3KSHA 2VV8A 3LI8A 2O9AA 4BBUA 3MMHA 2V1BA 3BWLA 3IS2B 1TS6A 2P04A 2W0NA 4JGRA 2L0WA 4EETB 3OCLA 1LSVA 3R4KA 4KUKA 3VE4A 2NUTC 4BMWA 1GSXA 4CLCB 4G3WA 3V67A 4I3IA 4IHQA 1OJGA 2OAQ1 2LB9A 2PYPA 4PKYA 1LL8A 2K31A 5HDDA 3TRCA 3UB8A 3OC2A 2VGLS 2V0WA 3LR5A 3ZQ5A 3E98A 3MJQA 3KYQA 2V0UA 3S7OA 2XA7S 1XFNA 4P6ZS 2L4RA 4Y5FA 2FH5A 3TJZC 1EW0A 1N9OA 3FG8A 5IU1A 2W27A 2ZMFA 5HWWA 3H9WA 3CUEC 2D02A 4WELA 3LI9A 4PKYG 4L9GA 5DKLA 3D3OA 3G6OA 5DF9A 4I3JA 4GW9A 4GCZA 3UMEA 2EWVA 4L9EA 5HPFA 2VA0A 4II7A 4LRYC 2KX6A 2P08A 3GDIA 2W3GA 1NLZA 1F5MA 2QYBA 3U2AA 2VJWA 2W1TA 1VHMA 2MJ6A 4YWZA 4EXOA 4KQDA 4F3LA 3UE3A 3OCNA 3BW6A 4ARZA 4Z1WA 4EEUA 5HSQA 2PT7A 4LRXC 3O5YA 1P9WA 2J3TD 2YKFA 4O0PA 1OTAA 3CLOA 1TF1A 4Y2FA 4OOLA 3PBSA 2GNXA 4G3KA 5HD3A 1F98A 3EGDC 1XFQA 1H3QA 3A0VA 3MQOA 4I38A 2PD8A 1DP6A 3LYXA 1NLYA 1YAXA 4WL9A 2EA9A 2W3DA 1TS0A 2VGLM 4H6JA 1P0ZA 4M4XA 1GSWA 3P01A 1OTBA 3IBJA 5G4ZA 3PR6A 5A8BA 5F6AA 4B9OA 4HHDA 4P6ZM 2O0YA 4MDZA 2W3FA 2A24B 3PXPA 4UQIS 1OT9A 4EQ1A 1G6OA 3OLOA 5IS1A 1DRMA 1D7EA 2VLGA 1TS7A 3CUEA 4R6LA 1IOUA 4MMNA 3F1OA 3F1PB 4HNBA 4HH2A 2QWSA 1W63M 3EOIA 2PDRA 1X0OA 5I5LA 1OTEA 3CAXA 2JKTI 3LR0A 3CITA 3F1NB 4HI4A 4JGPA 3T4TA 4HOIA 3ULFA 4CLCE 4G3VA 3LIBA 2J80A 3PBOA 5KSHA 3KYZA 4Q0JA 4NXGA 2HV1A 3RFBA 3KSGA 3UB6A 4QPRA 2W3EA 4HIAA 2XSSA 4WN5A 3HJIA 2OOLA 2PHYA 3IBRA 1F9IA 4NEED 1IFQA 1N9NA 3JVUA 2L1MA 1LSWA 5L8MA 2FZ0A 4HJ6A 4GLQA 1JNUA 4NXFA 2WKQA 4GS9A 2A2LA 5DFYA 3B47A 3BY9A 4LRZE 1WA9A 2JKTM 2W3HA 3VV4A 3CI6A 2INWA 5HWVA 3VOLA 2PR5A 2LB5A 2WKPA 4DJ2A 1S4SA 2G7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDK A;  1DP9 A;  3LIE A;  2R78 A;  3D72 A;  3H7W B;  4HP4 A;  4EES A;  3UB7 A;  4HJ3 A;  3A0S A;  5TBM B;  2Z6D A;  1OJ5 A;  4K08 A;  1T18 A;  1BYW A;  2VV7 A;  4L9F A;  4GHI B;  5F69 A;  1D06 A;  5AVE A;  1T1A A;  3A0R A;  1Y28 A;  4WUJ A;  2H28 A;  2QJ7 A;  3NHQ A;  3P7N A;  2QKP A;  3VE3 A;  4EW7 A;  5HDS A;  4NXE A;  3E4P A;  1GSV A;  3MXQ A;  4XT2 B;  1UGU A;  3LID A;  1XJ2 A;  3LIC A;  1KOU A;  4NXB A;  1OT6 A;  1T1B A;  4HP9 A;  4LPZ A;  4JGO A;  2QJ5 A;  1S66 L;  2CMN A;  4RQ9 A;  1UWN X;  4E04 A;  4HY8 A;  5DKK A;  2ZOI A;  1S67 L;  3MQQ A;  3C2W A;  4HH3 A;  3E4O A;  5EFW A;  2A24 A;  3UB9 A;  2OWJ A;  4I3A A;  1LT0 A;  2B02 A;  3MFX A;  1G28 A;  2VEA A;  5AVF A;  3PYP A;  1NWZ A;  5J3W A;  3H82 B;  3C8C A;  3F1N A;  3CWF A;  2VV6 A;  4MN6 A;  3BY8 A;  2JN7 A;  4BBV A;  4JGQ A;  2ZOH A;  4BBT A;  4EEP A;  3IS2 A;  1ODV A;  1V9Z A;  1UWP X;  1S1Y A;  3K3C A;  2V1A A;  4R3A A;  2V9A A;  5KIZ A;  4HQA A;  4EER A;  1LSX A;  2PYR A;  3LIA A;  4GS9 B;  4LLO B;  1OTD A;  2BAS A;  3NOU C;  4R70 A;  2I9V A;  3NOP C;  1S4R A;  2PR6 A;  5HDC A;  1MZU A;  3H7W A;  3RH8 B;  2WKR A;  1T19 A;  4KUO A;  5HZH A;  3UMD A;  5TBM A;  1N9L A;  2ZBB A;  1XJ6 A;  2OWH A;  4GHI A;  4F3L B;  3GEC A;  3RTY A;  1TS8 A;  1T1C A;  3E4Q A;  2GJ3 A;  5F5Y A;  3LIF A;  3B33 A;  4I5S A;  5DJU A;  1XJ3 A;  5DJT A;  3K3D A;  4WLA A;  3PHY A;  3EEH A;  3NJA A;  4HJ4 A;  4MN5 A;  3KX0 X;  3EWK A;  3ICY A;  4XT2 A;  2QHK A;  4H6J B;  1V9Y A;  5HWT A;  3LUQ A;  2D01 A;  4WF0 A;  4I39 A;  5G4Y A;  2JHE A;  1XJ4 A;  5F68 A;  1P97 A;  1OTI A;  3F1O B;  5J4E A;  2PD7 A;  2P7J A;  2Z6C A;  4R38 A;  3F1P A;  3UE6 A;  4DJ3 A;  3FC7 A;  1S1Z A;  1VB6 A;  3NOT C;  2K7S A;  2YKH A;  3HJK A;  5HD5 A;  3T50 A;  5J7E A;  2M1C A;  1DP8 A;  3H82 A;  3MR0 A;  3SW1 A;  2VV8 A;  3LI8 A;  4BBU A;  2V1B A;  3BWL A;  3IS2 B;  1TS6 A;  2W0N A;  4JGR A;  2L0W A;  4EET B;  1LSV A;  4KUK A;  3VE4 A;  1GSX A;  4I3I A;  1OJG A;  2PYP A;  4PKY A;  1LL8 A;  5HDD A;  3UB8 A;  2V0W A;  3ZQ5 A;  3MJQ A;  2V0U A;  1XFN A;  2L4R A;  1EW0 A;  1N9O A;  3FG8 A;  5IU1 A;  2W27 A;  5HWW A;  3H9W A;  2D02 A;  3LI9 A;  4PKY G;  4L9G A;  5DKL A;  3G6O A;  4I3J A;  4GW9 A;  4GCZ A;  3UME A;  4L9E A;  4LRY C;  2KX6 A;  3GDI A;  4YWZ A;  4EXO A;  4KQD A;  4F3L A;  4EEU A;  5HSQ A;  4LRX C;  2YKF A;  1OTA A;  3CLO A;  5HD3 A;  1F98 A;  1XFQ A;  3A0V A;  3MQO A;  4I38 A;  2PD8 A;  1DP6 A;  3LYX A;  4WL9 A;  2EA9 A;  1TS0 A;  4H6J A;  1P0Z A;  4M4X A;  1GSW A;  1OTB A;  5G4Z A;  5A8B A;  5F6A A;  4B9O A;  4HHD A;  2A24 B;  1OT9 A;  4EQ1 A;  3OLO A;  5IS1 A;  1DRM A;  1D7E A;  2VLG A;  1TS7 A;  4R6L A;  3F1O A;  3F1P B;  4HNB A;  4HH2 A;  2QWS A;  2PDR A;  1X0O A;  5I5L A;  1OTE A;  3CAX A;  3F1N B;  4HI4 A;  4JGP A;  4HOI A;  3ULF A;  3LIB A;  2J80 A;  4NXG A;  2HV1 A;  3UB6 A;  4HIA A;  4WN5 A;  3HJI A;  2OOL A;  2PHY A;  3IBR A;  1F9I A;  1N9N A;  2L1M A;  1LSW A;  4HJ6 A;  1JNU A;  4NXF A;  2WKQ A;  4GS9 A;  3BY9 A;  4LRZ E;  1WA9 A;  2INW A;  5HWV A;  3VOL A;  2PR5 A;  2WKP A;  4DJ2 A;  1S4S A; 
#chains in the Genus database with same CATH topology
 3TG9 A;  3ZYT A;  3LIE A;  5HAR A;  4P0M A;  2R78 A;  4UHU A;  2EFU A;  5CER A;  4E3L A;  4HJ3 A;  4K91 A;  1VET B;  4K08 A;  3WS1 A;  1BYW A;  3KSF A;  4Y3I A;  4GHI B;  5F69 A;  2RL3 A;  4X25 A;  1FR1 A;  2M7U A;  1D06 A;  4CQH A;  5EE8 A;  3UY6 A;  4OQH A;  1LL5 A;  3PBR A;  2ZQC A;  4MCW A;  2ZQ9 A;  1GHM A;  3A0R A;  1Y28 A;  1JWP A;  1YKD A;  1BSG A;  2A3U A;  2H28 A;  1BLC A;  3VOZ A;  4YIN A;  2QJ7 A;  3P7N A;  2QKP A;  3VE3 A;  4DE2 A;  5HDS A;  4XT2 B;  3W4Q A;  1XJ2 A;  3D9Y A;  1K6S A;  2H0Y A;  5FAT A;  1W79 A;  1IYQ A;  1L0G A;  3AGD A;  4QY5 A;  2XA7 M;  2CMN A;  4PM5 A;  5IT5 A;  4DMZ A;  1S67 L;  1OPX A;  2C5W B;  4N9K A;  1Z6F A;  4RVA A;  2JE5 A;  1K57 A;  1RGY A;  4LV2 A;  2M7V A;  1PFL A;  4HBU A;  1PWD A;  3PYP A;  1BT5 A;  5E2E A;  4O8G A;  4K0X A;  5J3W A;  3H82 B;  5FQJ A;  1H0M A;  1K55 C;  2HF6 A;  1MWS A;  3R7W B;  3TSG A;  1CK3 A;  4FTX A;  2ZC4 B;  3TOI A;  5CTN A;  3UO9 A;  5FQM A;  4PM9 A;  5EOO A;  3IS2 A;  1V9Z A;  4N1X A;  1NZU A;  1BTL A;  3K3C A;  5A90 A;  3HLD A;  5HX9 A;  3N8R A;  2V9A A;  4R4R A;  2JKG A;  2K2N A;  2EX8 A;  1TD5 A;  4FSF A;  2VX8 A;  4IUH A;  3BQ8 A;  2KLI A;  4UQI M;  3FPW A;  3OOV A;  5FDS A;  1I5Q A;  1PZP A;  4XUZ A;  5JYO A;  2HP6 A;  4GDB A;  2GZA A;  3RH8 B;  1IKG A;  1YLP A;  3DW0 A;  3LR3 A;  3WS0 A;  4S2O A;  3UMD A;  1FIK A;  1H5X A;  1F2K A;  2JKF A;  2W1T B;  1VET A;  4OQG A;  1H8M A;  5K5B A;  4GHI A;  4XXR A;  5J8X A;  3GEC A;  3Q82 A;  4MLL A;  1FCN A;  1W63 Q;  3QP8 A;  5F5Y A;  4I5S A;  4BLM A;  3LO7 A;  5DJU A;  3N8L A;  2V20 A;  1XJ3 A;  3CPT B;  3K2N A;  4GD8 A;  5HL1 A;  3QP5 A;  3PHY A;  1IYO A;  4X53 A;  1L0D A;  2Y2H A;  3KX0 X;  4S2J A;  3ICY A;  4XT2 A;  1Z09 A;  2QHK A;  3LUQ A;  4KQO A;  2VGJ A;  1J9M A;  4KQQ A;  2ZC6 B;  4R3J A;  1KGF A;  1P97 A;  2QPN A;  2P7J A;  3CJM A;  4B93 A;  2Z6C A;  4R38 A;  3B3X A;  3QP6 A;  5AJG A;  4EU0 A;  3UE6 A;  3SOI A;  3UNW A;  2ZQ8 A;  1K54 C;  3S22 A;  3V39 A;  1JWZ A;  3TW8 A;  4JF6 A;  3BM6 A;  3MQ0 A;  5HD5 A;  2ZQD A;  4XUX A;  5HW3 A;  3G35 A;  2DMW A;  5GHZ A;  5HL6 A;  1NY0 A;  1DP8 A;  2XDM A;  3H82 A;  4NK3 A;  3ZG0 A;  4E6W A;  3SW1 A;  3R7W A;  3W2Z A;  3LI8 A;  2ACG A;  1G68 A;  3MMH A;  3UDX A;  1IKI A;  1LHY A;  4R23 A;  2W0N A;  3MXS A;  4JGR A;  4OLG A;  4CLC B;  4KUK A;  4EET B;  5TGF A;  4EWF A;  4G3W A;  3V67 A;  4IHQ A;  5GLA A;  4S2N A;  1LI0 A;  1I2W A;  1BLP A;  1KDW A;  3UB8 A;  4GD6 A;  1ACF A;  3LR5 A;  3ZQ5 A;  5HAI A;  1TEM A;  3S7O A;  4IBX A;  4KG5 A;  2XA7 S;  1XFN A;  3ZHH A;  3I7J A;  1ESI A;  4FH2 A;  2ZMF A;  1JVJ A;  1Y54 A;  5DKL A;  3N6I A;  3NEC A;  4GW9 A;  3E2L A;  3CZD A;  3IQA A;  1K54 A;  1JTG A;  4L9E A;  5HPF A;  4II7 A;  2KX6 A;  3GDI A;  3RXX A;  3U2A A;  2W1T A;  4P6B A;  1SKO A;  4EXO A;  4KQD A;  3UDF A;  3BW6 A;  5HSQ A;  4CJN A;  3O5Y A;  1O07 A;  3CPT A;  1CJF A;  3CLO A;  3P09 A;  4KZA A;  3WWX A;  3A3F A;  4IVI A;  3O88 A;  1PRQ A;  4G3K A;  5HD3 A;  1F98 A;  4JF5 A;  1PW8 A;  3LYX A;  4WL9 A;  2EA9 A;  4M4X A;  3P01 A;  1OTB A;  3IBJ A;  1GA0 A;  4P6Z M;  4Z9Q A;  3PXP A;  4DF6 A;  3M2J A;  1OT9 A;  4UQI S;  1G6O A;  3OLO A;  4EBL A;  3PTE A;  3VP2 A;  5FI2 A;  4R1G A;  3IX4 A;  4HH2 A;  1X0O A;  4KZB A;  2Y2K A;  3LR0 A;  5DTT A;  2JBF A;  4LV0 A;  3F1N B;  4CLC E;  3ULF A;  3ZG8 B;  3IX3 A;  2OLV A;  4KZ7 A;  1SKF A;  3MKF A;  4KZ5 A;  2WK0 A;  3A3J A;  5CEC A;  4NXG A;  1MWU A;  3KSG A;  3UB6 A;  2WYX A;  2XSS A;  3VP4 A;  3DAV A;  4WN5 A;  3GRJ A;  4KZ8 A;  2OOL A;  5EPH A;  3S1Y A;  2XFS A;  1F9I A;  4OLD A;  3A3D A;  4H8R A;  4QWO A;  2J8Y A;  3OPH A;  5DVA A;  2X02 A;  3LEZ A;  5CEB A;  4ZJ3 A;  2FZ0 A;  4HJ6 A;  4GLQ A;  2ZL1 B;  4UAA A;  1JNU A;  3HUO A;  4S2M A;  1L0E A;  2PBY A;  5DFY A;  2XR0 A;  2JKT M;  2W3H A;  3VV4 A;  5CGX A;  1KE4 A;  2LB5 A;  4JBF A;  5GLD A;  1WYB A;  4LCL A;  4Y0O A;  2EX6 A;  3H7W B;  3T4J A;  1DJC A;  3UB7 A;  3BQA A;  1OJ5 A;  2ZMA A;  5M1A A;  3HLG A;  1T18 A;  5DFX A;  1ONG A;  4BQM A;  2WAD A;  1E3U A;  3ZCZ A;  3C7U A;  1T1A A;  2UWX A;  2PRF A;  3C5A A;  3HVF A;  4ZRR A;  3LFV A;  2ZD8 A;  3MKE A;  5FDH A;  2JKR I;  4E3K A;  1NRF A;  3CHW P;  2XD5 A;  4EW7 A;  1H8Y A;  2XLN A;  2Y2P A;  3LID A;  3DBA A;  1KOU A;  1OT6 A;  4HP9 A;  4LPZ A;  4X68 A;  1DY6 A;  2JCH A;  3O3V A;  4RQ9 A;  1UWN X;  4E04 A;  4OP5 A;  4HY8 A;  1PI5 A;  1LI9 A;  3ZVW A;  3O86 A;  1BLH A;  3NIA A;  4Y0T A;  1ERM A;  2Y2Q A;  3UB9 A;  4OPR A;  4X6T A;  1LT0 A;  4FUW A;  2B02 A;  3BEC A;  4HBT A;  5AQ9 A;  5HPI A;  4LV1 A;  3OPP A;  1N4O A;  3SZT A;  3HRE A;  4D60 A;  1FCM A;  3O87 A;  1K0K A;  4ID4 A;  4ZBE A;  3F1N A;  5CHU A;  4O01 A;  2XD1 A;  3VSK A;  4WEK A;  1KE0 A;  1CI9 A;  5EVE A;  2VV6 A;  4MN6 A;  3BY8 A;  3S7P A;  3BFC A;  4BBV A;  4JGQ A;  2ZOH A;  4O7D A;  4ZJ1 A;  1S1Y A;  1RCJ A;  4M3K A;  2XFT A;  3B42 A;  3BFG A;  1AWI A;  3Q81 A;  1K25 A;  1E3U D;  4HQA A;  1YLW A;  4UA6 A;  1YSP A;  5U47 A;  2WKH A;  3G4P A;  4QU3 A;  4EUZ A;  2ZL1 A;  3T1S A;  3LIA A;  4GOG A;  2Q0O A;  1ZC2 A;  4GJ4 A;  1L0F A;  4R70 A;  1K6R A;  4DN0 A;  2ZM8 A;  4ETZ A;  3KO6 A;  5BOH A;  5EVI B;  1K57 C;  2GDN A;  4JF4 A;  4S2K A;  3H7W A;  5FEG A;  2J9P A;  4GKU A;  5C5K A;  1YLJ A;  3VFF A;  1H8Z A;  1N9L A;  1XXM A;  2J3T C;  4IED A;  1XJ6 A;  4GN2 A;  3HUN A;  4MBH A;  2Y59 A;  4ARZ B;  3VP3 A;  1TS8 A;  2WAF A;  2GJ3 A;  3LIF A;  2B95 A;  3T12 B;  3ZVT A;  5HAP A;  4NET A;  1XKZ A;  3VSL A;  1CEG A;  2Y2J A;  3N7W A;  3LEQ A;  5DF7 A;  4HJ4 A;  4X55 A;  1STZ A;  3N4I A;  4DDS A;  3EWK A;  2ZMV A;  4OPY A;  5FI7 A;  2Y2G A;  4DE1 A;  2HZ5 A;  3Q7Z A;  1ZTU A;  1I2S A;  4IVK A;  5FQI A;  3T4S A;  4UEY A;  5G4Y A;  1S6R A;  2V1Z A;  3QNB A;  2VZW A;  1M6K A;  2EWW A;  4KZ4 A;  2PD7 A;  3SS4 A;  3E2K A;  1YLT A;  3F1P A;  1QME A;  4F94 A;  1ESU A;  1G6A A;  3SS3 A;  1ERQ A;  2HJE A;  4GDN A;  5EVI C;  1ONH A;  3FC7 A;  1S1Z A;  4U0X A;  2B5R A;  3GV9 A;  2K7S A;  3HJK A;  4U0T A;  3SH8 A;  4KZ9 A;  1PWC A;  5M18 A;  3HUM A;  1NYY A;  4D2O A;  3FYZ A;  1QMF A;  4KG2 A;  4OON A;  1PZO A;  3AGF A;  2V1B A;  3HLC A;  1BUE A;  2OV5 A;  4JKT A;  3MZD A;  4BL2 A;  3OCL A;  4BMW A;  3VE4 A;  5EEC A;  1OJG A;  3SH7 A;  2OAQ 1;  4N92 A;  4PKY A;  1ZG6 A;  3Q7V B;  5HDD A;  3C4P A;  3OC2 A;  2VGL S;  3CMZ A;  5GHY A;  4KG6 A;  3N8S A;  3E98 A;  3MJQ A;  4OQ0 A;  2PU4 A;  4UA9 A;  2L4R A;  3C4O A;  3TJZ C;  1EW0 A;  1N9O A;  2XQZ A;  3IX8 A;  3DTM A;  3CUE C;  5CRF A;  2Y2I A;  5M19 A;  3LI9 A;  4PKY G;  4L9G A;  2EX2 A;  5EVI A;  4GCZ A;  3UME A;  2EWV A;  4Y7P A;  2WGI A;  4LEN A;  3LY4 A;  3NCK A;  1F5M A;  2EXB A;  2VJW A;  3FZC A;  4DDY A;  3IXH A;  3WS2 A;  3OCN A;  2FFF B;  4ARZ A;  3IWO A;  3HBR A;  4Z1W A;  1XA7 A;  2PT7 A;  3VOY A;  2J3T D;  5GL9 A;  4ZTK A;  3MBZ A;  5E2G A;  4Y2F A;  4WM9 A;  4S2N C;  2GNX A;  3BRM A;  4R0Q A;  3EGD C;  2WGV A;  4I38 A;  1MPL A;  2ZC7 A;  2W3D A;  2PBD P;  1P0Z A;  3BYD A;  1GSW A;  1XGJ A;  5G4Z A;  5HFO A;  2O0Y A;  2H0T A;  4MDZ A;  2A24 B;  1NJ4 A;  4B4Z A;  3MFD A;  1DRM A;  1D7E A;  2VLG A;  3CUE A;  4R6L A;  3QP2 A;  1SDE A;  2XH9 A;  4MMN A;  4HNB A;  3IH9 A;  2QWS A;  2UV0 E;  1W63 M;  2PDR A;  5I5L A;  3HLW A;  2Y91 A;  3DTI A;  3G31 A;  5KSH A;  3KYZ A;  4CPK A;  3P98 A;  5EVI D;  1JTD A;  3RFB A;  5F82 A;  5F83 A;  2W3E A;  4HIA A;  3IXB A;  3HJI A;  1M40 A;  3IBR A;  2H10 A;  1YLY A;  3G32 A;  1IFQ A;  1N9N A;  2RCX A;  2L1M A;  1LSW A;  5L8M A;  3W8K A;  1TVF A;  1TDL A;  4NXF A;  3ZG9 B;  1S0W A;  3B47 A;  4LRZ E;  1WA9 A;  1FCO A;  5HWV A;  4BL3 A;  4B88 A;  2KDK A;  1YPR A;  1DP9 A;  2O9B A;  3MSH A;  1YLZ A;  2PAV P;  2ZM0 A;  4OVD A;  3ZG7 B;  4HP4 A;  1HD8 A;  5TBM B;  2Z6D A;  1K56 A;  3S4X A;  2W1R A;  1W7F A;  2VV7 A;  4Y17 A;  5AVE A;  3V3S A;  2ZQ7 A;  1P9R A;  1RP5 A;  3MF0 A;  1D1J A;  3VP0 A;  5FAP A;  4MBF A;  4NXE A;  3E4P A;  3MXQ A;  1UGU A;  4CLC C;  3BFF A;  3QNC A;  2OSU A;  3UDI A;  3WRZ A;  4DKI A;  1YM1 A;  1VEU B;  2BTF P;  3ZNT A;  3PBT A;  3EQU A;  3Q07 A;  5FQQ A;  2HP9 A;  2XRN A;  3G30 A;  4MN7 A;  5DKK A;  1K4E A;  3RJU A;  3MQQ A;  3C2W A;  4U3T A;  5CGW A;  3E0Y A;  5EFW A;  4EQI A;  2A24 A;  4I3A A;  4KZ6 A;  3MFX A;  2Y79 A;  1G28 A;  3PBN A;  4N9L A;  3RXW A;  2VEA A;  4AFI A;  4R4S A;  5AVF A;  3T1Q B;  1NWZ A;  3SH9 A;  1GHI A;  5GHX A;  1K4F A;  1G5U A;  4BD1 A;  3S7Q A;  3IH8 A;  4PAU A;  5CX7 A;  4EV4 A;  2Y2N A;  5EUA A;  4Q0I A;  1EI5 A;  1K56 D;  4BBT A;  4OKP A;  1UWP X;  3GMW A;  1HVB A;  4QY6 A;  2V1A A;  5FL3 A;  1SCW A;  3OBF A;  4UA7 A;  4CLC A;  1MWR A;  5KIZ A;  5FI6 A;  4EER A;  5CHM A;  4JPM A;  1LSX A;  4GB7 A;  1ALQ A;  4BWI A;  2PYR A;  2BLS A;  4Q0H A;  1CF0 A;  4GS9 B;  1BZA A;  4X56 A;  3IF5 A;  4LLO B;  2XGN A;  2ZC3 B;  4JXS A;  4MNR A;  1MKI A;  2I9V A;  1RGZ A;  3G2Z A;  2Y2L A;  5LBR A;  1S4R A;  3GTC A;  2Y4A A;  3BFD A;  2WKE A;  5A93 A;  1MZU A;  2IWB A;  1MY8 A;  2WKR A;  1T19 A;  1JWV A;  4RYE A;  1C3B A;  3ZDJ A;  4ZDX A;  2VKS A;  1ERO A;  5TBM A;  4E3M A;  1HZO A;  2HGV A;  2ZBB A;  2OWH A;  4PPR A;  3ZG5 A;  3RTY A;  1VM1 A;  3EEA A;  1XP4 A;  3E4Q A;  4LCM A;  1FIL A;  3NC8 A;  3T4Q A;  3B33 A;  4ME4 A;  2WZX A;  4OOM A;  1XGI A;  1XA1 A;  4WLA A;  3NJA A;  3ITA A;  3T4K A;  1Y4O A;  1YSQ A;  3WRT A;  1N9B A;  3C38 A;  5HWT A;  3JPU A;  1IYP A;  3C30 A;  1VEU A;  4I39 A;  4ETX A;  2JHE A;  4CLC D;  5F1G A;  5CED A;  5CXW A;  4DXC A;  1OTI A;  3F1O B;  5FQK A;  3UPP A;  1PNE A;  3S7N A;  2OLU A;  2FFY A;  1GHP A;  2HDR A;  4WEJ A;  1O7E A;  4QB8 A;  4LGW A;  1SDN A;  2IWC A;  3NOT C;  3ZGA B;  2YKH A;  3FKV A;  1SZV A;  2Y8H A;  3W4P A;  2NUP C;  3MR0 A;  3KSH A;  3KYE A;  1MXO A;  4KEN B;  1LLB A;  2O9A A;  3A3I A;  1DJA A;  4LV3 A;  3IS2 B;  1DJB A;  2HDQ A;  3QP4 A;  4K0W A;  2ZLY A;  2P04 A;  2R9W A;  3R4K A;  3OPL A;  4E3J A;  2PYP A;  2WUQ A;  4Y0U A;  1KE3 A;  3WS4 A;  1FQG A;  4OH0 A;  3KYQ A;  4P6Z S;  2FH5 A;  3FG8 A;  2W27 A;  3NDG A;  5HWW A;  5GLC A;  5DF9 A;  4I3J A;  3UE1 A;  1ES2 A;  2PU2 A;  2Y2O A;  3VFH A;  2VA0 A;  4LRY C;  2Z2M B;  2W3G A;  2QYB A;  1LL9 A;  1VHM A;  2MJ6 A;  3FKW A;  4YWZ A;  3UE3 A;  3ITB A;  4EEU A;  5DTK A;  4LRX C;  5EM1 A;  1FR6 A;  3MXR A;  1GA9 A;  2YKF A;  1L2S A;  3T1R A;  1NZO A;  5F1F A;  1Q2P A;  1TF1 A;  1HTZ A;  4OOL A;  5EM0 A;  2EFX A;  3PBS A;  4DE3 A;  4RA7 A;  1H3Q A;  3G2Y A;  3HLF A;  2PD8 A;  1YAX A;  3PR6 A;  5A8B A;  4B9O A;  1U60 A;  1FOF A;  2W3F A;  3HLB A;  4DRT A;  4WYY A;  1TS7 A;  1KVL A;  3F1O A;  3EOI A;  1OTE A;  1ES3 A;  2JKT I;  2X01 A;  1YT4 A;  4HI4 A;  4HOI A;  4G3V A;  5FQ9 A;  1KVM A;  3JYI A;  2J80 A;  2Q9M A;  2BG1 A;  3V3R A;  4Q0J A;  4PM6 A;  3IXG A;  2HV1 A;  3VP1 A;  2ZC5 B;  2J7V A;  4GNU A;  4QPR A;  4ZJ2 A;  2WGW B;  3UN7 A;  3NBL A;  3V50 A;  1W5D A;  4Y13 A;  3LCE A;  4EBP A;  4NEE D;  3JVU A;  1OME A;  3PAG A;  4S2L A;  1IYS A;  1ZG4 A;  3G34 A;  3UPN A;  3DWZ A;  1HLU P;  2H5S A;  2WKQ A;  5FA7 A;  2I72 A;  3GVB A;  5L2F A;  2VGK A;  1Q2Q A;  2PR5 A;  2WKP A;  2WAE A;  4DJ2 A;  1S4S A;  3LGO A;  2Q9N A;  2EX9 A;  3MS6 A;  2G7U A;  4MEZ A;  4P87 A;  2Z2L B;  3D72 A;  3IT9 A;  1FSW A;  3PBQ A;  4EES A;  1KDS A;  2A49 A;  3BJN A;  3A0S A;  4KQR A;  3IWI A;  4JXV A;  4L0L A;  3HCY A;  3FWL A;  3IHB A;  4ZAM A;  4L9F A;  4IUK A;  1CEF A;  3BLM A;  4EUV A;  1EWZ A;  2R9X A;  5A92 A;  1NRJ A;  4S2P A;  1K55 A;  2O9C A;  3CG5 A;  4WUJ A;  1SKO B;  4FD8 A;  1KGE A;  3NHQ A;  1W8Y A;  1NXY A;  3GR2 A;  5MC7 A;  4WZ5 C;  4RX3 A;  4C6Y A;  5TJJ A;  1ES5 A;  1GSV A;  3EQV A;  1MKM A;  3LIC A;  2JC7 A;  3T4O A;  5FAQ A;  4NXB A;  4HEF A;  2HPB A;  1T1B A;  2XRO A;  3LR4 A;  4JGO A;  2QJ5 A;  1S66 L;  3T4L A;  5KZH A;  3LY3 A;  4B4X A;  1FSY A;  2ZOI A;  1A0K A;  3HLE A;  3M6H A;  4Y15 A;  4C75 A;  4HH3 A;  5DTS A;  3E4O A;  5GLB A;  3IHA A;  2OWJ A;  5D3O A;  5AQA A;  4E6X A;  2JKR M;  5FSR A;  1W8Q A;  4NG2 A;  4E3I A;  1MC0 A;  3MZE A;  2ZJ9 A;  5FAS A;  2X71 A;  3DTE A;  4JXW A;  3C8C A;  4P85 A;  3T1X A;  3OPR A;  3L9K A;  2IA2 A;  3CWF A;  1WE4 A;  3IF6 B;  3HL9 A;  5AQB A;  2JN7 A;  4X1M A;  4PHT A;  4EEP A;  4JXG A;  1ODV A;  3FPV A;  3L7H A;  3EGX C;  4WZ5 A;  2WGW A;  4R3A A;  3D4F A;  3W4O A;  2WKI A;  2WZZ A;  2AVX A;  3IXD A;  3Q7V A;  4BJP A;  2HP5 A;  2V2F F;  3QHY A;  2P9V B;  1OTD A;  3UPO A;  3NDE A;  2BAS A;  2EXA A;  3NOU C;  2GX5 A;  3NOP C;  4YOF A;  2C6W B;  1GCE A;  2PR6 A;  3ISG A;  5HDC A;  1ZHH B;  4IJG A;  1NYM A;  1ES4 A;  4KUO A;  2HJ9 C;  5KSC A;  5HZH A;  1PYY A;  3ZFZ A;  1TDG A;  4PMA A;  4HES A;  2OAP 1;  1BUL A;  4F3L B;  5A91 A;  1PW1 A;  5I94 A;  2B18 A;  1T1C A;  4FOF A;  4X1L A;  2J3W A;  4NKP A;  2QZ6 A;  4YFM A;  3DWK A;  4PM8 A;  3IF6 C;  5DJT A;  1SHV A;  3JVV A;  2ZQA A;  3TE8 A;  4A5R A;  3QP1 A;  3K3D A;  3EEH A;  3IWQ A;  2KOI A;  4KZ3 A;  4E3N A;  4MN5 A;  3M2K A;  3PAE A;  4FH4 A;  4QJG A;  4YNR A;  5FEF A;  1YMS A;  4H6J B;  3ZNY A;  3UE0 A;  5CHJ A;  4E3O A;  3KSI A;  1V9Y A;  1MBL A;  2HDS A;  2D01 A;  4WF0 A;  2E8J A;  2Y2M A;  1PWG A;  1XJ4 A;  5F68 A;  3SS5 A;  2J9O A;  1L3L A;  5J4E A;  3FV7 A;  4C3Q A;  2Y55 A;  5TR7 A;  5L07 A;  2O99 A;  2IWD A;  5E2H A;  1XPB A;  4S2I A;  4DJ3 A;  5AQ7 A;  2CC1 A;  1VB6 A;  5EV0 A;  5TFQ A;  3OZH A;  3T50 A;  5J7E A;  4OOY A;  2M1C A;  1J3W A;  1KGG A;  2XEP A;  4DXB A;  3IF6 A;  2VV8 A;  3A3E A;  4BBU A;  3BWL A;  1TS6 A;  2ZM2 A;  2L0W A;  1LSV A;  2NUT C;  1GSX A;  1XX2 A;  4N1H A;  2XF3 A;  1IEM A;  4I3I A;  2LB9 A;  2HDU A;  1E4D A;  3BFE A;  1LL8 A;  2K31 A;  3TRC A;  2P74 A;  3NUL A;  2V0W A;  3NY4 A;  2V0U A;  3GQZ A;  3GSG A;  2P9V A;  4X69 A;  4Y5F A;  5EVL A;  5IU1 A;  2G2W A;  1PIO A;  5IHV A;  3H9W A;  2D02 A;  4WEL A;  3D3O A;  3G6O A;  3C7V A;  4OPQ A;  5JYP A;  3V5M A;  4OPZ A;  4ESP A;  1MWT A;  3UB5 P;  5DF8 A;  2P08 A;  4QD4 A;  1NLZ A;  1AXB A;  5EOE A;  1YMX A;  5L09 A;  1E25 A;  2DNS A;  4F3L A;  4WMC A;  4Q8I A;  3BEB A;  4WBG A;  1P9W A;  4QHC A;  2DCF A;  4O0P A;  1OTA A;  3MZF A;  5KMW A;  2G2U A;  1XFQ A;  1K38 A;  3A0V A;  3MQO A;  1CQA A;  1DP6 A;  3NI9 A;  1NLY A;  5FAO A;  1TS0 A;  2VGL M;  4H6J A;  5E2F A;  2E8I A;  3AGE A;  2V8C A;  4DE0 A;  5F6A A;  4HHD A;  4IBR A;  2QMI A;  4EQ1 A;  5CGS A;  5CTM A;  5IS1 A;  2VK3 A;  3DTK A;  1IOU A;  3F1P B;  5G18 A;  3M6B A;  3CAX A;  3CIT A;  4FCF A;  1PI4 A;  4JGP A;  5E43 A;  3T4T A;  2V8F A;  4LFU A;  3LIB A;  4MBK A;  3PBO A;  1CI8 A;  5HAQ A;  1ZKJ A;  4OQI A;  4RX2 A;  5L10 A;  4OP8 A;  1IEL A;  2PHY A;  3VMA A;  4BEN A;  1VQQ A;  4EBN A;  4GZB A;  4PM7 A;  4WMC D;  1WYC A;  2DRW A;  3WS5 A;  3BLS A;  4GS9 A;  2A2L A;  3BY9 A;  4JLF A;  3CI6 A;  2INW A;  4WZ4 A;  4BD0 A;  1YQS A;  4R3B A;  3U4L P;  2XK1 A;  3VOL A;  1BLS A;  3Q1F A; 
#chains in the Genus database with same CATH homology
 2KDK A;  3ZYT A;  1DP9 A;  2O9B A;  3LIE A;  2R78 A;  3D72 A;  3H7W B;  4HP4 A;  3T4J A;  3PBQ A;  4EES A;  3UB7 A;  4HJ3 A;  3BJN A;  3BQA A;  3A0S A;  5TBM B;  2Z6D A;  1OJ5 A;  4L0L A;  3HCY A;  4K08 A;  1T18 A;  2W1R A;  5DFX A;  1BYW A;  2VV7 A;  4L9F A;  3KSF A;  4Y3I A;  4GHI B;  4IUK A;  5F69 A;  4EUV A;  2M7U A;  1D06 A;  4CQH A;  5AVE A;  1NRJ A;  3PBR A;  1T1A A;  4MCW A;  2O9C A;  3A0R A;  1Y28 A;  4WUJ A;  4ZRR A;  1YKD A;  3LFV A;  1P9R A;  2H28 A;  3MF0 A;  2QJ7 A;  3NHQ A;  3P7N A;  2QKP A;  2JKR I;  3VE3 A;  5MC7 A;  4EW7 A;  5HDS A;  4NXE A;  3E4P A;  5TJJ A;  1GSV A;  3MXQ A;  3EQV A;  1UGU A;  4XT2 B;  3LID A;  4CLC C;  3DBA A;  1MKM A;  1XJ2 A;  3LIC A;  1KOU A;  3T4O A;  4NXB A;  1OT6 A;  1T1B A;  2XRO A;  4HP9 A;  4LPZ A;  3LR4 A;  3PBT A;  4JGO A;  3EQU A;  2QJ5 A;  1S66 L;  3T4L A;  2XA7 M;  2CMN A;  4RQ9 A;  1UWN X;  4E04 A;  4HY8 A;  5IT5 A;  2XRN A;  4MN7 A;  5DKK A;  2ZOI A;  4DMZ A;  1S67 L;  1OPX A;  3MQQ A;  3C2W A;  4HH3 A;  3E0Y A;  3E4O A;  5EFW A;  2A24 A;  3UB9 A;  2OWJ A;  4I3A A;  1LT0 A;  2B02 A;  2Y79 A;  1G28 A;  3MFX A;  3PBN A;  2VEA A;  2M7V A;  4AFI A;  5HPI A;  2JKR M;  5AVF A;  3PYP A;  1MC0 A;  1NWZ A;  4O8G A;  5J3W A;  3H82 B;  3C8C A;  3F1N A;  2HF6 A;  2IA2 A;  4O01 A;  3R7W B;  3CWF A;  4WEK A;  3S7Q A;  4PAU A;  2VV6 A;  5CX7 A;  4MN6 A;  4Q0I A;  3BY8 A;  2JN7 A;  3S7P A;  4BBV A;  4PHT A;  4JGQ A;  2ZOH A;  4BBT A;  4EEP A;  3IS2 A;  1ODV A;  1V9Z A;  1UWP X;  3FPV A;  3EGX C;  1S1Y A;  3B42 A;  3K3C A;  2V1A A;  5FL3 A;  4R3A A;  3OBF A;  4CLC A;  2V9A A;  5KIZ A;  4HQA A;  2K2N A;  1TD5 A;  4EER A;  4FSF A;  1YSP A;  2VX8 A;  1LSX A;  4IUH A;  4BWI A;  4BJP A;  3BQ8 A;  2PYR A;  4Q0H A;  3LIA A;  4GS9 B;  2KLI A;  4UQI M;  4LLO B;  3FPW A;  1OTD A;  4GJ4 A;  2BAS A;  3OOV A;  3NOU C;  4R70 A;  4DN0 A;  2I9V A;  2GX5 A;  3NOP C;  4YOF A;  5LBR A;  4ETZ A;  1S4R A;  3KO6 A;  2PR6 A;  5HDC A;  1MZU A;  1ZHH B;  4IJG A;  2GZA A;  3H7W A;  3RH8 B;  2WKR A;  5C5K A;  1T19 A;  4KUO A;  2HJ9 C;  3LR3 A;  2VKS A;  5HZH A;  3UMD A;  5TBM A;  2W1T B;  1N9L A;  2J3T C;  2HGV A;  2ZBB A;  1XJ6 A;  2OAP 1;  1H8M A;  5K5B A;  2OWH A;  4GHI A;  4F3L B;  3GEC A;  3RTY A;  4ARZ B;  3EEA A;  1TS8 A;  2B18 A;  1T1C A;  3E4Q A;  4FOF A;  2GJ3 A;  2J3W A;  1W63 Q;  4NKP A;  5F5Y A;  3LIF A;  3T4Q A;  3B33 A;  4ME4 A;  4I5S A;  4OOM A;  5DJU A;  1XJ3 A;  5DJT A;  3JVV A;  3K2N A;  3TE8 A;  3K3D A;  4WLA A;  3PHY A;  3EEH A;  3NJA A;  4HJ4 A;  2KOI A;  1STZ A;  4MN5 A;  3T4K A;  3KX0 X;  3EWK A;  2ZMV A;  1YSQ A;  3ICY A;  4XT2 A;  2QHK A;  4YNR A;  4H6J B;  3C38 A;  3KSI A;  1V9Y A;  5HWT A;  3LUQ A;  4KQO A;  3C30 A;  1ZTU A;  2D01 A;  4WF0 A;  4I39 A;  3T4S A;  4UEY A;  5G4Y A;  4ETX A;  2JHE A;  4CLC D;  1XJ4 A;  2VZW A;  5F68 A;  1P97 A;  1OTI A;  2EWW A;  3F1O B;  5J4E A;  2PD7 A;  2P7J A;  4B93 A;  2Z6C A;  3S7N A;  4R38 A;  3F1P A;  2O99 A;  5AJG A;  4EU0 A;  2HJE A;  3UE6 A;  4WEJ A;  4DJ3 A;  3FC7 A;  1S1Z A;  1VB6 A;  3NOT C;  3HJK A;  2K7S A;  2YKH A;  3TW8 A;  3MQ0 A;  5HD5 A;  3T50 A;  5J7E A;  2DMW A;  5HL6 A;  2M1C A;  2Y8H A;  1DP8 A;  3H82 A;  2NUP C;  3MR0 A;  3SW1 A;  3R7W A;  3W2Z A;  3KSH A;  2VV8 A;  3LI8 A;  2O9A A;  4BBU A;  3MMH A;  2V1B A;  3BWL A;  3IS2 B;  1TS6 A;  2P04 A;  2W0N A;  4JGR A;  2L0W A;  4EET B;  3OCL A;  1LSV A;  3R4K A;  4KUK A;  3VE4 A;  2NUT C;  4BMW A;  1GSX A;  4CLC B;  4G3W A;  3V67 A;  4I3I A;  4IHQ A;  1OJG A;  2OAQ 1;  2LB9 A;  2PYP A;  4PKY A;  1LL8 A;  2K31 A;  5HDD A;  3TRC A;  3UB8 A;  3OC2 A;  2VGL S;  2V0W A;  3LR5 A;  3ZQ5 A;  3E98 A;  3MJQ A;  3KYQ A;  2V0U A;  3S7O A;  2XA7 S;  1XFN A;  4P6Z S;  2L4R A;  4Y5F A;  2FH5 A;  3TJZ C;  1EW0 A;  1N9O A;  3FG8 A;  5IU1 A;  2W27 A;  2ZMF A;  5HWW A;  3H9W A;  3CUE C;  2D02 A;  4WEL A;  3LI9 A;  4PKY G;  4L9G A;  5DKL A;  3D3O A;  3G6O A;  5DF9 A;  4I3J A;  4GW9 A;  4GCZ A;  3UME A;  2EWV A;  4L9E A;  5HPF A;  2VA0 A;  4II7 A;  4LRY C;  2KX6 A;  2P08 A;  3GDI A;  2W3G A;  1NLZ A;  1F5M A;  2QYB A;  3U2A A;  2VJW A;  2W1T A;  1VHM A;  2MJ6 A;  4YWZ A;  4EXO A;  4KQD A;  4F3L A;  3UE3 A;  3OCN A;  3BW6 A;  4ARZ A;  4Z1W A;  4EEU A;  5HSQ A;  2PT7 A;  4LRX C;  3O5Y A;  1P9W A;  2J3T D;  2YKF A;  4O0P A;  1OTA A;  3CLO A;  1TF1 A;  4Y2F A;  4OOL A;  3PBS A;  2GNX A;  4G3K A;  5HD3 A;  1F98 A;  3EGD C;  1XFQ A;  1H3Q A;  3A0V A;  3MQO A;  4I38 A;  2PD8 A;  1DP6 A;  3LYX A;  1NLY A;  1YAX A;  4WL9 A;  2EA9 A;  2W3D A;  1TS0 A;  2VGL M;  4H6J A;  1P0Z A;  4M4X A;  1GSW A;  3P01 A;  1OTB A;  3IBJ A;  5G4Z A;  3PR6 A;  5A8B A;  5F6A A;  4B9O A;  4HHD A;  4P6Z M;  2O0Y A;  4MDZ A;  2W3F A;  2A24 B;  3PXP A;  4UQI S;  1OT9 A;  4EQ1 A;  1G6O A;  3OLO A;  5IS1 A;  1DRM A;  1D7E A;  2VLG A;  1TS7 A;  3CUE A;  4R6L A;  1IOU A;  4MMN A;  3F1O A;  3F1P B;  4HNB A;  4HH2 A;  2QWS A;  1W63 M;  3EOI A;  2PDR A;  1X0O A;  5I5L A;  1OTE A;  3CAX A;  2JKT I;  3LR0 A;  3CIT A;  3F1N B;  4HI4 A;  4JGP A;  3T4T A;  4HOI A;  3ULF A;  4CLC E;  4G3V A;  3LIB A;  2J80 A;  3PBO A;  5KSH A;  3KYZ A;  4Q0J A;  4NXG A;  2HV1 A;  3RFB A;  3KSG A;  3UB6 A;  4QPR A;  2W3E A;  4HIA A;  2XSS A;  4WN5 A;  3HJI A;  2OOL A;  2PHY A;  3IBR A;  1F9I A;  4NEE D;  1IFQ A;  1N9N A;  3JVU A;  2L1M A;  1LSW A;  5L8M A;  2FZ0 A;  4HJ6 A;  4GLQ A;  1JNU A;  4NXF A;  2WKQ A;  4GS9 A;  2A2L A;  5DFY A;  3B47 A;  3BY9 A;  4LRZ E;  1WA9 A;  2JKT M;  2W3H A;  3VV4 A;  3CI6 A;  2INW A;  5HWV A;  3VOL A;  2PR5 A;  2LB5 A;  2WKP A;  4DJ2 A;  1S4S A;  2G7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...