2I9VA

Structural role of y98 in pyp: effects on fluorescence, gateway and photocycle recovery
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDQQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural role of tyrosine 98 in photoactive yellow protein: effects on fluorescence, gateway, and photocycle recovery.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2i9vA00
3PHYA 3H82B 1V9YA 1EW0A 1P97A 3LIBA 2H28A 4R3AA 3B33A 3UB7A 3PYPA 5HDDA 2I9VA 1ODVA 2V1AA 3C8CA 2V0UA 3SW1A 1X0OA 3BY8A 1XJ4A 3KX0X 2QJ7A 3UMDA 1LSXA 2D01A 4LLOB 4WL9A 4DJ2A 1OJ5A 4EETB 5TBMA 1KOUA 3RTYA 1N9LA 4BBUA 3NJAA 1GSXA 2L1MA 3F1PA 1OTBA 3H7WB 4HP9A 3MQOA 2L4RA 5J4EA 1D06A 2PHYA 5IS1A 4NXFA 4KUOA 3F1PB 4E04A 1S67L 1WA9A 2BASA 2JN7A 3K3CA 4GS9B 2W0NA 1Y28A 2OWHA 3HJIA 3A0RA 3MJQA 2VV7A 4JGRA 2VV6A 3CLOA 3H7WA 4LRYC 4WUJA 4XT2A 5G4ZA 1S66L 2J80A 2CMNA 2WKPA 4HJ4A 3MQQA 3UE6A 2ZBBA 3LIFA 4M4XA 3OLOA 4EXOA 1N9OA 2EA9A 2OWJA 1F98A 3NOTC 3VE3A 1D7EA 1NWZA 2Z6CA 2PD8A 2ZOIA 3UMEA 1S1ZA 3K3DA 5TBMB 1LSVA 5HDSA 2PYPA 3LYXA 1BYWA 1JNUA 1LL8A 2KX6A 2QHKA 2VEAA 3LIEA 4LRZE 4HNBA 4GW9A 4YWZA 4R6LA 4GS9A 3LIAA 2VLGA 1N9NA 3NHQA 1T1CA 2WKRA 4GCZA 4MN5A 5F6AA 5I5LA 4PKYG 5DKKA 2QWSA 4I38A 3CAXA 3E4PA 3LUQA 2ZOHA 1OT9A 2W27A 2WKQA 3E4OA 4JGOA 4RQ9A 5F5YA 5G4YA 4EQ1A 2Z6DA 1S4SA 2K7SA 1S4RA 4HH2A 1OTEA 5DKLA 4HI4A 4H6JA 5HWTA 3ULFA 1T1BA 1P0ZA 2YKFA 3HJKA 4HIAA 4XT2B 3VOLA 4K08A 1DP9A 1G28A 4H6JB 4L9FA 5EFWA 5DJTA 4I3JA 4PKYA 5HSQA 5KIZA 5A8BA 3MXQA 1V9ZA 2A24B 5AVEA 3UB9A 3BY9A 3LI8A 1GSVA 2YKHA 5HDCA 2M1CA 3GECA 4NXBA 3CWFA 1XJ3A 4HOIA 4JGPA 4F3LB 4L9GA 4KUKA 4NXGA 1TS6A 4I3IA 4LRXC 1XJ2A 4MN6A 4NXEA 4LPZA 3LI9A 1T18A 1LSWA 1OT6A 3IBRA 5HWVA 1XFQA 2INWA 2PYRA 2V9AA 3H9WA 3G6OA 4GHIA 1OTDA 3FG8A 2D02A 2OOLA 4HJ6A 1S1YA 4WN5A 3LICA 4HH3A 4GHIB 4BBTA 1VB6A 1OTAA 2P7JA 4EW7A 1MZUA 1OTIA 3IS2A 3NOUC 3RH8B 3ZQ5A 2PDRA 3EEHA 4HHDA 5HD5A 3F1NA 3T50A 2L0WA 1GSWA 3H82A 3IS2B 2KDKA 3UB6A 1DRMA 3VE4A 3NOPC 5HD3A 3BWLA 1XJ6A 5F69A 4B9OA 4KQDA 1LT0A 4WLAA 3ICYA 5J3WA 4WF0A 1OJGA 5IU1A 2A24A 2PD7A 4DJ3A 4R38A 2PR6A 3A0SA 3D72A 3MFXA 4I3AA 4EESA 4HQAA 4EEUA 1UWPX 4EEPA 4F3LA 4I5SA 5DJUA 1XFNA 5J7EA 1DP6A 2V0WA 5HZHA 1UWNX 5AVFA 3F1OA 3P7NA 4L9EA 4EERA 4I39A 1UGUA 1TS0A 3EWKA 3GDIA 2QJ5A 2R78A 5HWWA 3F1OB 2JHEA 2V1BA 2VV8A 3E4QA 4HY8A 3F1NB 4R70A 3UB8A 3LIDA 2HV1A 3FC7A 4JGQA 2B02A 3A0VA 3C2WA 1TS7A 5F68A 1TS8A 4HJ3A 4BBVA 4HP4A 1T19A 2GJ3A 3MR0A 1F9IA 1DP8A 2QKPA 1T1AA 2PR5A
chains in the Genus database with same CATH superfamily
3PBSA 5HDDA 1NZUA 1OJ5A 1KOUA 1Q2PA 4BBUA 3GQZA 3DWKA 4U0XA 3P01A 3MBZA 5CEBA 2WGWA 3VP1A 1Y28A 1Q2QA 2PT7A 2OAQ1 5GHXA 2ZC5B 1O7EA 3UMEA 5MC7A 3LYXA 1QMEA 1G6AA 4DF6A 2QMIA 5KZHA 1XP4A 4P6BA 2V8FA 4ARZB 3UPNA 2O9BA 2XFSA 2XD5A 1P0ZA 4HIAA 3HJKA 3C4PA 3A3IA 4UQIS 2ZQAA 1GA0A 1IEMA 4JGPA 1OPXA 3LI9A 1T18A 3Q7ZA 3G6OA 1NJ4A 2D02A 1MBLA 3UB5P 3QP1A 3ZNYA 3IT9A 3Q81A 4R3BA 5AQBA 5CGSA 5DTTA 2VKSA 3CG5A 4K0WA 5EVEA 2XDMA 3JYIA 3TSGA 1L0FA 5EVID 3MFXA 4EESA 4R1GA 1YMXA 2ZM2A 3BYDA 3Q07A 4Z1WA 2QJ5A 1YLJA 4UHUA 3CUEC 5KSHA 5HW3A 4EQIA 1XA7A 5CTMA 1T1AA 4OPYA 1GHPA 3G32A 3PXPA 2Y2MA 4GN2A 3ZYTA 2HDQA 3F1PA 1FILA 1OMEA 3Q1FA 5FAPA 4ME4A 5TR7A 2HP6A 5J4EA 1F2KA 3F1PB 4X1LA 5CHMA 4JGRA 5E2GA 4OH0A 4WUJA 4XT2A 5FQQA 2KLIA 1S66L 2O99A 1SDEA 3WS5A 4M4XA 1IYPA 1KVLA 2Z6CA 3A3FA 5TBMB 3WRTA 2X01A 1I2SA 4E6WA 1AWIA 3CAXA 4LCLA 1OT9A 3ZG9B 4HH2A 3IXGA 2Y2NA 3PTEA 2XRNA 1GCEA 1DP9A 3T1SA 4H6JB 3W4OA 1M6KA 2X71A 3LI8A 1GSVA 2PBYA 4ESPA 3BQAA 1PW8A 4IVIA 2JKFA 4KUKA 4NXGA 2XD1A 2J7VA 4G3VA 2XK1A 1K38A 2PU4A 4L0LA 2B5RA 4PM5A 5L2FA 1TDLA 4Y0TA 3RXXA 2Y79A 3E2KA 3N8RA 5TFQA 4DDYA 3T4KA 2L0WA 2C6WB 5FSRA 1EWZA 5L09A 3T1RA 1G5UA 2HJEA 3FKVA 4F3LA 4I5SA 3IHAA 1UWNX 3BFGA 2ZQ9A 3T1QB 4DE1A 3ZG5A 3IHBA 1STZA 3IH9A 3T4QA 3IF6A 1TS7A 1HVBA 3MKFA 5FDHA 4LV3A 2VK3A 1KGGA 4H8RA 2DCFA 5EE8A 4LV2A 1X0OA 5GLCA 5GHZA 1E3UD 3HREA 5FQMA 4HP9A 1ERQA 3O5YA 3VSKA 5G4ZA 4CPKA 3DAVA 3PR6A 3SS3A 1D7EA 3HLGA 4CLCE 4QY6A 3T4TA 3K3DA 1H8YA 2J3WA 4MN5A 3NCKA 4I38A 4EBNA 2WGVA 5EVIA 1NLZA 4N1XA 4Q0JA 4KQQA 2Y8HA 3TW8A 1C3BA 1G6OA 5JYPA 5HWTA 1XGJA 3WS2A 1XKZA 4BENA 5F83A 3HBRA 4P85A 3ZG7B 2EFUA 2GZAA 3HCYA 1Z6FA 1ZG6A 1DJBA 2HDUA 3G2YA 3OPHA 5DFXA 4BBTA 1PW1A 2WUQA 2MJ6A 3ZGAB 1RGZA 3ISGA 3IS2B 3S7OA 3QP6A 2FH5A 3HLDA 5IU1A 4R38A 3ZVWA 4WZ5C 3A3DA 4NEED 3P7NA 1MKMA 3BFFA 3KYEA 2FFYA 5K5BA 4K0XA 1YLWA 5FQ9A 5F68A 5CHJA 2J3TC 3WS4A 4JKTA 3OOVA 4OONA 1VETB 2K2NA 2HGVA 3OZHA 2W3GA 3JPUA 5HX9A 2JKRM 2CMNA 3MQQA 1BLPA 4MCWA 5FATA 3IWQA 1NWZA 3DTMA 3CI6A 5EPHA 4BMWA 2EX9A 1SKFA 4DDSA 4Y0UA 3NHQA 1G68A 4ID4A 2ZJ9A 5F6AA 3T4LA 2HJ9C 2ZOHA 4E3OA 4QHCA 1OTEA 1Z09A 4BWIA 5FQJA 1IYOA 4I3JA 5A8BA 2ZMAA 4OPRA 2YKHA 2M1CA 1XJ3A 4L9GA 3IQAA 1L3LA 1CEFA 3IBRA 1XFQA 1JWPA 3KYZA 3SS4A 3C7VA 3FG8A 2A49A 1KDWA 4FD8A 3RH8B 2NUPC 3V67A 4ZJ3A 5FEFA 1GSWA 4Y0OA 1E3UA 3IWIA 3OC2A 4PM9A 3UDXA 3IXHA 1LT0A 2Y2JA 1ZG4A 1UWPX 3FZCA 5CGWA 5E43A 2V0WA 2BG1A 3C7UA 2JHEA 3UB8A 2ZMVA 4OQIA 1P9RA 4HJ3A 3SZTA 4PHTA 3SW1A 3ZFZA 3UB7A 2Y2PA 1I2WA 1TEMA 3BY8A 3LCEA 1LSXA 3R7WB 1K4EA 5BOHA 4R4SA 1K56D 1D06A 2G2WA 2JN7A 2W0NA 4PMAA 2GX5A 1W8QA 2VGKA 1MWSA 3U4LP 2WZXA 4GLQA 3WWXA 3LY3A 4KZ4A 4JF4A 5U47A 1Y54A 4S2IA 2KX6A 4GOGA 1CI8A 3V39A 1W63M 3AGFA 5I5LA 4PKYG 2EX8A 2QWSA 2NUTC 5F5YA 5I94A 2XA7S 4H6JA 4U3TA 4L9FA 4GDBA 1L0GA 2G2UA 5KIZA 5DTSA 5AVEA 3DTIA 1LHYA 2X02A 4YNRA 4MN6A 4B4ZA 1D1JA 2VA0A 3LR0A 1SKOA 2XF3A 4B4XA 2OOLA 3CUEA 4HH3A 4MN7A 1F5MA 3MZFA 4S2NA 2OSUA 2PDRA 4KQRA 3T50A 1TVFA 5F69A 1PZOA 1LL9A 2EXBA 4I3AA 1MY8A 4B93A 1BULA 2W1RA 1K6RA 5AVFA 2OLUA 3S1YA 1TS0A 4R70A 4CLCC 2Q9MA 3CPTB 2EWVA 4DXCA 3CPTA 3MR0A 1CEGA 2QKPA 1V9YA 3LIBA 4PM6A 3EGDC 1BLHA 1ODVA 2GNXA 4BLMA 3IX8A 4IBXA 2WGWB 2EFXA 3K2NA 4RVAA 5EECA 5F1GA 3R7WA 4CJNA 3H7WA 3KSHA 3QP8A 3UE6A 3OLOA 3R4KA 3VP4A 3NOTC 1NXYA 1S1ZA 5E2HA 4BD1A 1LSVA 1LI0A 2FZ0A 2VEAA 5EVIB 3V3RA 2HP5A 4GCZA 2EWWA 4RQ9A 1PIOA 2K7SA 5HAPA 3VOLA 5M1AA 4JF5A 3MXQA 4UEYA 4FH2A 4DMZA 5HAQA 2QPNA 3A3EA 1BLSA 5GL9A 1OT6A 2HDRA 3TRCA 4KZ7A 2O9CA 1S1YA 5EVLA 4QWOA 3O86A 1M40A 4OPZA 2GDNA 3KO6A 1YT4A 3UDFA 3IF6B 1H0MA 1HLUP 4QJGA 3IF6C 4S2NC 4LGWA 4BL2A 4WYYA 3IX3A 2XR0A 3ZCZA 2J9OA 5KSCA 1BUEA 3QHYA 1GA9A 4BD0A 4AFIA 2XQZA 1YLPA 3HUOA 1IYQA 3E0YA 3MQOA 4O0PA 5EFWA 3CITA 2VV6A 1FR1A 4JF6A 3PBOA 2BTFP 1NLYA 2EA9A 2IWDA 4D2OA 4C75A 4UQIM 5JYOA 5HDSA 3EQUA 4GDNA 3P09A 4PAUA 3W2ZA 3UNWA 5A90A 3LIAA 3KSIA 3MQ0A 1H8ZA 5IT5A 4HESA 2ZC7A 3CHWP 4X1MA 4HEFA 4K08A 1G28A 4GNUA 1BLCA 4F94A 2DNSA 3BY9A 4JBFA 4D60A 1MWTA 2G7UA 5FAQA 1SCWA 4LCMA 1QMFA 4CQHA 1N9BA 1L2SA 4C3QA 2V9AA 3VP0A 3NY4A 1DJCA 2XLNA 1PWCA 2LB9A 1W5DA 4LFUA 2WKEA 5FDSA 1NRJA 1O07A 2R9WA 3BEBA 4IHQA 3Q82A 1DRMA 5HD3A 4QU3A 2JKRI 1SZVA 5J3WA 4Y15A 2B95A 3QNCA 3SH9A 1KGEA 1Y4OA 4L9EA 3B3XA 3BECA 2Y2HA 3FC7A 1VEUB 3B42A 4HP4A 2A3UA 1A0KA 4ZJ2A 3H82B 1EW0A 4FCFA 2ZQ7A 1KGFA 2ZC4B 2V20A 3MF0A 2JC7A 2ZL1B 4DJ2A 3UMDA 3EOIA 2Y2OA 1IOUA 4JXVA 5IS1A 2H5SA 4P6ZM 2HDSA 4LRYC 1WYCA 2J80A 5FA7A 3W8KA 2ZBBA 3LIFA 3OCNA 3PBQA 2J3TD 5CEDA 1L0EA 1YSQA 1NY0A 3VMAA 3QP5A 4DN0A 4GW9A 4YWZA 1ALQA 1N9NA 4GB7A 2ZQDA 5KMWA 5CRFA 3OPRA 4S2MA 5FAOA 4CLCD 1JTDA 3WS1A 1XXMA 1TDGA 4OOYA 3LFVA 4Q0HA 2V2FF 4NK3A 3C30A 3N8LA 1FCNA 3SH7A 1ACFA 4S2LA 1I5QA 1KE0A 2W3DA 2O9AA 3AGDA 4FOFA 1KDSA 3D3OA 1OTAA 1K4FA 4QB8A 5HFOA 4Q0IA 4HBTA 5EM1A 2VJWA 3O88A 3T1XA 1XGIA 2XEPA 3G34A 3DW0A 1FCOA 1OJGA 4WF0A 4HQAA 1JTGA 2R78A 5HWWA 3C4OA 1RCJA 3F1NB 4S2OA 1FIKA 4OOMA 1VM1A 1W79A 2B02A 4WELA 4CLCB 3T12B 5DVAA 1VETA 4R3AA 3HLFA 1HZOA 4GD8A 4GZBA 2ZC6B 4LV1A 2J8YA 2L1MA 2JE5A 3E98A 1K54C 4BQMA 3DWZA 4S2JA 3VE3A 1FSYA 3G31A 4BJPA 1BYWA 3BFEA 4DE3A 2H0YA 1ZKJA 1J9MA 4RA7A 3VSLA 3BFDA 3KSGA 3SOIA 4EWFA 5CERA 4DKIA 4FUWA 4XT2B 2VGLM 1PWGA 4HOIA 5EUAA 2ZC3B 4KZAA 4NXEA 5GLBA 1WE4A 3V50A 5HL1A 1K6SA 4X69A 2PBDP 4WEJA 4E3NA 1K57A 4OQGA 2OV5A 1TF1A 2QZ6A 1AXBA 3UDIA 3WRZA 4EUZA 1W8YA 2P7JA 3IS2A 3ZQ5A 4EV4A 3F1NA 4KG5A 3BWLA 5HARA 4B9OA 3FWLA 3D72A 4EEPA 5J7EA 4X6TA 3F1OA 3A3JA 3SS5A 4WMCA 3LIDA 3NULA 3I7JA 3IH8A 1K57C 1F9IA 1PYYA 1DP8A 4WZ5A 4NKPA 3PHYA 4Y2FA 3VOYA 3O87A 5CHUA 4MEZA 1XJ4A 2QJ7A 2D01A 4DRTA 1MPLA 1FQGA 1H3QA 3MZDA 3NIAA 1N9OA 3FPWA 5FQKA 4KZ5A 2PU2A 2WADA 4HBUA 2WAEA 4E3JA 2ZQ8A 3B47A 3NECA 4GS9A 4MBKA 3ZNTA 4P0MA 4MMNA 2QYBA 4DXBA 2W27A 1BZAA 1L0DA 2E8IA 1K54A 1S4RA 3HLEA 4FTXA 2EX2A 2V8CA 3P98A 4PKYA 5HSQA 2IA2A 1V9ZA 2Y2IA 3O3VA 2IWBA 5HDCA 3EQVA 4KG2A 4NXBA 3MSHA 3MXSA 1S0WA 4S2KA 4ZAMA 3L7HA 2PRFA 2INWA 4IEDA 4Y3IA 5AQ9A 4WMCD 4NETA 2P9VA 4WN5A 3LICA 4Y17A 4EUVA 3TJZC 4Y7PA 3LEZA 5HD5A 3TOIA 3LO7A 4X68A 1W7FA 2KDKA 1YM1A 3ICYA 4MDZA 2W3HA 5A92A 4IJGA 3GDIA 2Q9NA 3E4QA 3T4SA 3NI9A 3S7PA 2W1TA 2R9XA 5DF8A 2A2LA 1HD8A 2P74A 3ZG0A 1K55C 4X25A 2E8JA 1YSPA 5AJGA 4ZBEA 1PFLA 1CI9A 4NXFA 4Y13A 2XFTA 1ESIA 4GS9B 4LV0A 3MJQA 1GHMA 2XA7M 1NYYA 2Y2LA 2P04A 2PD8A 5FI7A 2W3FA 1FSWA 1PWDA 5GHYA 5HL6A 4Y5FA 4LRZE 3GMWA 2ZD8A 4WM9A 3BW6A 3BLSA 3C5AA 3LUQA 3E4OA 4EQ1A 3TE8A 1S4SA 3C38A 4RYEA 2YKFA 2P9VB 5DJTA 3AGEA 4O7DA 4LENA 4OQ0A 4JXGA 4M3KA 4F3LB 4NG2A 3S22A 2WGIA 5F82A 4R3JA 1OTDA 4HJ6A 5FI6A 2W3EA 4ARZA 5FEGA 2H10A 4O8GA 5DF9A 3RFBA 5L8MA 3HVFA 4OVDA 1JWVA 4KQDA 1U60A 3VFFA 2Q0OA 2Y55A 3KYQA 4E3KA 4KZ3A 4Z9QA 3Q7VB 2C5WB 2HV1A 3ZVTA 5E2EA 4JGQA 4G3KA 2DMWA 2WZZA 2HP9A 3D9YA 5CTNA 3N4IA 3OPLA 4YINA 1BT5A 3LR3A 1ZC2A 2V0UA 3LR5A 3SH8A 4WL9A 5TBMA 1N9LA 4P6ZS 4PM7A 1GSXA 3BQ8A 1N4OA 2Y4AA 1NYMA 4OLDA 3VP3A 4WBGA 3JVVA 4UA7A 4Q8IA 1YLYA 1J3WA 2FFFB 4OQHA 1YAXA 4EXOA 1F98A 3NC8A 4OP5A 2PYPA 1JNUA 2JKGA 1H5XA 4EU0A 3W4QA 3FPVA 2UV0E 5L07A 2RL3A 1FR6A 2JKTM 5G4YA 1H8MA 4HI4A 1ESUA 1MWUA 1W63Q 3UB9A 3QP2A 4JLFA 3CWFA 4LRXC 5FL3A 1YPRA 5HAIA 3G4PA 5HWVA 2PYRA 4DE0A 3GTCA 3TG9A 3D4FA 4GHIB 1DY6A 3IBJA 3ITBA 4EW7A 4DE2A 2EXAA 4KG6A 3MXRA 2PD7A 1RP5A 4II7A 3M2KA 2XH9A 5DJUA 5A91A 3LR4A 3M6BA 4EERA 3BFCA 3EWKA 2Y2GA 3F1OB 2V1BA 4A5RA 2I72A 2Y2QA 4ZJ1A 3VP2A 1CQAA 4IBRA 4BBVA 2GJ3A 2H0TA 1XX2A 5CX7A 4HNBA 5DKKA 2ZL1A 1P97A 1ONHA 3PBNA 4LLOB 2WYXA 1OTBA 3IX4A 4E04A 3K3CA 2WK0A 3ZHHA 5EOOA 5L10A 1EROA 1VHMA 2Y2KA 3IXBA 1YLZA 1KE4A 2DRWA 2WKHA 3IWOA 4QY5A 1WYBA 1NRFA 2Z2LB 3HLCA 4RX3A 4ETZA 1LL8A 4PPRA 2VZWA 4R6LA 1K56A 1XA1A 2WKRA 3E4PA 5DFYA 2WKQA 3HL9A 5EVIC 3DBAA 1K25A 2EX6A 5DKLA 3DTKA 3KSFA 3MS6A 3OBFA 4YFMA 5C5KA 1JWZA 3PAEA 2CC1A 1MC0A 1PI4A 2A24B 4X56A 3ITAA 4N9KA 1IKGA 1GHIA 4I3IA 4KQOA 4LPZA 5M19A 3HLBA 3MFDA 3S7NA 1KE3A 3CMZA 1SDNA 3HUNA 4G3WA 4IVKA 3N6IA 1OTIA 1CK3A 3EEHA 3H82A 3ZDJA 4KZBA 3FYZA 3VE4A 1XJ6A 2Z2MB 4WLAA 4DJ3A 3IXDA 4EEUA 3UE0A 1ZTUA 3Q7VA 1DP6A 1IELA 3G30A 4UAAA 1UGUA 2JBFA 2ZMFA 4EBPA 4XXRA 4E6XA 2PAVP 4PM8A 3QNBA 5FQIA 4JXSA 2J9PA 2ZM8A 3GV9A 3OCLA 3VOZA 4XUZA 3B33A 3W4PA 3C8CA 1NZOA 2ZM0A 3G2ZA 3KX0X 5HPFA 3GRJA 1KVMA 4EETB 5TGFA 3RTYA 3NJAA 3H7WB 2L4RA 5FASA 2OWHA 3HJIA 2VV7A 2WKPA 1ONGA 4QPRA 4HJ4A 1MKIA 3EGXC 4UA9A 3LIEA 2LB5A 1RGYA 4BL3A 3CZDA 1SKOB 1YKDA 1CF0A 5GLAA 3T4JA 5EOEA 1K0KA 3NDGA 5G18A 4KZ8A 4R4RA 4N92A 3N7WA 3GECA 1TS6A 1ES2A 4JPMA 3OPPA 2OLVA 3UE1A 1XPBA 2O0YA 4CLCA 3NOUC 3JVUA 2HF6A 4E3MA 3MMHA 4JXWA 1TD5A 3NOPC 1K55A 4KZ6A 4N1HA 5DTKA 2XSSA 2A24A 3RJUA 2PR6A 2VX8A 2M7UA 5CGXA 2XROA 1XFNA 3S4XA 1E4DA 5HZHA 4ZTKA 1ZHHB 4P87A 4I39A 3UN7A 3PBRA 3S7QA 4MBFA 4GJ4A 4OLGA 1T19A 1FCMA 2ACGA 3UY6A 3V5MA 3WS0A 2PR5A 3DTEA 2H28A 3PYPA 2I9VA 1ES4A 2V1AA 3UPOA 4MBHA 3E2LA 1IFQA 4GKUA 4EBLA 4QD4A 2PHYA 3MKEA 4KUOA 1WA9A 5CXWA 2BASA 3A0RA 3V3SA 2RCXA 3LGOA 3NBLA 4U0TA 2ZOIA 5CECA 2QHKA 1LLBA 4E3IA 3G35A 2VLGA 3HLWA 2ZQCA 3CJMA 4JGOA 4X53A 1YMSA 2P08A 1IYSA 1CJFA 2Y91A 3ULFA 3FKWA 5D3OA 1YQSA 3VV4A 3N8SA 4IUHA 5AQ7A 4OPQA 2JKTI 1XJ2A 3NDEA 1BTLA 2WKIA 4S2PA 4GHIA 3T4OA 4UA6A 2K31A 1MZUA 4HHDA 2Y59A 3GSGA 3UO9A 3IF5A 4K91A 5E2FA 5LBRA 2V1ZA 3M6HA 3A0SA 1SHVA 2UWXA 1ES3A 4HY8A 2VV8A 3M2JA 3U2AA 3A0VA 4O01A 2VGJA 5AQAA 1MWRA 3QP4A 4FSFA 3VFHA 1VEUA 3RXWA 1LL5A 2BLSA 3UPPA 2HZ5A 4OKPA 3GR2A 5FI2A 1P9WA 3MZEA 4KENB 4ETXA 1S67L 4OP8A 1HTZA 3CLOA 1PZPA 3GVBA 4N9LA 2KOIA 3LY4A 1BSGA 4MLLA 2OWJA 3BJNA 4OOLA 2AVXA 2M7VA 3L9KA 4X55A 2XGNA 1T1CA 1EI5A 4WEKA 3BM6A 3ZG8B 4IUKA 2IWCA 1ERMA 4ZDXA 2Z6DA 3EEAA 1VQQA 2OAP1 4MNRA 3PAGA 3BRMA 1T1BA 2WAFA 4E3LA 5EM0A 5F1FA 4WZ4A 3FV7A 1PNEA 5A93A 1S6RA 4ZRRA 1FOFA 3PBTA 4GD6A 3BLMA 1LSWA 3LEQA 2ZLYA 3H9WA 5J8XA 5IHVA 2HPBA 5DF7A 1PI5A 1VB6A 4XUXA 5HPIA 5M18A 2W1TB 3UE3A 4FH4A 3UB6A 2VGLS 4RX2A 4R23A 1MXOA 4KZ9A 4R0QA 2B18A 1PRQA 1LI9A 4C6YA 1E25A 1ES5A 3HUMA 1JVJA 4YOFA 1YLTA 5GLDA 3C2WA 5TJJA 1TS8A 2JCHA 5EV0A 1IKIA 1DJAA 4B88A
chains in the Genus database with same CATH topology
4R3AA 3UB7A 1P97A 3PBSA 5HDDA 3BY8A 3PBNA 1LSXA 4LLOB 1OJ5A 3R7WB 1KOUA 4BBUA 2L1MA 1OTBA 1D06A 3P01A 3E98A 4E04A 2JN7A 3K3CA 2W0NA 1Y28A 2GX5A 2PT7A 2OAQ1 1VHMA 4GLQA 3VE3A 3UMEA 5MC7A 3LYXA 4BJPA 4ETZA 1BYWA 1LL8A 2KX6A 2VZWA 1W63M 4R6LA 2WKRA 5I5LA 4PKYG 2QWSA 2NUTC 3E4PA 5DFYA 4ARZB 2WKQA 5F5YA 3KSGA 3DBAA 2O9BA 5DKLA 2XA7S 4H6JA 3KSFA 1P0ZA 4HIAA 3HJKA 4XT2B 3OBFA 4L9FA 4UQIS 5C5KA 5KIZA 1MC0A 2A24B 5AVEA 2VGLM 4HOIA 4JGPA 1OPXA 4YNRA 4MN6A 4I3IA 4KQOA 4NXEA 4LPZA 3LI9A 1T18A 2VA0A 3LR0A 4WEJA 3G6OA 3S7NA 1TF1A 2D02A 2OOLA 3CUEA 4HH3A 4MN7A 4G3WA 1F5MA 2P7JA 1OTIA 3IS2A 3ZQ5A 2PDRA 3EEHA 3F1NA 3T50A 3H82A 3VE4A 3BWLA 1XJ6A 2VKSA 5F69A 4B9OA 4WLAA 4DJ3A 3D72A 3MFXA 4I3AA 4EESA 4EEUA 4B93A 4EEPA 1ZTUA 5J7EA 1DP6A 2W1RA 5AVFA 3F1OA 4Z1WA 1UGUA 1TS0A 2QJ5A 2ZMFA 4R70A 4CLCC 3LIDA 3CUEC 2EWVA 5KSHA 3MR0A 1F9IA 1DP8A 2QKPA 3OCLA 1T1AA 3PHYA 4NKPA 1V9YA 3LIBA 4Y2FA 3EGDC 3B33A 3PXPA 1ODVA 3C8CA 5HPFA 2GNXA 3KX0X 1XJ4A 2QJ7A 2D01A 4EETB 3ZYTA 3RTYA 3NJAA 3F1PA 3K2NA 3H7WB 4ME4A 2L4RA 5J4EA 3F1PB 3R7WA 4JGRA 2OWHA 1H3QA 3HJIA 4WUJA 2VV7A 4XT2A 3KSHA 3H7WA 2KLIA 1S66L 2WKPA 4QPRA 2O99A 4HJ4A 3UE6A 4M4XA 3OLOA 3R4KA 1N9OA 3NOTC 3FPWA 2Z6CA 1S1ZA 5TBMB 1LSVA 3EGXC 2FZ0A 3LIEA 2VEAA 2LB5A 3B47A 1YKDA 4GS9A 4GCZA 4MMNA 2EWWA 2QYBA 3T4JA 3CAXA 1OT9A 2W27A 4RQ9A 2K7SA 1S4RA 4HH2A 2XRNA 3VOLA 1DP9A 4H6JB 4PKYA 5HSQA 2IA2A 3MXQA 1V9ZA 4UEYA 3LI8A 1GSVA 3EQVA 5HDCA 3BQAA 3GECA 4NXBA 4DMZA 4KUKA 4NXGA 1TS6A 4G3VA 1OT6A 2INWA 4L0LA 3TRCA 4Y3IA 2O9CA 1S1YA 4WN5A 3LICA 2O0YA 4CLCA 2Y79A 3TJZC 4EUVA 3NOUC 3JVUA 5HD5A 3T4KA 2HF6A 3KO6A 2L0WA 3MMHA 2KDKA 1TD5A 3NOPC 3ICYA 4MDZA 2XSSA 2A24A 2PR6A 2VX8A 2W3HA 2HJEA 2M7UA 4F3LA 4I5SA 2XROA 1XFNA 5HZHA 1UWNX 1ZHHB 4I39A 4IJGA 3PBRA 3S7QA 3GDIA 3E4QA 3T4SA 1STZA 3T4QA 1TS7A 4GJ4A 3S7PA 1T19A 2W1TA 2A2LA 2PR5A 2H28A 3PYPA 2I9VA 2V1AA 1X0OA 4AFIA 1IFQA 1YSPA 5AJGA 4HP9A 3E0YA 3MQOA 4O0PA 2PHYA 4NXFA 4KUOA 1WA9A 2BASA 4GS9B 5EFWA 3O5YA 3CITA 3A0RA 3MJQA 2VV6A 5G4ZA 2XA7M 3PBOA 2P04A 3PR6A 1NLYA 2EA9A 1D7EA 4CLCE 2PD8A 2ZOIA 4UQIM 3T4TA 2W3FA 3K3DA 5HDSA 3EQUA 5HL6A 4Y5FA 2QHKA 4LRZE 2J3WA 4PAUA 3W2ZA 3BW6A 2VLGA 3KSIA 3LIAA 3MQ0A 4MN5A 5IT5A 4I38A 1NLZA 3LUQA 3E4OA 4JGOA 3TE8A 4EQ1A 4Q0JA 2P08A 2Y8HA 3TW8A 1G6OA 1S4SA 3C38A 5HWTA 3ULFA 2YKFA 4K08A 1G28A 5DJTA 3BY9A 3VV4A 4IUHA 2G7UA 4F3LB 2JKTI 1XJ2A 2GZAA 4CQHA 3HCYA 2V9AA 4GHIA 1OTDA 4HJ6A 3T4OA 2K31A 5DFXA 2LB9A 4BBTA 2W3EA 2MJ6A 4ARZA 1MZUA 1NRJA 4HHDA 4O8GA 5DF9A 3IS2B 3RFBA 3S7OA 5L8MA 4IHQA 1DRMA 5HD3A 2FH5A 4KQDA 2JKRI 5LBRA 5J3WA 5IU1A 4R38A 3A0SA 4NEED 3KYQA 3P7NA 1MKMA 4L9EA 5K5BA 4HY8A 2VV8A 2HV1A 3FC7A 4JGQA 3U2AA 3A0VA 4O01A 3B42A 4G3KA 5F68A 2DMWA 4HP4A 2J3TC 4FSFA 3OOVA 3H82B 1EW0A 3MF0A 3LR3A 2V0UA 3SW1A 4DJ2A 3LR5A 3EOIA 3UMDA 4WL9A 2K2NA 5TBMA 1N9LA 4P6ZS 2HGVA 1GSXA 1P9WA 3BQ8A 1IOUA 2W3GA 5IS1A 4ETXA 1S67L 4P6ZM 4LRYC 3CLOA 3JVVA 2JKRM 2J80A 2CMNA 3MQQA 2KOIA 2ZBBA 3LIFA 3OCNA 3PBQA 4EXOA 1YAXA 2J3TD 4MCWA 2OWJA 1F98A 1NWZA 3BJNA 4OOLA 2M7VA 3CI6A 1YSQA 2PYPA 1JNUA 4EU0A 4DN0A 4GW9A 4BMWA 3FPVA 4YWZA 1N9NA 3NHQA 1T1CA 4WEKA 5F6AA 3T4LA 2HJ9C 4IUKA 2JKTM 2ZOHA 5G4YA 1H8MA 2Z6DA 3EEAA 1OTEA 2OAP1 4HI4A 4CLCD 1T1BA 4BWIA 3LFVA 4Q0HA 4I3JA 5A8BA 1W63Q 3UB9A 2YKHA 3C30A 2M1CA 3CWFA 1XJ3A 4L9GA 4ZRRA 4LRXC 3PBTA 5FL3A 1LSWA 2W3DA 3IBRA 5HWVA 1XFQA 2PYRA 3H9WA 2O9AA 3KYZA 3FG8A 4FOFA 4GHIB 1VB6A 3D3OA 3IBJA 1OTAA 5HPIA 4EW7A 2W1TB 2NUPC 3RH8B 3UE3A 3V67A 1GSWA 4Q0IA 2VGLS 3UB6A 3OC2A 2VJWA 1LT0A 4WF0A 1OJGA 2PD7A 4II7A 2B18A 4HQAA 1UWPX 5DJUA 2V0WA 3LR4A 4EERA 4YOFA 3EWKA 2R78A 5HWWA 3F1OB 2JHEA 2V1BA 3F1NB 3UB8A 2ZMVA 4OOMA 2B02A 1P9RA 3C2WA 4WELA 5TJJA 4CLCB 1TS8A 4HJ3A 4BBVA 2GJ3A 5CX7A 4PHTA 4HNBA 5DKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHY A;  3H82 B;  1V9Y A;  1EW0 A;  1P97 A;  3LIB A;  2H28 A;  4R3A A;  3B33 A;  3UB7 A;  3PYP A;  5HDD A;  2I9V A;  1ODV A;  2V1A A;  3C8C A;  2V0U A;  3SW1 A;  1X0O A;  3BY8 A;  1XJ4 A;  3KX0 X;  2QJ7 A;  3UMD A;  1LSX A;  2D01 A;  4LLO B;  4WL9 A;  4DJ2 A;  1OJ5 A;  4EET B;  5TBM A;  1KOU A;  3RTY A;  1N9L A;  4BBU A;  3NJA A;  1GSX A;  2L1M A;  3F1P A;  1OTB A;  3H7W B;  4HP9 A;  3MQO A;  2L4R A;  5J4E A;  1D06 A;  2PHY A;  5IS1 A;  4NXF A;  4KUO A;  3F1P B;  4E04 A;  1S67 L;  1WA9 A;  2BAS A;  2JN7 A;  3K3C A;  4GS9 B;  2W0N A;  1Y28 A;  2OWH A;  3HJI A;  3A0R A;  3MJQ A;  2VV7 A;  4JGR A;  2VV6 A;  3CLO A;  3H7W A;  4LRY C;  4WUJ A;  4XT2 A;  5G4Z A;  1S66 L;  2J80 A;  2CMN A;  2WKP A;  4HJ4 A;  3MQQ A;  3UE6 A;  2ZBB A;  3LIF A;  4M4X A;  3OLO A;  4EXO A;  1N9O A;  2EA9 A;  2OWJ A;  1F98 A;  3NOT C;  3VE3 A;  1D7E A;  1NWZ A;  2Z6C A;  2PD8 A;  2ZOI A;  3UME A;  1S1Z A;  3K3D A;  5TBM B;  1LSV A;  5HDS A;  2PYP A;  3LYX A;  1BYW A;  1JNU A;  1LL8 A;  2KX6 A;  2QHK A;  2VEA A;  3LIE A;  4LRZ E;  4HNB A;  4GW9 A;  4YWZ A;  4R6L A;  4GS9 A;  3LIA A;  2VLG A;  1N9N A;  3NHQ A;  1T1C A;  2WKR A;  4GCZ A;  4MN5 A;  5F6A A;  5I5L A;  4PKY G;  5DKK A;  2QWS A;  4I38 A;  3CAX A;  3E4P A;  3LUQ A;  2ZOH A;  1OT9 A;  2W27 A;  2WKQ A;  3E4O A;  4JGO A;  4RQ9 A;  5F5Y A;  5G4Y A;  4EQ1 A;  2Z6D A;  1S4S A;  2K7S A;  1S4R A;  4HH2 A;  1OTE A;  5DKL A;  4HI4 A;  4H6J A;  5HWT A;  3ULF A;  1T1B A;  1P0Z A;  2YKF A;  3HJK A;  4HIA A;  4XT2 B;  3VOL A;  4K08 A;  1DP9 A;  1G28 A;  4H6J B;  4L9F A;  5EFW A;  5DJT A;  4I3J A;  4PKY A;  5HSQ A;  5KIZ A;  5A8B A;  3MXQ A;  1V9Z A;  2A24 B;  5AVE A;  3UB9 A;  3BY9 A;  3LI8 A;  1GSV A;  2YKH A;  5HDC A;  2M1C A;  3GEC A;  4NXB A;  3CWF A;  1XJ3 A;  4HOI A;  4JGP A;  4F3L B;  4L9G A;  4KUK A;  4NXG A;  1TS6 A;  4I3I A;  4LRX C;  1XJ2 A;  4MN6 A;  4NXE A;  4LPZ A;  3LI9 A;  1T18 A;  1LSW A;  1OT6 A;  3IBR A;  5HWV A;  1XFQ A;  2INW A;  2PYR A;  2V9A A;  3H9W A;  3G6O A;  4GHI A;  1OTD A;  3FG8 A;  2D02 A;  2OOL A;  4HJ6 A;  1S1Y A;  4WN5 A;  3LIC A;  4HH3 A;  4GHI B;  4BBT A;  1VB6 A;  1OTA A;  2P7J A;  4EW7 A;  1MZU A;  1OTI A;  3IS2 A;  3NOU C;  3RH8 B;  3ZQ5 A;  2PDR A;  3EEH A;  4HHD A;  5HD5 A;  3F1N A;  3T50 A;  2L0W A;  1GSW A;  3H82 A;  3IS2 B;  2KDK A;  3UB6 A;  1DRM A;  3VE4 A;  3NOP C;  5HD3 A;  3BWL A;  1XJ6 A;  5F69 A;  4B9O A;  4KQD A;  1LT0 A;  4WLA A;  3ICY A;  5J3W A;  4WF0 A;  1OJG A;  5IU1 A;  2A24 A;  2PD7 A;  4DJ3 A;  4R38 A;  2PR6 A;  3A0S A;  3D72 A;  3MFX A;  4I3A A;  4EES A;  4HQA A;  4EEU A;  1UWP X;  4EEP A;  4F3L A;  4I5S A;  5DJU A;  1XFN A;  5J7E A;  1DP6 A;  2V0W A;  5HZH A;  1UWN X;  5AVF A;  3F1O A;  3P7N A;  4L9E A;  4EER A;  4I39 A;  1UGU A;  1TS0 A;  3EWK A;  3GDI A;  2QJ5 A;  2R78 A;  5HWW A;  3F1O B;  2JHE A;  2V1B A;  2VV8 A;  3E4Q A;  4HY8 A;  3F1N B;  4R70 A;  3UB8 A;  3LID A;  2HV1 A;  3FC7 A;  4JGQ A;  2B02 A;  3A0V A;  3C2W A;  1TS7 A;  5F68 A;  1TS8 A;  4HJ3 A;  4BBV A;  4HP4 A;  1T19 A;  2GJ3 A;  3MR0 A;  1F9I A;  1DP8 A;  2QKP A;  1T1A A;  2PR5 A; 
#chains in the Genus database with same CATH topology
 3PBS A;  5HDD A;  1NZU A;  1OJ5 A;  1KOU A;  1Q2P A;  4BBU A;  3GQZ A;  3DWK A;  4U0X A;  3P01 A;  3MBZ A;  5CEB A;  2WGW A;  3VP1 A;  1Y28 A;  1Q2Q A;  2PT7 A;  2OAQ 1;  5GHX A;  2ZC5 B;  1O7E A;  3UME A;  5MC7 A;  3LYX A;  1QME A;  1G6A A;  4DF6 A;  2QMI A;  5KZH A;  1XP4 A;  4P6B A;  2V8F A;  4ARZ B;  3UPN A;  2O9B A;  2XFS A;  2XD5 A;  1P0Z A;  4HIA A;  3HJK A;  3C4P A;  3A3I A;  4UQI S;  2ZQA A;  1GA0 A;  1IEM A;  4JGP A;  1OPX A;  3LI9 A;  1T18 A;  3Q7Z A;  3G6O A;  1NJ4 A;  2D02 A;  1MBL A;  3UB5 P;  3QP1 A;  3ZNY A;  3IT9 A;  3Q81 A;  4R3B A;  5AQB A;  5CGS A;  5DTT A;  2VKS A;  3CG5 A;  4K0W A;  5EVE A;  2XDM A;  3JYI A;  3TSG A;  1L0F A;  5EVI D;  3MFX A;  4EES A;  4R1G A;  1YMX A;  2ZM2 A;  3BYD A;  3Q07 A;  4Z1W A;  2QJ5 A;  1YLJ A;  4UHU A;  3CUE C;  5KSH A;  5HW3 A;  4EQI A;  1XA7 A;  5CTM A;  1T1A A;  4OPY A;  1GHP A;  3G32 A;  3PXP A;  2Y2M A;  4GN2 A;  3ZYT A;  2HDQ A;  3F1P A;  1FIL A;  1OME A;  3Q1F A;  5FAP A;  4ME4 A;  5TR7 A;  2HP6 A;  5J4E A;  1F2K A;  3F1P B;  4X1L A;  5CHM A;  4JGR A;  5E2G A;  4OH0 A;  4WUJ A;  4XT2 A;  5FQQ A;  2KLI A;  1S66 L;  2O99 A;  1SDE A;  3WS5 A;  4M4X A;  1IYP A;  1KVL A;  2Z6C A;  3A3F A;  5TBM B;  3WRT A;  2X01 A;  1I2S A;  4E6W A;  1AWI A;  3CAX A;  4LCL A;  1OT9 A;  3ZG9 B;  4HH2 A;  3IXG A;  2Y2N A;  3PTE A;  2XRN A;  1GCE A;  1DP9 A;  3T1S A;  4H6J B;  3W4O A;  1M6K A;  2X71 A;  3LI8 A;  1GSV A;  2PBY A;  4ESP A;  3BQA A;  1PW8 A;  4IVI A;  2JKF A;  4KUK A;  4NXG A;  2XD1 A;  2J7V A;  4G3V A;  2XK1 A;  1K38 A;  2PU4 A;  4L0L A;  2B5R A;  4PM5 A;  5L2F A;  1TDL A;  4Y0T A;  3RXX A;  2Y79 A;  3E2K A;  3N8R A;  5TFQ A;  4DDY A;  3T4K A;  2L0W A;  2C6W B;  5FSR A;  1EWZ A;  5L09 A;  3T1R A;  1G5U A;  2HJE A;  3FKV A;  4F3L A;  4I5S A;  3IHA A;  1UWN X;  3BFG A;  2ZQ9 A;  3T1Q B;  4DE1 A;  3ZG5 A;  3IHB A;  1STZ A;  3IH9 A;  3T4Q A;  3IF6 A;  1TS7 A;  1HVB A;  3MKF A;  5FDH A;  4LV3 A;  2VK3 A;  1KGG A;  4H8R A;  2DCF A;  5EE8 A;  4LV2 A;  1X0O A;  5GLC A;  5GHZ A;  1E3U D;  3HRE A;  5FQM A;  4HP9 A;  1ERQ A;  3O5Y A;  3VSK A;  5G4Z A;  4CPK A;  3DAV A;  3PR6 A;  3SS3 A;  1D7E A;  3HLG A;  4CLC E;  4QY6 A;  3T4T A;  3K3D A;  1H8Y A;  2J3W A;  4MN5 A;  3NCK A;  4I38 A;  4EBN A;  2WGV A;  5EVI A;  1NLZ A;  4N1X A;  4Q0J A;  4KQQ A;  2Y8H A;  3TW8 A;  1C3B A;  1G6O A;  5JYP A;  5HWT A;  1XGJ A;  3WS2 A;  1XKZ A;  4BEN A;  5F83 A;  3HBR A;  4P85 A;  3ZG7 B;  2EFU A;  2GZA A;  3HCY A;  1Z6F A;  1ZG6 A;  1DJB A;  2HDU A;  3G2Y A;  3OPH A;  5DFX A;  4BBT A;  1PW1 A;  2WUQ A;  2MJ6 A;  3ZGA B;  1RGZ A;  3ISG A;  3IS2 B;  3S7O A;  3QP6 A;  2FH5 A;  3HLD A;  5IU1 A;  4R38 A;  3ZVW A;  4WZ5 C;  3A3D A;  4NEE D;  3P7N A;  1MKM A;  3BFF A;  3KYE A;  2FFY A;  5K5B A;  4K0X A;  1YLW A;  5FQ9 A;  5F68 A;  5CHJ A;  2J3T C;  3WS4 A;  4JKT A;  3OOV A;  4OON A;  1VET B;  2K2N A;  2HGV A;  3OZH A;  2W3G A;  3JPU A;  5HX9 A;  2JKR M;  2CMN A;  3MQQ A;  1BLP A;  4MCW A;  5FAT A;  3IWQ A;  1NWZ A;  3DTM A;  3CI6 A;  5EPH A;  4BMW A;  2EX9 A;  1SKF A;  4DDS A;  4Y0U A;  3NHQ A;  1G68 A;  4ID4 A;  2ZJ9 A;  5F6A A;  3T4L A;  2HJ9 C;  2ZOH A;  4E3O A;  4QHC A;  1OTE A;  1Z09 A;  4BWI A;  5FQJ A;  1IYO A;  4I3J A;  5A8B A;  2ZMA A;  4OPR A;  2YKH A;  2M1C A;  1XJ3 A;  4L9G A;  3IQA A;  1L3L A;  1CEF A;  3IBR A;  1XFQ A;  1JWP A;  3KYZ A;  3SS4 A;  3C7V A;  3FG8 A;  2A49 A;  1KDW A;  4FD8 A;  3RH8 B;  2NUP C;  3V67 A;  4ZJ3 A;  5FEF A;  1GSW A;  4Y0O A;  1E3U A;  3IWI A;  3OC2 A;  4PM9 A;  3UDX A;  3IXH A;  1LT0 A;  2Y2J A;  1ZG4 A;  1UWP X;  3FZC A;  5CGW A;  5E43 A;  2V0W A;  2BG1 A;  3C7U A;  2JHE A;  3UB8 A;  2ZMV A;  4OQI A;  1P9R A;  4HJ3 A;  3SZT A;  4PHT A;  3SW1 A;  3ZFZ A;  3UB7 A;  2Y2P A;  1I2W A;  1TEM A;  3BY8 A;  3LCE A;  1LSX A;  3R7W B;  1K4E A;  5BOH A;  4R4S A;  1K56 D;  1D06 A;  2G2W A;  2JN7 A;  2W0N A;  4PMA A;  2GX5 A;  1W8Q A;  2VGK A;  1MWS A;  3U4L P;  2WZX A;  4GLQ A;  3WWX A;  3LY3 A;  4KZ4 A;  4JF4 A;  5U47 A;  1Y54 A;  4S2I A;  2KX6 A;  4GOG A;  1CI8 A;  3V39 A;  1W63 M;  3AGF A;  5I5L A;  4PKY G;  2EX8 A;  2QWS A;  2NUT C;  5F5Y A;  5I94 A;  2XA7 S;  4H6J A;  4U3T A;  4L9F A;  4GDB A;  1L0G A;  2G2U A;  5KIZ A;  5DTS A;  5AVE A;  3DTI A;  1LHY A;  2X02 A;  4YNR A;  4MN6 A;  4B4Z A;  1D1J A;  2VA0 A;  3LR0 A;  1SKO A;  2XF3 A;  4B4X A;  2OOL A;  3CUE A;  4HH3 A;  4MN7 A;  1F5M A;  3MZF A;  4S2N A;  2OSU A;  2PDR A;  4KQR A;  3T50 A;  1TVF A;  5F69 A;  1PZO A;  1LL9 A;  2EXB A;  4I3A A;  1MY8 A;  4B93 A;  1BUL A;  2W1R A;  1K6R A;  5AVF A;  2OLU A;  3S1Y A;  1TS0 A;  4R70 A;  4CLC C;  2Q9M A;  3CPT B;  2EWV A;  4DXC A;  3CPT A;  3MR0 A;  1CEG A;  2QKP A;  1V9Y A;  3LIB A;  4PM6 A;  3EGD C;  1BLH A;  1ODV A;  2GNX A;  4BLM A;  3IX8 A;  4IBX A;  2WGW B;  2EFX A;  3K2N A;  4RVA A;  5EEC A;  5F1G A;  3R7W A;  4CJN A;  3H7W A;  3KSH A;  3QP8 A;  3UE6 A;  3OLO A;  3R4K A;  3VP4 A;  3NOT C;  1NXY A;  1S1Z A;  5E2H A;  4BD1 A;  1LSV A;  1LI0 A;  2FZ0 A;  2VEA A;  5EVI B;  3V3R A;  2HP5 A;  4GCZ A;  2EWW A;  4RQ9 A;  1PIO A;  2K7S A;  5HAP A;  3VOL A;  5M1A A;  4JF5 A;  3MXQ A;  4UEY A;  4FH2 A;  4DMZ A;  5HAQ A;  2QPN A;  3A3E A;  1BLS A;  5GL9 A;  1OT6 A;  2HDR A;  3TRC A;  4KZ7 A;  2O9C A;  1S1Y A;  5EVL A;  4QWO A;  3O86 A;  1M40 A;  4OPZ A;  2GDN A;  3KO6 A;  1YT4 A;  3UDF A;  3IF6 B;  1H0M A;  1HLU P;  4QJG A;  3IF6 C;  4S2N C;  4LGW A;  4BL2 A;  4WYY A;  3IX3 A;  2XR0 A;  3ZCZ A;  2J9O A;  5KSC A;  1BUE A;  3QHY A;  1GA9 A;  4BD0 A;  4AFI A;  2XQZ A;  1YLP A;  3HUO A;  1IYQ A;  3E0Y A;  3MQO A;  4O0P A;  5EFW A;  3CIT A;  2VV6 A;  1FR1 A;  4JF6 A;  3PBO A;  2BTF P;  1NLY A;  2EA9 A;  2IWD A;  4D2O A;  4C75 A;  4UQI M;  5JYO A;  5HDS A;  3EQU A;  4GDN A;  3P09 A;  4PAU A;  3W2Z A;  3UNW A;  5A90 A;  3LIA A;  3KSI A;  3MQ0 A;  1H8Z A;  5IT5 A;  4HES A;  2ZC7 A;  3CHW P;  4X1M A;  4HEF A;  4K08 A;  1G28 A;  4GNU A;  1BLC A;  4F94 A;  2DNS A;  3BY9 A;  4JBF A;  4D60 A;  1MWT A;  2G7U A;  5FAQ A;  1SCW A;  4LCM A;  1QMF A;  4CQH A;  1N9B A;  1L2S A;  4C3Q A;  2V9A A;  3VP0 A;  3NY4 A;  1DJC A;  2XLN A;  1PWC A;  2LB9 A;  1W5D A;  4LFU A;  2WKE A;  5FDS A;  1NRJ A;  1O07 A;  2R9W A;  3BEB A;  4IHQ A;  3Q82 A;  1DRM A;  5HD3 A;  4QU3 A;  2JKR I;  1SZV A;  5J3W A;  4Y15 A;  2B95 A;  3QNC A;  3SH9 A;  1KGE A;  1Y4O A;  4L9E A;  3B3X A;  3BEC A;  2Y2H A;  3FC7 A;  1VEU B;  3B42 A;  4HP4 A;  2A3U A;  1A0K A;  4ZJ2 A;  3H82 B;  1EW0 A;  4FCF A;  2ZQ7 A;  1KGF A;  2ZC4 B;  2V20 A;  3MF0 A;  2JC7 A;  2ZL1 B;  4DJ2 A;  3UMD A;  3EOI A;  2Y2O A;  1IOU A;  4JXV A;  5IS1 A;  2H5S A;  4P6Z M;  2HDS A;  4LRY C;  1WYC A;  2J80 A;  5FA7 A;  3W8K A;  2ZBB A;  3LIF A;  3OCN A;  3PBQ A;  2J3T D;  5CED A;  1L0E A;  1YSQ A;  1NY0 A;  3VMA A;  3QP5 A;  4DN0 A;  4GW9 A;  4YWZ A;  1ALQ A;  1N9N A;  4GB7 A;  2ZQD A;  5KMW A;  5CRF A;  3OPR A;  4S2M A;  5FAO A;  4CLC D;  1JTD A;  3WS1 A;  1XXM A;  1TDG A;  4OOY A;  3LFV A;  4Q0H A;  2V2F F;  4NK3 A;  3C30 A;  3N8L A;  1FCN A;  3SH7 A;  1ACF A;  4S2L A;  1I5Q A;  1KE0 A;  2W3D A;  2O9A A;  3AGD A;  4FOF A;  1KDS A;  3D3O A;  1OTA A;  1K4F A;  4QB8 A;  5HFO A;  4Q0I A;  4HBT A;  5EM1 A;  2VJW A;  3O88 A;  3T1X A;  1XGI A;  2XEP A;  3G34 A;  3DW0 A;  1FCO A;  1OJG A;  4WF0 A;  4HQA A;  1JTG A;  2R78 A;  5HWW A;  3C4O A;  1RCJ A;  3F1N B;  4S2O A;  1FIK A;  4OOM A;  1VM1 A;  1W79 A;  2B02 A;  4WEL A;  4CLC B;  3T12 B;  5DVA A;  1VET A;  4R3A A;  3HLF A;  1HZO A;  4GD8 A;  4GZB A;  2ZC6 B;  4LV1 A;  2J8Y A;  2L1M A;  2JE5 A;  3E98 A;  1K54 C;  4BQM A;  3DWZ A;  4S2J A;  3VE3 A;  1FSY A;  3G31 A;  4BJP A;  1BYW A;  3BFE A;  4DE3 A;  2H0Y A;  1ZKJ A;  1J9M A;  4RA7 A;  3VSL A;  3BFD A;  3KSG A;  3SOI A;  4EWF A;  5CER A;  4DKI A;  4FUW A;  4XT2 B;  2VGL M;  1PWG A;  4HOI A;  5EUA A;  2ZC3 B;  4KZA A;  4NXE A;  5GLB A;  1WE4 A;  3V50 A;  5HL1 A;  1K6S A;  4X69 A;  2PBD P;  4WEJ A;  4E3N A;  1K57 A;  4OQG A;  2OV5 A;  1TF1 A;  2QZ6 A;  1AXB A;  3UDI A;  3WRZ A;  4EUZ A;  1W8Y A;  2P7J A;  3IS2 A;  3ZQ5 A;  4EV4 A;  3F1N A;  4KG5 A;  3BWL A;  5HAR A;  4B9O A;  3FWL A;  3D72 A;  4EEP A;  5J7E A;  4X6T A;  3F1O A;  3A3J A;  3SS5 A;  4WMC A;  3LID A;  3NUL A;  3I7J A;  3IH8 A;  1K57 C;  1F9I A;  1PYY A;  1DP8 A;  4WZ5 A;  4NKP A;  3PHY A;  4Y2F A;  3VOY A;  3O87 A;  5CHU A;  4MEZ A;  1XJ4 A;  2QJ7 A;  2D01 A;  4DRT A;  1MPL A;  1FQG A;  1H3Q A;  3MZD A;  3NIA A;  1N9O A;  3FPW A;  5FQK A;  4KZ5 A;  2PU2 A;  2WAD A;  4HBU A;  2WAE A;  4E3J A;  2ZQ8 A;  3B47 A;  3NEC A;  4GS9 A;  4MBK A;  3ZNT A;  4P0M A;  4MMN A;  2QYB A;  4DXB A;  2W27 A;  1BZA A;  1L0D A;  2E8I A;  1K54 A;  1S4R A;  3HLE A;  4FTX A;  2EX2 A;  2V8C A;  3P98 A;  4PKY A;  5HSQ A;  2IA2 A;  1V9Z A;  2Y2I A;  3O3V A;  2IWB A;  5HDC A;  3EQV A;  4KG2 A;  4NXB A;  3MSH A;  3MXS A;  1S0W A;  4S2K A;  4ZAM A;  3L7H A;  2PRF A;  2INW A;  4IED A;  4Y3I A;  5AQ9 A;  4WMC D;  4NET A;  2P9V A;  4WN5 A;  3LIC A;  4Y17 A;  4EUV A;  3TJZ C;  4Y7P A;  3LEZ A;  5HD5 A;  3TOI A;  3LO7 A;  4X68 A;  1W7F A;  2KDK A;  1YM1 A;  3ICY A;  4MDZ A;  2W3H A;  5A92 A;  4IJG A;  3GDI A;  2Q9N A;  3E4Q A;  3T4S A;  3NI9 A;  3S7P A;  2W1T A;  2R9X A;  5DF8 A;  2A2L A;  1HD8 A;  2P74 A;  3ZG0 A;  1K55 C;  4X25 A;  2E8J A;  1YSP A;  5AJG A;  4ZBE A;  1PFL A;  1CI9 A;  4NXF A;  4Y13 A;  2XFT A;  1ESI A;  4GS9 B;  4LV0 A;  3MJQ A;  1GHM A;  2XA7 M;  1NYY A;  2Y2L A;  2P04 A;  2PD8 A;  5FI7 A;  2W3F A;  1FSW A;  1PWD A;  5GHY A;  5HL6 A;  4Y5F A;  4LRZ E;  3GMW A;  2ZD8 A;  4WM9 A;  3BW6 A;  3BLS A;  3C5A A;  3LUQ A;  3E4O A;  4EQ1 A;  3TE8 A;  1S4S A;  3C38 A;  4RYE A;  2YKF A;  2P9V B;  5DJT A;  3AGE A;  4O7D A;  4LEN A;  4OQ0 A;  4JXG A;  4M3K A;  4F3L B;  4NG2 A;  3S22 A;  2WGI A;  5F82 A;  4R3J A;  1OTD A;  4HJ6 A;  5FI6 A;  2W3E A;  4ARZ A;  5FEG A;  2H10 A;  4O8G A;  5DF9 A;  3RFB A;  5L8M A;  3HVF A;  4OVD A;  1JWV A;  4KQD A;  1U60 A;  3VFF A;  2Q0O A;  2Y55 A;  3KYQ A;  4E3K A;  4KZ3 A;  4Z9Q A;  3Q7V B;  2C5W B;  2HV1 A;  3ZVT A;  5E2E A;  4JGQ A;  4G3K A;  2DMW A;  2WZZ A;  2HP9 A;  3D9Y A;  5CTN A;  3N4I A;  3OPL A;  4YIN A;  1BT5 A;  3LR3 A;  1ZC2 A;  2V0U A;  3LR5 A;  3SH8 A;  4WL9 A;  5TBM A;  1N9L A;  4P6Z S;  4PM7 A;  1GSX A;  3BQ8 A;  1N4O A;  2Y4A A;  1NYM A;  4OLD A;  3VP3 A;  4WBG A;  3JVV A;  4UA7 A;  4Q8I A;  1YLY A;  1J3W A;  2FFF B;  4OQH A;  1YAX A;  4EXO A;  1F98 A;  3NC8 A;  4OP5 A;  2PYP A;  1JNU A;  2JKG A;  1H5X A;  4EU0 A;  3W4Q A;  3FPV A;  2UV0 E;  5L07 A;  2RL3 A;  1FR6 A;  2JKT M;  5G4Y A;  1H8M A;  4HI4 A;  1ESU A;  1MWU A;  1W63 Q;  3UB9 A;  3QP2 A;  4JLF A;  3CWF A;  4LRX C;  5FL3 A;  1YPR A;  5HAI A;  3G4P A;  5HWV A;  2PYR A;  4DE0 A;  3GTC A;  3TG9 A;  3D4F A;  4GHI B;  1DY6 A;  3IBJ A;  3ITB A;  4EW7 A;  4DE2 A;  2EXA A;  4KG6 A;  3MXR A;  2PD7 A;  1RP5 A;  4II7 A;  3M2K A;  2XH9 A;  5DJU A;  5A91 A;  3LR4 A;  3M6B A;  4EER A;  3BFC A;  3EWK A;  2Y2G A;  3F1O B;  2V1B A;  4A5R A;  2I72 A;  2Y2Q A;  4ZJ1 A;  3VP2 A;  1CQA A;  4IBR A;  4BBV A;  2GJ3 A;  2H0T A;  1XX2 A;  5CX7 A;  4HNB A;  5DKK A;  2ZL1 A;  1P97 A;  1ONH A;  3PBN A;  4LLO B;  2WYX A;  1OTB A;  3IX4 A;  4E04 A;  3K3C A;  2WK0 A;  3ZHH A;  5EOO A;  5L10 A;  1ERO A;  1VHM A;  2Y2K A;  3IXB A;  1YLZ A;  1KE4 A;  2DRW A;  2WKH A;  3IWO A;  4QY5 A;  1WYB A;  1NRF A;  2Z2L B;  3HLC A;  4RX3 A;  4ETZ A;  1LL8 A;  4PPR A;  2VZW A;  4R6L A;  1K56 A;  1XA1 A;  2WKR A;  3E4P A;  5DFY A;  2WKQ A;  3HL9 A;  5EVI C;  3DBA A;  1K25 A;  2EX6 A;  5DKL A;  3DTK A;  3KSF A;  3MS6 A;  3OBF A;  4YFM A;  5C5K A;  1JWZ A;  3PAE A;  2CC1 A;  1MC0 A;  1PI4 A;  2A24 B;  4X56 A;  3ITA A;  4N9K A;  1IKG A;  1GHI A;  4I3I A;  4KQO A;  4LPZ A;  5M19 A;  3HLB A;  3MFD A;  3S7N A;  1KE3 A;  3CMZ A;  1SDN A;  3HUN A;  4G3W A;  4IVK A;  3N6I A;  1OTI A;  1CK3 A;  3EEH A;  3H82 A;  3ZDJ A;  4KZB A;  3FYZ A;  3VE4 A;  1XJ6 A;  2Z2M B;  4WLA A;  4DJ3 A;  3IXD A;  4EEU A;  3UE0 A;  1ZTU A;  3Q7V A;  1DP6 A;  1IEL A;  3G30 A;  4UAA A;  1UGU A;  2JBF A;  2ZMF A;  4EBP A;  4XXR A;  4E6X A;  2PAV P;  4PM8 A;  3QNB A;  5FQI A;  4JXS A;  2J9P A;  2ZM8 A;  3GV9 A;  3OCL A;  3VOZ A;  4XUZ A;  3B33 A;  3W4P A;  3C8C A;  1NZO A;  2ZM0 A;  3G2Z A;  3KX0 X;  5HPF A;  3GRJ A;  1KVM A;  4EET B;  5TGF A;  3RTY A;  3NJA A;  3H7W B;  2L4R A;  5FAS A;  2OWH A;  3HJI A;  2VV7 A;  2WKP A;  1ONG A;  4QPR A;  4HJ4 A;  1MKI A;  3EGX C;  4UA9 A;  3LIE A;  2LB5 A;  1RGY A;  4BL3 A;  3CZD A;  1SKO B;  1YKD A;  1CF0 A;  5GLA A;  3T4J A;  5EOE A;  1K0K A;  3NDG A;  5G18 A;  4KZ8 A;  4R4R A;  4N92 A;  3N7W A;  3GEC A;  1TS6 A;  1ES2 A;  4JPM A;  3OPP A;  2OLV A;  3UE1 A;  1XPB A;  2O0Y A;  4CLC A;  3NOU C;  3JVU A;  2HF6 A;  4E3M A;  3MMH A;  4JXW A;  1TD5 A;  3NOP C;  1K55 A;  4KZ6 A;  4N1H A;  5DTK A;  2XSS A;  2A24 A;  3RJU A;  2PR6 A;  2VX8 A;  2M7U A;  5CGX A;  2XRO A;  1XFN A;  3S4X A;  1E4D A;  5HZH A;  4ZTK A;  1ZHH B;  4P87 A;  4I39 A;  3UN7 A;  3PBR A;  3S7Q A;  4MBF A;  4GJ4 A;  4OLG A;  1T19 A;  1FCM A;  2ACG A;  3UY6 A;  3V5M A;  3WS0 A;  2PR5 A;  3DTE A;  2H28 A;  3PYP A;  2I9V A;  1ES4 A;  2V1A A;  3UPO A;  4MBH A;  3E2L A;  1IFQ A;  4GKU A;  4EBL A;  4QD4 A;  2PHY A;  3MKE A;  4KUO A;  1WA9 A;  5CXW A;  2BAS A;  3A0R A;  3V3S A;  2RCX A;  3LGO A;  3NBL A;  4U0T A;  2ZOI A;  5CEC A;  2QHK A;  1LLB A;  4E3I A;  3G35 A;  2VLG A;  3HLW A;  2ZQC A;  3CJM A;  4JGO A;  4X53 A;  1YMS A;  2P08 A;  1IYS A;  1CJF A;  2Y91 A;  3ULF A;  3FKW A;  5D3O A;  1YQS A;  3VV4 A;  3N8S A;  4IUH A;  5AQ7 A;  4OPQ A;  2JKT I;  1XJ2 A;  3NDE A;  1BTL A;  2WKI A;  4S2P A;  4GHI A;  3T4O A;  4UA6 A;  2K31 A;  1MZU A;  4HHD A;  2Y59 A;  3GSG A;  3UO9 A;  3IF5 A;  4K91 A;  5E2F A;  5LBR A;  2V1Z A;  3M6H A;  3A0S A;  1SHV A;  2UWX A;  1ES3 A;  4HY8 A;  2VV8 A;  3M2J A;  3U2A A;  3A0V A;  4O01 A;  2VGJ A;  5AQA A;  1MWR A;  3QP4 A;  4FSF A;  3VFH A;  1VEU A;  3RXW A;  1LL5 A;  2BLS A;  3UPP A;  2HZ5 A;  4OKP A;  3GR2 A;  5FI2 A;  1P9W A;  3MZE A;  4KEN B;  4ETX A;  1S67 L;  4OP8 A;  1HTZ A;  3CLO A;  1PZP A;  3GVB A;  4N9L A;  2KOI A;  3LY4 A;  1BSG A;  4MLL A;  2OWJ A;  3BJN A;  4OOL A;  2AVX A;  2M7V A;  3L9K A;  4X55 A;  2XGN A;  1T1C A;  1EI5 A;  4WEK A;  3BM6 A;  3ZG8 B;  4IUK A;  2IWC A;  1ERM A;  4ZDX A;  2Z6D A;  3EEA A;  1VQQ A;  2OAP 1;  4MNR A;  3PAG A;  3BRM A;  1T1B A;  2WAF A;  4E3L A;  5EM0 A;  5F1F A;  4WZ4 A;  3FV7 A;  1PNE A;  5A93 A;  1S6R A;  4ZRR A;  1FOF A;  3PBT A;  4GD6 A;  3BLM A;  1LSW A;  3LEQ A;  2ZLY A;  3H9W A;  5J8X A;  5IHV A;  2HPB A;  5DF7 A;  1PI5 A;  1VB6 A;  4XUX A;  5HPI A;  5M18 A;  2W1T B;  3UE3 A;  4FH4 A;  3UB6 A;  2VGL S;  4RX2 A;  4R23 A;  1MXO A;  4KZ9 A;  4R0Q A;  2B18 A;  1PRQ A;  1LI9 A;  4C6Y A;  1E25 A;  1ES5 A;  3HUM A;  1JVJ A;  4YOF A;  1YLT A;  5GLD A;  3C2W A;  5TJJ A;  1TS8 A;  2JCH A;  5EV0 A;  1IKI A;  1DJA A;  4B88 A; 
#chains in the Genus database with same CATH homology
 4R3A A;  3UB7 A;  1P97 A;  3PBS A;  5HDD A;  3BY8 A;  3PBN A;  1LSX A;  4LLO B;  1OJ5 A;  3R7W B;  1KOU A;  4BBU A;  2L1M A;  1OTB A;  1D06 A;  3P01 A;  3E98 A;  4E04 A;  2JN7 A;  3K3C A;  2W0N A;  1Y28 A;  2GX5 A;  2PT7 A;  2OAQ 1;  1VHM A;  4GLQ A;  3VE3 A;  3UME A;  5MC7 A;  3LYX A;  4BJP A;  4ETZ A;  1BYW A;  1LL8 A;  2KX6 A;  2VZW A;  1W63 M;  4R6L A;  2WKR A;  5I5L A;  4PKY G;  2QWS A;  2NUT C;  3E4P A;  5DFY A;  4ARZ B;  2WKQ A;  5F5Y A;  3KSG A;  3DBA A;  2O9B A;  5DKL A;  2XA7 S;  4H6J A;  3KSF A;  1P0Z A;  4HIA A;  3HJK A;  4XT2 B;  3OBF A;  4L9F A;  4UQI S;  5C5K A;  5KIZ A;  1MC0 A;  2A24 B;  5AVE A;  2VGL M;  4HOI A;  4JGP A;  1OPX A;  4YNR A;  4MN6 A;  4I3I A;  4KQO A;  4NXE A;  4LPZ A;  3LI9 A;  1T18 A;  2VA0 A;  3LR0 A;  4WEJ A;  3G6O A;  3S7N A;  1TF1 A;  2D02 A;  2OOL A;  3CUE A;  4HH3 A;  4MN7 A;  4G3W A;  1F5M A;  2P7J A;  1OTI A;  3IS2 A;  3ZQ5 A;  2PDR A;  3EEH A;  3F1N A;  3T50 A;  3H82 A;  3VE4 A;  3BWL A;  1XJ6 A;  2VKS A;  5F69 A;  4B9O A;  4WLA A;  4DJ3 A;  3D72 A;  3MFX A;  4I3A A;  4EES A;  4EEU A;  4B93 A;  4EEP A;  1ZTU A;  5J7E A;  1DP6 A;  2W1R A;  5AVF A;  3F1O A;  4Z1W A;  1UGU A;  1TS0 A;  2QJ5 A;  2ZMF A;  4R70 A;  4CLC C;  3LID A;  3CUE C;  2EWV A;  5KSH A;  3MR0 A;  1F9I A;  1DP8 A;  2QKP A;  3OCL A;  1T1A A;  3PHY A;  4NKP A;  1V9Y A;  3LIB A;  4Y2F A;  3EGD C;  3B33 A;  3PXP A;  1ODV A;  3C8C A;  5HPF A;  2GNX A;  3KX0 X;  1XJ4 A;  2QJ7 A;  2D01 A;  4EET B;  3ZYT A;  3RTY A;  3NJA A;  3F1P A;  3K2N A;  3H7W B;  4ME4 A;  2L4R A;  5J4E A;  3F1P B;  3R7W A;  4JGR A;  2OWH A;  1H3Q A;  3HJI A;  4WUJ A;  2VV7 A;  4XT2 A;  3KSH A;  3H7W A;  2KLI A;  1S66 L;  2WKP A;  4QPR A;  2O99 A;  4HJ4 A;  3UE6 A;  4M4X A;  3OLO A;  3R4K A;  1N9O A;  3NOT C;  3FPW A;  2Z6C A;  1S1Z A;  5TBM B;  1LSV A;  3EGX C;  2FZ0 A;  3LIE A;  2VEA A;  2LB5 A;  3B47 A;  1YKD A;  4GS9 A;  4GCZ A;  4MMN A;  2EWW A;  2QYB A;  3T4J A;  3CAX A;  1OT9 A;  2W27 A;  4RQ9 A;  2K7S A;  1S4R A;  4HH2 A;  2XRN A;  3VOL A;  1DP9 A;  4H6J B;  4PKY A;  5HSQ A;  2IA2 A;  3MXQ A;  1V9Z A;  4UEY A;  3LI8 A;  1GSV A;  3EQV A;  5HDC A;  3BQA A;  3GEC A;  4NXB A;  4DMZ A;  4KUK A;  4NXG A;  1TS6 A;  4G3V A;  1OT6 A;  2INW A;  4L0L A;  3TRC A;  4Y3I A;  2O9C A;  1S1Y A;  4WN5 A;  3LIC A;  2O0Y A;  4CLC A;  2Y79 A;  3TJZ C;  4EUV A;  3NOU C;  3JVU A;  5HD5 A;  3T4K A;  2HF6 A;  3KO6 A;  2L0W A;  3MMH A;  2KDK A;  1TD5 A;  3NOP C;  3ICY A;  4MDZ A;  2XSS A;  2A24 A;  2PR6 A;  2VX8 A;  2W3H A;  2HJE A;  2M7U A;  4F3L A;  4I5S A;  2XRO A;  1XFN A;  5HZH A;  1UWN X;  1ZHH B;  4I39 A;  4IJG A;  3PBR A;  3S7Q A;  3GDI A;  3E4Q A;  3T4S A;  1STZ A;  3T4Q A;  1TS7 A;  4GJ4 A;  3S7P A;  1T19 A;  2W1T A;  2A2L A;  2PR5 A;  2H28 A;  3PYP A;  2I9V A;  2V1A A;  1X0O A;  4AFI A;  1IFQ A;  1YSP A;  5AJG A;  4HP9 A;  3E0Y A;  3MQO A;  4O0P A;  2PHY A;  4NXF A;  4KUO A;  1WA9 A;  2BAS A;  4GS9 B;  5EFW A;  3O5Y A;  3CIT A;  3A0R A;  3MJQ A;  2VV6 A;  5G4Z A;  2XA7 M;  3PBO A;  2P04 A;  3PR6 A;  1NLY A;  2EA9 A;  1D7E A;  4CLC E;  2PD8 A;  2ZOI A;  4UQI M;  3T4T A;  2W3F A;  3K3D A;  5HDS A;  3EQU A;  5HL6 A;  4Y5F A;  2QHK A;  4LRZ E;  2J3W A;  4PAU A;  3W2Z A;  3BW6 A;  2VLG A;  3KSI A;  3LIA A;  3MQ0 A;  4MN5 A;  5IT5 A;  4I38 A;  1NLZ A;  3LUQ A;  3E4O A;  4JGO A;  3TE8 A;  4EQ1 A;  4Q0J A;  2P08 A;  2Y8H A;  3TW8 A;  1G6O A;  1S4S A;  3C38 A;  5HWT A;  3ULF A;  2YKF A;  4K08 A;  1G28 A;  5DJT A;  3BY9 A;  3VV4 A;  4IUH A;  2G7U A;  4F3L B;  2JKT I;  1XJ2 A;  2GZA A;  4CQH A;  3HCY A;  2V9A A;  4GHI A;  1OTD A;  4HJ6 A;  3T4O A;  2K31 A;  5DFX A;  2LB9 A;  4BBT A;  2W3E A;  2MJ6 A;  4ARZ A;  1MZU A;  1NRJ A;  4HHD A;  4O8G A;  5DF9 A;  3IS2 B;  3RFB A;  3S7O A;  5L8M A;  4IHQ A;  1DRM A;  5HD3 A;  2FH5 A;  4KQD A;  2JKR I;  5LBR A;  5J3W A;  5IU1 A;  4R38 A;  3A0S A;  4NEE D;  3KYQ A;  3P7N A;  1MKM A;  4L9E A;  5K5B A;  4HY8 A;  2VV8 A;  2HV1 A;  3FC7 A;  4JGQ A;  3U2A A;  3A0V A;  4O01 A;  3B42 A;  4G3K A;  5F68 A;  2DMW A;  4HP4 A;  2J3T C;  4FSF A;  3OOV A;  3H82 B;  1EW0 A;  3MF0 A;  3LR3 A;  2V0U A;  3SW1 A;  4DJ2 A;  3LR5 A;  3EOI A;  3UMD A;  4WL9 A;  2K2N A;  5TBM A;  1N9L A;  4P6Z S;  2HGV A;  1GSX A;  1P9W A;  3BQ8 A;  1IOU A;  2W3G A;  5IS1 A;  4ETX A;  1S67 L;  4P6Z M;  4LRY C;  3CLO A;  3JVV A;  2JKR M;  2J80 A;  2CMN A;  3MQQ A;  2KOI A;  2ZBB A;  3LIF A;  3OCN A;  3PBQ A;  4EXO A;  1YAX A;  2J3T D;  4MCW A;  2OWJ A;  1F98 A;  1NWZ A;  3BJN A;  4OOL A;  2M7V A;  3CI6 A;  1YSQ A;  2PYP A;  1JNU A;  4EU0 A;  4DN0 A;  4GW9 A;  4BMW A;  3FPV A;  4YWZ A;  1N9N A;  3NHQ A;  1T1C A;  4WEK A;  5F6A A;  3T4L A;  2HJ9 C;  4IUK A;  2JKT M;  2ZOH A;  5G4Y A;  1H8M A;  2Z6D A;  3EEA A;  1OTE A;  2OAP 1;  4HI4 A;  4CLC D;  1T1B A;  4BWI A;  3LFV A;  4Q0H A;  4I3J A;  5A8B A;  1W63 Q;  3UB9 A;  2YKH A;  3C30 A;  2M1C A;  3CWF A;  1XJ3 A;  4L9G A;  4ZRR A;  4LRX C;  3PBT A;  5FL3 A;  1LSW A;  2W3D A;  3IBR A;  5HWV A;  1XFQ A;  2PYR A;  3H9W A;  2O9A A;  3KYZ A;  3FG8 A;  4FOF A;  4GHI B;  1VB6 A;  3D3O A;  3IBJ A;  1OTA A;  5HPI A;  4EW7 A;  2W1T B;  2NUP C;  3RH8 B;  3UE3 A;  3V67 A;  1GSW A;  4Q0I A;  2VGL S;  3UB6 A;  3OC2 A;  2VJW A;  1LT0 A;  4WF0 A;  1OJG A;  2PD7 A;  4II7 A;  2B18 A;  4HQA A;  1UWP X;  5DJU A;  2V0W A;  3LR4 A;  4EER A;  4YOF A;  3EWK A;  2R78 A;  5HWW A;  3F1O B;  2JHE A;  2V1B A;  3F1N B;  3UB8 A;  2ZMV A;  4OOM A;  2B02 A;  1P9R A;  3C2W A;  4WEL A;  5TJJ A;  4CLC B;  1TS8 A;  4HJ3 A;  4BBV A;  2GJ3 A;  5CX7 A;  4PHT A;  4HNB A;  5DKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...