2I9XA

Structural genomics, the crystal structure of spovg conserved domain from staphylococcus epidermidis atcc 12228
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
NAMKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative septation protein spoVG
publication title The crystal structure of SpoVG from Staphylococcus epidermidis ATCC 12228
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
total genus 14
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04026 SpoVG SpoVG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.40 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Stage V sporulation protein G 2i9xA00
2I9ZA 2IA9A 2I9XA
chains in the Genus database with same CATH superfamily
1Q4KA 4NKBA 3P37A 4N7VA 4NK7A 4CXKA 5DMSA 3HIHA 4CXUA 2OGQA 4X9WA 4G7NA 4O56A 4WHKA 5LHZA 5AJ9A 4YYPA 3RQ7A 3C5LA 3P34A 4E67A 2IA9A 3Q1IA 4CXSA 4RS6A 1Q4OA 3FVHA 4FDIA 3BZIA 3P2ZA 3HMJG 4X9VA 5DNJA 4CYSA 1E1ZP 2N19A 4FDJA 5DMVC 4H71A 4CYRA 3GYVA 4WHLA 3HIKA 2QZUA 4XB0A 4E9DA 4LKLA 3KDRA 4WHHA 4LKMA 1E33P 1F34B 3FS3A 1P49A 2OJXA 4N9JA 4O6WA 3P35A 1HDHA 2VKZG 4E9CA 3LM3A 2UV8G 1N2KA 4RCPA 3LXQA 1E2SP 1A87A 1E2TA 3GYWA 1E3CP 1N2LA 4X9RA 4O9WA 2E50A 3HFDA 4DFWA 3P36A 5J19A 1F32A 1FSUA 1UMWA 2I9XA 1AUKA 4N7ZA 2I9ZA 4HCOA 3ED4A 3P2WA 4J7BB 5DAYA 4HY2A 4H5XA 4HABA
chains in the Genus database with same CATH topology
2I9ZA 2IA9A 2I9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9Z A;  2IA9 A;  2I9X A; 
#chains in the Genus database with same CATH topology
 1Q4K A;  4NKB A;  3P37 A;  4N7V A;  4NK7 A;  4CXK A;  5DMS A;  3HIH A;  4CXU A;  2OGQ A;  4X9W A;  4G7N A;  4O56 A;  4WHK A;  5LHZ A;  5AJ9 A;  4YYP A;  3RQ7 A;  3C5L A;  3P34 A;  4E67 A;  2IA9 A;  3Q1I A;  4CXS A;  4RS6 A;  1Q4O A;  3FVH A;  4FDI A;  3BZI A;  3P2Z A;  3HMJ G;  4X9V A;  5DNJ A;  4CYS A;  1E1Z P;  2N19 A;  4FDJ A;  5DMV C;  4H71 A;  4CYR A;  3GYV A;  4WHL A;  3HIK A;  2QZU A;  4XB0 A;  4E9D A;  4LKL A;  3KDR A;  4WHH A;  4LKM A;  1E33 P;  1F34 B;  3FS3 A;  1P49 A;  2OJX A;  4N9J A;  4O6W A;  3P35 A;  1HDH A;  2VKZ G;  4E9C A;  3LM3 A;  2UV8 G;  1N2K A;  4RCP A;  3LXQ A;  1E2S P;  1A87 A;  1E2T A;  3GYW A;  1E3C P;  1N2L A;  4X9R A;  4O9W A;  2E50 A;  3HFD A;  4DFW A;  3P36 A;  5J19 A;  1F32 A;  1FSU A;  1UMW A;  2I9X A;  1AUK A;  4N7Z A;  2I9Z A;  4HCO A;  3ED4 A;  3P2W A;  4J7B B;  5DAY A;  4HY2 A;  4H5X A;  4HAB A; 
#chains in the Genus database with same CATH homology
 2I9Z A;  2IA9 A;  2I9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...