2I9XA

Structural genomics, the crystal structure of spovg conserved domain from staphylococcus epidermidis atcc 12228
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
NAMKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of SpoVG from Staphylococcus epidermidis ATCC 12228
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
molecule keywords Putative septation protein spoVG
total genus 14
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04026 SpoVG SpoVG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.40 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Stage V sporulation protein G 2i9xA00
2I9XA 2IA9A 2I9ZA
chains in the Genus database with same CATH superfamily
4HCOA 4WHKA 4CXKA 4H71A 4FDIA 2OGQA 3P34A 4N7ZA 5DAYA 4XB0A 4WHLA 4LKMA 3P2ZA 3LM3A 1E2TA 4WHHA 3P35A 2VKZG 4X9WA 1HDHA 4N9JA 2UV8G 3FS3A 4LKLA 4N7VA 2N19A 4X9VA 5DMSA 2OJXA 4X9RA 4CXUA 2E50A 1E1ZP 3C5LA 2I9XA 4NK7A 3LXQA 4RCPA 2QZUA 3P37A 4CYRA 3HFDA 2IA9A 4YYPA 3FVHA 1N2KA 5DNJA 5J19A 1AUKA 5AJ9A 1Q4KA 3HMJG 1E2SP 4O6WA 1N2LA 4HY2A 4O56A 5LHZA 1E33P 3P2WA 1Q4OA 4J7BB 4E9CA 3ED4A 1F32A 3HIKA 4G7NA 4CYSA 4RS6A 4E67A 4E9DA 3HIHA 3BZIA 1P49A 4H5XA 1F34B 3GYWA 3KDRA 3P36A 1E3CP 4NKBA 1UMWA 2I9ZA 3Q1IA 1A87A 4FDJA 4O9WA 4HABA 3RQ7A 4CXSA 3GYVA 1FSUA 4DFWA 5DMVC
chains in the Genus database with same CATH topology
2I9XA 2IA9A 2I9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9X A;  2IA9 A;  2I9Z A; 
#chains in the Genus database with same CATH topology
 4HCO A;  4WHK A;  4CXK A;  4H71 A;  4FDI A;  2OGQ A;  3P34 A;  4N7Z A;  5DAY A;  4XB0 A;  4WHL A;  4LKM A;  3P2Z A;  3LM3 A;  1E2T A;  4WHH A;  3P35 A;  2VKZ G;  4X9W A;  1HDH A;  4N9J A;  2UV8 G;  3FS3 A;  4LKL A;  4N7V A;  2N19 A;  4X9V A;  5DMS A;  2OJX A;  4X9R A;  4CXU A;  2E50 A;  1E1Z P;  3C5L A;  2I9X A;  4NK7 A;  3LXQ A;  4RCP A;  2QZU A;  3P37 A;  4CYR A;  3HFD A;  2IA9 A;  4YYP A;  3FVH A;  1N2K A;  5DNJ A;  5J19 A;  1AUK A;  5AJ9 A;  1Q4K A;  3HMJ G;  1E2S P;  4O6W A;  1N2L A;  4HY2 A;  4O56 A;  5LHZ A;  1E33 P;  3P2W A;  1Q4O A;  4J7B B;  4E9C A;  3ED4 A;  1F32 A;  3HIK A;  4G7N A;  4CYS A;  4RS6 A;  4E67 A;  4E9D A;  3HIH A;  3BZI A;  1P49 A;  4H5X A;  1F34 B;  3GYW A;  3KDR A;  3P36 A;  1E3C P;  4NKB A;  1UMW A;  2I9Z A;  3Q1I A;  1A87 A;  4FDJ A;  4O9W A;  4HAB A;  3RQ7 A;  4CXS A;  3GYV A;  1FSU A;  4DFW A;  5DMV C; 
#chains in the Genus database with same CATH homology
 2I9X A;  2IA9 A;  2I9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...