2I9XA

Structural genomics, the crystal structure of spovg conserved domain from staphylococcus epidermidis atcc 12228
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
NAMKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative septation protein spoVG
publication title The crystal structure of SpoVG from Staphylococcus epidermidis ATCC 12228
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
total genus 14
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04026 SpoVG SpoVG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.40 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Stage V sporulation protein G 2i9xA00
2I9ZA 2IA9A 2I9XA
chains in the Genus database with same CATH superfamily
4CXSA 3ED4A 2I9ZA 4NK7A 1F34B 4E9DA 5DMVC 4WHLA 4FDJA 4RS6A 3HMJG 1AUKA 4E9CA 5LHZA 1FSUA 3C5LA 4CXKA 3HIHA 4HY2A 4H71A 5J19A 3FVHA 4LKMA 4FDIA 3P34A 4O9WA 4HABA 4YYPA 4H5XA 1Q4OA 5DAYA 4CYRA 1N2KA 1E33P 3P2WA 3HIKA 2UV8G 3GYWA 1A87A 5AJ9A 4O6WA 4N9JA 3P35A 1Q4KA 4XB0A 1P49A 4CXUA 1E3CP 2IA9A 4CYSA 4HCOA 2QZUA 4O56A 1F32A 3P37A 3LXQA 5DMSA 3P36A 4E67A 2E50A 4G7NA 4WHKA 1E1ZP 5DNJA 2N19A 2OJXA 4J7BB 4X9VA 3GYVA 1E2SP 4X9WA 4X9RA 2OGQA 1UMWA 3P2ZA 4WHHA 4DFWA 3LM3A 2VKZG 4N7VA 3FS3A 1E2TA 2I9XA 3BZIA 4LKLA 4NKBA 4N7ZA 3Q1IA 1N2LA 3HFDA 3RQ7A 3KDRA 4RCPA 1HDHA
chains in the Genus database with same CATH topology
2I9ZA 2IA9A 2I9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9Z A;  2IA9 A;  2I9X A; 
#chains in the Genus database with same CATH topology
 4CXS A;  3ED4 A;  2I9Z A;  4NK7 A;  1F34 B;  4E9D A;  5DMV C;  4WHL A;  4FDJ A;  4RS6 A;  3HMJ G;  1AUK A;  4E9C A;  5LHZ A;  1FSU A;  3C5L A;  4CXK A;  3HIH A;  4HY2 A;  4H71 A;  5J19 A;  3FVH A;  4LKM A;  4FDI A;  3P34 A;  4O9W A;  4HAB A;  4YYP A;  4H5X A;  1Q4O A;  5DAY A;  4CYR A;  1N2K A;  1E33 P;  3P2W A;  3HIK A;  2UV8 G;  3GYW A;  1A87 A;  5AJ9 A;  4O6W A;  4N9J A;  3P35 A;  1Q4K A;  4XB0 A;  1P49 A;  4CXU A;  1E3C P;  2IA9 A;  4CYS A;  4HCO A;  2QZU A;  4O56 A;  1F32 A;  3P37 A;  3LXQ A;  5DMS A;  3P36 A;  4E67 A;  2E50 A;  4G7N A;  4WHK A;  1E1Z P;  5DNJ A;  2N19 A;  2OJX A;  4J7B B;  4X9V A;  3GYV A;  1E2S P;  4X9W A;  4X9R A;  2OGQ A;  1UMW A;  3P2Z A;  4WHH A;  4DFW A;  3LM3 A;  2VKZ G;  4N7V A;  3FS3 A;  1E2T A;  2I9X A;  3BZI A;  4LKL A;  4NKB A;  4N7Z A;  3Q1I A;  1N2L A;  3HFD A;  3RQ7 A;  3KDR A;  4RCP A;  1HDH A; 
#chains in the Genus database with same CATH homology
 2I9Z A;  2IA9 A;  2I9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...