2I9ZA

Structural genomics, the crystal structure of full-length spovg from staphylococcus epidermidis atcc 12228
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETDEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal structure of SpoVG from Staphylococcus epidermidis ATCC 12228
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
molecule keywords Putative septation protein spoVG
total genus 11
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04026 SpoVG SpoVG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.40 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Stage V sporulation protein G 2i9zA00
2I9XA 2IA9A 2I9ZA
chains in the Genus database with same CATH superfamily
1UMWA 4NK7A 4HABA 1P49A 4X9VA 5LHZA 4NKBA 2E50A 5AJ9A 4CYRA 3LM3A 3HIKA 4CXUA 4G7NA 1FSUA 2QZUA 1E2TA 2N19A 3RQ7A 3P34A 5DAYA 1F32A 3HIHA 4LKLA 4E67A 3HFDA 4RS6A 2OGQA 1F34B 3GYVA 4X9RA 4CXSA 5DNJA 4N7ZA 4WHHA 4YYPA 4E9CA 4J7BB 4H71A 4HY2A 5DMVC 4O6WA 4N7VA 4CXKA 2UV8G 1E1ZP 1Q4KA 4FDIA 4CYSA 3P2WA 3P35A 4X9WA 2I9XA 3GYWA 1N2KA 5J19A 3KDRA 4HCOA 1E2SP 3FS3A 4FDJA 2VKZG 4WHLA 4N9JA 3P36A 3P37A 3C5LA 3P2ZA 4E9DA 1E33P 4WHKA 1AUKA 1A87A 4O56A 3HMJG 4DFWA 5DMSA 4H5XA 4XB0A 4LKMA 3FVHA 1N2LA 3LXQA 3ED4A 4O9WA 1E3CP 2OJXA 1HDHA 3Q1IA 1Q4OA 2IA9A 3BZIA 4RCPA 2I9ZA
chains in the Genus database with same CATH topology
2I9XA 2IA9A 2I9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9X A;  2IA9 A;  2I9Z A; 
#chains in the Genus database with same CATH topology
 1UMW A;  4NK7 A;  4HAB A;  1P49 A;  4X9V A;  5LHZ A;  4NKB A;  2E50 A;  5AJ9 A;  4CYR A;  3LM3 A;  3HIK A;  4CXU A;  4G7N A;  1FSU A;  2QZU A;  1E2T A;  2N19 A;  3RQ7 A;  3P34 A;  5DAY A;  1F32 A;  3HIH A;  4LKL A;  4E67 A;  3HFD A;  4RS6 A;  2OGQ A;  1F34 B;  3GYV A;  4X9R A;  4CXS A;  5DNJ A;  4N7Z A;  4WHH A;  4YYP A;  4E9C A;  4J7B B;  4H71 A;  4HY2 A;  5DMV C;  4O6W A;  4N7V A;  4CXK A;  2UV8 G;  1E1Z P;  1Q4K A;  4FDI A;  4CYS A;  3P2W A;  3P35 A;  4X9W A;  2I9X A;  3GYW A;  1N2K A;  5J19 A;  3KDR A;  4HCO A;  1E2S P;  3FS3 A;  4FDJ A;  2VKZ G;  4WHL A;  4N9J A;  3P36 A;  3P37 A;  3C5L A;  3P2Z A;  4E9D A;  1E33 P;  4WHK A;  1AUK A;  1A87 A;  4O56 A;  3HMJ G;  4DFW A;  5DMS A;  4H5X A;  4XB0 A;  4LKM A;  3FVH A;  1N2L A;  3LXQ A;  3ED4 A;  4O9W A;  1E3C P;  2OJX A;  1HDH A;  3Q1I A;  1Q4O A;  2IA9 A;  3BZI A;  4RCP A;  2I9Z A; 
#chains in the Genus database with same CATH homology
 2I9X A;  2IA9 A;  2I9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...