2IAAC

Crystal structure of an electron transfer complex between aromatic amine dephydrogenase and azurin from alcaligenes faecalis (form 2)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
b'ACDVSIEGNDSMQFNTKSIVVDKTCKEFTINLKHTGKLPKAAMGHNVVVSKKSDESAVATDGMKAGLNNDYVKAGDERVIAHTSVIGGGETDSVTFDVSKLKEGEDYAFFCSFPGHWSIMKGTIELGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic Amine Dehydrogenase
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 30
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2iaaC00
4N4YB 1A3ZA 1CUOA 1VLXA 4A2FA 4A67A 4YSPA 3T6ZA 3EH4B 3RYMA 1ZV2A 2HRHA 1XB8A 1MZYA 3L45A 2EIMB 3OQRA 1JZFA 4E9RA 2FT8A 1GSKA 2X87A 2AVFA 3S8FB 4HHWA 3UABA 4G70B 1CURA 4Q89A 3GDCA 2ZXWB 3C75A 3ABKB 3IEAA 3FQ1A 2VSMB 3V9CA 3EF4A 1OCCB 2ZOOA 3ASNB 1NIDA 3NJMA 1V10A 1OCOB 1ETJA 1WS8A 1F56A 1NINA 2PP7A 3ABLB 1AG6A 2EILB 3UGEA 2YAMA 2QDWA 1BQRA 2UXTA 1UATA 4L0PB 1AZBA 7PAZA 2XX1A 1PZCA 4HALA 3AG1B 1ET8A 2BP8B 2VM3A 2B08A 1WAEA 4P5RA 4UANA 3T6WA 1DZ0A 3NYKA 5E9NA 4AI7A 1BQ5A 2YARA 4UF7C 5I6KA 3GYRA 1A4BA 1HAUA 1PY0A 1AR1B 2JFCA 1SDDB 4ZK8A 2PP9A 4QLWA 1PLCA 1CC3A 1CYWA 4E9XA 7PCYA 4F2FA 1AS8A 3SBPA 2BHFA 4YSRA 1PLAA 1ILSA 3NJKA 3PPSA 3TBCA 2BP8A 5AZUA 2GSMB 1EHKB 1PZBA 6PAZA 1GY1A 1NIEA 4GP8B 1WS7A 1JZJA 4A2HA 3DTUB 2P80A 2UXFA 4YSCA 5B1JC 2GBAA 3NJHA 1A4CA 2PP8A 1ADWA 4G71B 4HAKA 4BWTA 1A8ZA 2YAFA 2HXAA 1PCSA 1ZDQA 3ZIYA 5TK2A 5TK4A 1ASPA 1WA2X 3ABGA 2DWTA 4DP5X 2DWSA 4DPBX 4FAAB 1ASQA 2EINB 2HX7A 1JXDA 4YSAA 2GIMA 1AACA 2IH9A 3QPKA 2HX9A 2ZWNA 3OMIB 1L9PA 1GR7A 1OOWA 1N68A 1BXVA 1J9QA 2BW5A 2DYSB 4M3HA 1E67A 2QPEB 1OCRB 3G5WA 3WKPA 2DY2A 2TSAA 1ET5A 2CUAA 1TU2A 3SQRA 3TBBA 2XV3A 2Q5BA 1NDTA 4DP7X 3ZDWA 2BP0B 4WTQA 1JXGA 5B3SB 3AY2A 3NJIA 1SJMA 4N8UA 2AANA 4E9QA 1JOIA 3FSAA 2AFNA 2RACA 1OF0A 1J9TA 4E9YA 2PPFA 2WO3B 1IC0A 1RCYA 1SFDA 4JHUA 2AZUA 4YVNA 2B3IA 2FQGA 3IBOA 4BDVA 2R7EA 1R1CA 2P80D 2VMJA 1L9QA 1RZQA 1L9SA 2I7SA 3X1FA 1X9UA 4Q8BA 1I53A 3JTBA 1TKWA 4E9SA 2PPAA 1W8EA 1J9RA 1PZAA 3KW7A 1AOZA 1NPNA 4YSUA 3N55A 1NPJA 2GHZA 4YSSA 2UXVA 2OJ1A 2XUWA 4BWUA 4ENZA 1M57B 5A7EA 2IWKA 4AKPA 1SHXA 2Y1AA 3S3CB 1XB6A 1PF3A 1W6WA 3NP4A 3FT0A 1BEXA 4HCIA 2DYRB 1OE3A 4HIPA 3X1BA 1A4AA 3DKHA 1MG2C 1ASOA 4G7QB 4AX3A 1RZPA 4JHVA 5IY5B 4A66A 2H5UA 4KO5A 4EF3A 1NIBA 2FQFA 3NSDA 1URIA 3ERXA 2PLTA 4MFHA 3WKQA 4AKQA 3AG3B 4GYBA 2N0MA 3FS9A 1L9OA 3V9EA 3PLYA 1V54B 2FTAA 1GS7A 4KO7A 5B7EA 4KO6A 4DPAX 3GXUB 5I26A 3FSWA 1QHQA 1JZIA 1L9TA 1V55B 3FQYA 5F7AA 4KOBA 2UX7A 3FSVA 3QQXA 3FYEB 2MTAA 5B1AB 3X1GA 2FQEA 5I6OA 1OE1A 2CBPA 3FQ2A 1SF3A 3SBQA 1IBYA 3D12B 2BWDA 4YSDA 1KYAA 2YAQA 4TXVB 1OE2A 2YAPA 3NSCA 3QJRB 1L9RA 3WI9A 4CSZA 5AFAA 2JXMA 1BAWA 4P5SA 3PAVA 3PAZA 3CDZB 4BWWA 1YLBB 1HFUA 2IWFA 2E86A 3S3DB 2LLNA 1ILUA 2J55A 3OMAB 4WKXA 3FU7B 5AKRA 3X2QB 2HLEB 1SHWA 1SDDA 4E9WA 4RH4A 3NJFA 3UAEA 3PAUA 2QDVA 4KNUA 3BVDB 4YVUA 3N2JA 3CVDA 1J5DA 5ANHA 1IBZA 4X4KA 1KBVA 3KW8A 4A2GA 4DPCX 1KBWA 1AZUA 3CG8A 4E9VA 1JVLA 3CVCA 3S3BB 1GS6X 3QJUB 1NICA 3SBRA 3MBWB 1XMEB 5LDUA 2J5WA 3AG4B 5I5IA 2VW6A 5F7BA 1E5YA 2W88A 3ABMB 4DP8X 1KDJA 1JVOA 1A65A 1FWXA 1ZPUA 3ZX1A 5D4IA 1DYZA 2YQBA 2CALA 2VN3A 2GB2A 2UX6A 1NZRA 5PAZA 4G7RB 2IAAC 1AG0A 1JZEA 3TU6A 4E9TA 4BXSV 4GP4B 3UACA 2XXGA 1M9WA 1PMYA 2Y69B 4PAZA 1N70A 2GC4C 4KNTA 4BK5C 1J9SA 1ZDSA 4DP1X 1OCZB 5B7MA 4YSOA 4CSPA 2HRGA 2FQDA 2VW4A 1AZRA 2BWIA 3AZUA 2FT7A 3CVBA 5D4HA 3DIVA 3ZBMA 4FA7B 2WO2B 2BP0A 1GW0A 5B1KA 5PCYA 3WNJA 1GS8A 1KGYE 1WA0X 1BYPA 2I7OA 1QNIA 2IDQA 4F7KA 4YSTA 1BXAA 5B1JA 1FA4A 3NJLA 1AS6A 2J57A 4PCYA 2A3TA 2OCCB 4HZ1A 2XXFA 3H4HA 4G7SB 5I6PA 1RKRA 2GI0A 3IE9A 2FWLB 4NB7A 2YXVA 2EIJB 5D4JA 2PPEA 2HZHA 4DP2X 3AW5A 1XB3A 3NT0A 3NJGA 2XLLA 3TASA 2IDTA 3EH5B 1GY2A 2PPDA 1E65A 3QJSB 4YSQA 2CJ3A 4UAHA 3IN2A 2W8CA 1AANA 2TSBA 1JZHA 2XWZA 3NSFA 5B7FA 2WSDA 2XYBA 1EZLA 3OMNB 1BXUA 3HB3B 2DV6A 2JKWA 1ZIAA 3OD3A 4W9ZA 1AZCA 2MRYA 3TA4D 4A68A 1CYXA 1B3IA 4HCFA 4KO9A 4W1TA 1SFHA 2XVBA 3OM3B 4JKNA 5I6NA 1AQ8A 1KDIA 1MZZA 1ZIBA 3NJJA 4M4RB 1AIZA 1T5KA 2QPDB 3EHBB 2BO0A 2IDSA 1TEGA 3U25A 2HX8A 3UAAA 3BQVA 3WIAA 1JXFA 3H4FA 1JZGA 3FYIB 4KNSA 2YAHA 3PCYA 1AAJA 1NTDA 5I5MA 2BZCA 3QJQB 5I6MA 3H56A 1E5ZA 3FU9A 1KV7A 2IH8A 4DP4X 1ID2A 3UADA 1BQKA 1OV8A 2PCYA 1X9RA 2VM4A 3NSYA 1NIFA 2BW4A 1KCBA 1PNCA 1MDAA 3X1EA 2PCFA 4GXFA 5B1BB 2FNWA 4HHGA 5I5JA 2CAKA 1AS7A 3CDZA 2AZAA 2NRDA 2QT6A 3T9WA 1PLBA 2XX0A 3FPYA 3JT2A 4YSEA 3FU7A 2H3XC 3FU8A 2OV0A 1HAWA 4DP9X 1E30A 1WA1X 1IUZA 2X88A 3WNIA 4GY4A 2EIKB 3T6XA 2YAOA 1M56B 3NJNA 1GYCA 1FFTB 1SF5A 8PAZA 3NP3A 5I28A 2FT6A 3IN0A 3FSZA 4AZUA 3X1NA 9PCYA 2VSKB 3FPXA 3CZUB 2PPCA 2XV2A 2ZONA 3WG7B 3PXLA 4NAJA 4AKOA 6PCYA 1KCWA 5I6LA 4K9JA 2UXGA 1BYOA 1JERA 2R7EB 4BDVB 4A2EA 1PNDA 1NIAA 2FJSA 2IWEA 1PAZA 3ASOB 1MG3C 1W6LA 4DP6X 1J5CA 2YAEA 4GP5B 3EH3B 4F2EA 2XU9A 3MX0B 3AG2B 4KOCA 2IDFA 1IKOP 3QJVB 2IDUA 2H47C 1AZNA 1QLEB 3S8GB 1NWPA 4G72B 2VW7A 4QKTA 4YL4A 1ET7A 2GC7C 4HCGA 2BZ7A 2YXWA 4A2DA 3T6VA 5FC9A 1SNRA 3HEIB 2Q9OA 5EHFA 2I85A 4BXVA 2CCWA 1TEFA 2J56A 1NWOA 3QJTB 3T71A 4NERA 2XV0A 4DP0X
chains in the Genus database with same CATH superfamily
1Q9LB 1FG2B 4A6YL 1E4WL 2F1EA 4JANA 2GJ6E 1MJUH 1A02N 4I77H 4X0KB 4F3FB 4FHBD 4KK9C 3DYOA 4N22A 5DHVH 2V17L 1D5MA 3DX6B 5IB1A 1IBHA 3L45A 2AXFB 4HIEA 3OQRA 4OCWL 4PS8A 4WSKA 5IOPA 3I3EA 2EDJA 3IGAB 3IJHB 4JFZH 5JW4R 3KYMA 4XH2A 1AGBB 1CDIA 4G70B 4LCIL 1O7DE 3D69A 1T5WB 2VN6A 1YA5A 3VXUB 1XX9C 4OVUA 3DO4A 1QBAA 2FEDC 3UZEC 4FG6C 5EWIL 2ZQKA 1RQ5A 3QW9A 3EYFA 1ULVA 2A73B 2HSIA 3A67H 4PU2A 4KDTC 1E4XH 1G1YA 3BPOC 1KCLA 4MJID 1MCDA 3GBNH 3RGHA 12E8L 2ZSVB 1SMDA 5DJ6B 3UO1L 4P5TB 5GISH 4FTVA 1KULA 2VLRA 4GUOA 1JG9A 2PXYA 1K85A 5GS2D 1TTGA 1NBYA 2NR6D 3BGMB 2WLLB 4NQSB 4UIKH 3Q2NA 5CILH 2ZYIA 1JD9A 5DYOB 4QAMB 4HIQA 4WJKB 4R83A 4W4OA 4NAMA 2IADA 1YEJL 2BY0A 4DZBB 1AQMA 1S3RA 1FZOA 3LNEA 5EEWA 1JXJA 3OKMB 5GZND 3SE4C 1UA6L 5IJVB 2A9ML 2WBJD 1CF8L 3ZDZE 4J3VA 1A8JH 2VRAA 4K7PX 4WHYG 4G9DA 4Q2ZA 4UILL 4AGNA 1AD9A 3N1QC 4HGWA 1NMBL 3MLRH 3EGSB 4Y7MA 1CFTB 1RI8A 2BLFA 2VR6A 4NNYA 2E27H 2Z7ZA 2XZAH 2IMMA 4JDZB 1A6UL 2UXFA 4XP9H 3O6KL 3MRRA 2E7HA 1Y07A 5H37A 5LAXA 3T04D 4LKCA 1FVEA 1I1YA 1IGML 4BWTA 3ZT6A 5HSFA 2NY5L 2HWZL 1YMMD 1JGDB 2HXAA 2K4WA 3VFTA 3FO2A 4DGIL 1JFHA 2WJ7A 1KCUH 1KXVA 1WZAA 5F6HJ 3SE6A 3UTSB 5G4NA 2ICWB 3PGCA 4IBQA 2V37A 2GAZA 5FGRA 5H35A 3RP1A 4RGMC 3VGFA 5ID1B 3AUVA 1ZPLA 5EC1A 4YDJA 5HJGA 2MCMA 4AYDC 3O11A 2IOIA 1XGPA 1EBPA 4HHAB 3AY4C 4KITB 3FU6A 4GSDH 2V9RA 3HB3D 2AXGB 1FP5A 1XXFC 3DI3B 3TNNA 4RSYA 3QIWA 4XB7A 3SDDB 4U31A 1FV1B 4N2KA 2Q5BA 5B39B 1ACXA 3DIFA 3MA9H 4M62H 5AWNL 2EDQA 2GTQA 4DP7X 4XHJD 1JV2A 1S7WB 1YVLA 4FLRA 3GMMB 2A7BA 3S48A 1ONQA 2O72A 3L9BA 2OYPA 4JHUA 1S9WB 2CO6B 2Y7QB 4MMYA 1ZJAA 4X6DE 3BPLC 2WXMA 4CRPA 1QUNB 3NABH 5FGBC 3FUEA 2CLVA 2I7SA 4NKMB 5D7EA 5GZOD 1JYNA 1Q9WB 1AD0B 3GI9L 4NZTL 2ZWSA 1EVUA 2M83A 3BUPA 3WELA 1I53A 1MRDL 4G1MB 3WEXB 3HE7C 3UPRA 5CD3B 1E28B 1CFQA 2O6CA 4WI6A 1BBDH 1FFRA 2ZTBA 2VDNL 4HWBA 1WHPA 4ODSL 5TE6H 5CJBA 1GTFA 3RWHA 3IWVA 1NH6A 4JRYD 2UXVA 1G43A 3BPNC 5DD0H 1HX0A 4ZT1A 4I3GA 4L1HA 2ZPKL 5HHMD 3ZRCC 5BJTA 4NKQB 4MJ2A 3BIKA 5SWZE 1XSOA 3QXWA 1TJIL 4KWUA 4ETQA 5ETUB 2CRMA 3HR5A 4OM0H 3MRLB 4QRPA 4U3XA 1YJDC 4W9FC 4YWGH 3CAFA 3IYLW 2V2WB 4PJ7E 5A1AA 3W39A 3GUTB 3OX8B 2R0ZH 5LJYH 4O2CB 1SOXA 2D7PA 4NYLA 1H9DA 5AYTA 5JTWA 5EBLA 3SKOB 5HI3C 5DHXB 1URIA 3TZVD 4DFHA 2CIKA 4F1ZA 4AC4A 1B4TA 4FQCH 1E4KA 2DWEB 4KO7A 4ZW3A 3FU0A 3F6JA 2BSTA 5G5DA 5E6YA 4LLMB 3E6HA 1FUNA 1A9EA 1E3XA 2F8IA 3T3PF 3VWJD 1IQDA 2Q2LA 1MW1A 1UKSA 5TE4H 3FQ2A 1YEHL 4XAKD 4WGWB 3CH8A 1MCJA 2NY1C 1ZT4A 2X42A 5KG9B 1SBSH 4DZ8A 3GBMH 4L3EA 1XF4B 1IC7H 1A9BA 1QSFD 3KWXA 3WJLC 4LSTL 3MLWH 2GITB 2YLHA 5LO7A 2EKJA 2EP6A 1KLFA 2ZXGA 1MKFA 4JFSA 4DGVL 3CGTA 4NQQA 2HLAB 2F15A 1ZK5A 3Q5OA 3MZTA 3LKQA 2WZPD 2J55A 4JGUA 4GQ9L 4PRPA 3QFJB 1XHHA 2AV1A 3R7QA 4C56B 4R90L 2A4ZA 2DRUA 4U1HA 1N19A 4LHUD 2QDVA 1SJEA 5AKSA 4Q6IB 2OMVB 4EN3C 1QFHA 2WXHA 3U6XA 3BVDB 4YVUA 3KPSE 3MV8D 2K45A 2ZF8A 4AQ8C 3CN2A 1DVFB 1FNFA 4P9HL 5CGYD 2BX5A 2Y2WA 2MCG1 1PZ2A 2ZOTA 2H8PA 1ZVHA 4PTTB 4YN3A 3OJDA 4H1LA 4NQVB 3CX2A 32C2B 5DD1H 1CBVL 4GG6E 3TA3C 3CG8A 3NIGE 3OWRA 4RA0C 4WFED 3MV7D 5AVRB 4DQOL 2CKNA 3U4BL 2VN7A 3QJFA 5AKTA 3L3KB 4XAWL 5JO5A 2XY2A 3JZ7A 3LHAA 5ALBL 3CZSA 3E6FA 2EEDA 2WZ6A 3MOAL 4RNRB 5JQIB 4OUUB 3N42F 1FWXA 3N06B 3ZX1A 3VXTB 3UFIA 1S9VB 5FCSH 2UX6A 2O5NA 4NKDB 4G7RB 4YHLL 2DMBA 5EZIL 1JRHL 4G6AC 3T2LA 1IEHA 4Y4HC 2NY0B 3LZPA 2EXWC 5T1DL 4MAYA 1T3FA 2XRAH 2NY3C 1B2WH 1YQ2A 1A6WH 5BS0E 3REWA 4FMFA 1FAIH 2ICES 2KPNA 3L4XA 4FLHA 2DYPB 4ZQTA 1QRNE 5L2JB 4L18A 2BNRB 1UM4H 1Q8MA 3RGBA 3HI1B 3T65A 2YD8A 2LU4A 3LVEA 1WD9A 3B34A 4IOIB 2YGOA 1H3UA 3GJFH 1NA8A 1OAZL 3OXRB 1GC1H 3L1OL 3EFFB 4KK8D 2VSCA 3ATBA 1RU9L 5LGJB 4B7LA 2CCVA 3NIDB 4RBPK 3U6XS 4PP2A 3H4HA 2G0LA 4KKRA 4DIXA 2D2OA 3B9AA 4O02H 1OP5H 1G9NC 5JPNA 4DCQB 2Z9TA 2YXVA 3ZT5A 4X42A 3KJ4B 4FJYA 5DEJA 4NPJA 4AIZB 4QXGL 2HVJA 3CSFA 3KXFE 2APVA 4ZFGH 5EEVA 5F3HA 4OQTA 3OKEA 2DQEH 3QDHA 1F45A 3SN6N 3M07A 4OZFH 2ED7A 2NXYC 3DX0A 4JM4L 4UAHA 2COQA 3CZFA 4HK3J 2VSDA 4EIZC 3S5LA 5GJSL 5B7FA 4PIBA 3BIAX 1LEGB 1CZ8H 5ICZA 4AQ1B 1JTPA 1NFAA 3M7FB 3C09B 1CFNB 2DQUL 5E4IA 1XZ0A 4S2SB 1MJUL 3DWTA 1ZGLA 3HZKA 3UBHA 2VNCA 3MCLH 3ZDXB 1QPPA 1DVXA 3V0HA 1WAAE 2V9TA 3OLEA 1AO7D 1X5XA 4Z76A 3N41B 2NQCA 4PCTA 4QWWC 4HUMB 3HHRB 4JFZL 3CFJB 4AH2B 2Q7YA 3LCYA 3IWUA 1MCRA 3KPOB 1UD4A 3Q6GH 5I8CA 4P5MA 2WQ8A 1T6BX 2LV4A 2G2RB 2X4SB 1A0QL 2MIZA 5FK9A 1EAOA 3L9RA 5HHOA 3STLB 1AGCB 4KKAD 4X4ME 5HDOA 1E4XL 3RY6A 3LOWA 1UWFA 2JTYA 1J5OH 1UJ3A 2E9IA 3GBNL 3V0WH 5A2BA 3VYNA 5IMLB 5ISZB 1L4IA 2VZUA 5E9DB 1UENA 3N85H 4C4BA 5GISL 2ATAA 4IJ3C 4PBWD 4TL4A 3FQRA 3N5AA 3P54A 1PNCA 1YEFL 1XCQA 3BZDA 3WJJC 2BIMA 2AJUH 5CILL 4U6XA 4XP1L 3CLWA 3EJQA 1WV7T 2XTJE 3ULUL 1UM6H 1T04A 1A25A 3O6FD 1HHGA 1F00I 5EIQA 5EC2A 4P4RB 2Q8AH 4B9YA 1Q72H 4NFBA 4BGDA 5DI8A 1MFMA 2NZ1A 4HUXB 5EF0A 4IK7A 5T5FA 2GJ6A 3REVA 4ELDA 3HHMA 5LGHH 2DQMA 4NWUL 4A7GF 3FB7A 2XVGA 3MRGA 4WWKA 5FYKE 4BD4A 3DVNA 4YHYB 1B90A 3ZR6A 1XCTB 3L13A 3MLRL 4OBRA 1UC6A 4JFXA 4PJHF 2OMTA 5B8CB 3MOQA 1XR9B 1M71B 4TKWA 1EUUA 3G04A 5AVWB 3V0JA 1DBBH 4NUJB 2XZAL 1I9EA 5HGDB 5DZ9A 4XP9L 1J1OH 4I0PA 3LPGA 3EGXB 1V5JA 3MZGB 1KJ3H 2JSFA 2ZUSA 1UQSB 2XV2A 3CZUB 4G8FB 4N8PA 4J2XA 2HRPH 4K9JA 5EF2A 3MRNA 3TPUB 2R7EB 4J3WA 4MJ5A 4YHOH 1T1YB 2UYLB 1KCUL 2J4WL 4OCRH 4ZTOL 2BSCA 1W72B 5DHYA 5C71A 3RWJB 1RVFL 2OMYA 4J28A 4LRIA 4OCNC 4PD4K 1VERA 2GFBA 1MJJB 4RGOL 5A16B 2Q9OA 4NP9A 5C0EB 2VYRE 3FQNB 4GSDL 4HJGA 5JNYA 4FJ6A 3HG0A 1NWOA 2M26A 5EN2B 4M9PA 4ZAKD 4CMHC 5CEYA 2WBWB 2YD2A 1CUOA 2YR3A 3QUKA 3RI5K 1FE8H 5CP7A 1BLNA 2UWEB 4XZUA 2FR4A 2XACC 1EZSA 1WBZB 3WIHA 1YYLL 5EEYA 4QCIA 3RTQB 4H4NA 1YN7A 3CFDA 1OVZA 3QWOB 4JVPA 5LN4A 4AENB 1EEQA 3ZVVA 5I5RA 2CDFA 2RFXA 3S8FB 3UABA 3NABL 4AMWA 2BVEA 3TTYA 3SJVB 4PD4J 1XSIA 2FJGB 3ARGC 4X7FC 2J72A 5DHEA 3DO7B 4XRCB 1LK3L 4NS0A 3FRPG 1BBDL 1KGXA 3OF6D 3ASNB 3K71A 3QEUA 4LPCA 5AAMA 4Y8AA 1CLYL 4Q4EA 1GYAA 4WO0A 2IOMA 3LDBC 1MWAB 5E6UB 4XO9A 1DUYB 1WFOA 3WE6B 3GD1C 5E1AA 1I1FB 3VGAB 2GQHA 5CLXA 5GRJL 4PGJA 4F7PB 4DKTA 1B0RA 4OM0L 4XXWA 3WN5B 3PHQA 7PAZA 4YWGL 1G9HA 5CFAA 4KQ4H 3AG1B 4LMQI 4DN4L 4BGLA 2B08A 1IAIM 2R1WA 5A2LH 3VI4B 5H37H 2R0ZL 3KL3A 2J3SA 1HWGB 5I76A 5J13C 2BVUA 3FTGA 3P0YL 5FOJA 5F0LB 3HJ0A 4IDLA 4H7VA 5KSUB 2PP9A 4U1GC 1PLCA 2XTSA 3OKYA 4TQIA 2HVKA 1NM4A 2MOGA 3AQZA 4UT7L 3EOBA 3HG5A 3F6LA 2DIBA 2KS0A 2NZIA 4G80B 5DD6A 5IEKA 4K7FA 3VTMA 4X6DA 4HS3A 4X6FB 4B50A 2K7PA 2X40A 3I2CH 2GSMB 4XNYL 1IX2A 1I8LC 1ZEAH 1M6UA 1JV5A 4L3FA 2P80A 5EU6E 4QXTA 2JV6A 4OJEH 4QO1A 5TE4L 4GI8A 4PV9B 1BZEA 4Z7VB 2NT1A 4YQXH 3AC0A 1FPTH 1SBSL 1KLGB 2FAUA 4MCNA 1ZLUK 3GBML 1N5YH 1HQRB 1IC7L 3CXHK 4OBSA 1BZOA 3MLWL 1C5DA 5SWZA 4AUUA 4Y5VC 1EEYB 3U9WA 3RDTC 2BIOA 5GRUH 3GQFA 3MACH 5IVXE 1C08A 2AV7A 2HN7B 4KTEH 3E2HB 3BZ4B 3K4DA 4BSWB 1S5IH 2ITDA 5CLYA 5I1DA 1UZGA 1I9RH 3OR6B 4P23B 1UXWB 3MJWA 1S5HA 4G9FD 4PJ7A 1IC4H 3BT0A 3JYBA 4ADIA 4JDVB 1JP5A 3QIBB 3FQWB 4B0MB 1TJMA 3C5ZB 3L3OC 4RAUB 1UOVA 1QSEB 5FXCH 4UNIA 5DEFB 5E23A 2VXVH 5EU5B 5DD1L 3QDGE 5DWPA 4HWBH 5EU3A 4XVJH 5AUMA 2GJZB 2I9LA 3F7RA 4LVNC 3CXHJ 3QO1A 4L4VB 1JOIA 2VLMD 1MRCL 1M2VB 1NUDA 4UIMB 1IL1A 3EXJA 3DMMC 2ARWA 2B5IB 4N0RA 5BZWA 3S96B 2WXQA 4OLUH 4P46A 3SKMB 4JFFD 1B0GA 4DK3A 3UX9B 1NKRA 3S36X 3NCYP 3KLAB 3O9WA 4WJ5B 5K93A 3AT9A 4JKMA 1RZQA 4LQ1A 5DR5H 3A47A 5C09D 3HZVA 4HISA 5DK0B 2A4CA 3MX0A 2ICWJ 3VFSA 4MDJB 2EDLA 4PLOB 3FTUA 4W81A 3ROLA 4AIEA 1MRFH 3BSZA 1UADC 3BESR 4WEEA 1WT5C 3WSQL 4B60A 1BA9A 3LQZB 3TVMA 4HOWA 3B7YA 1MFAL 2B2XH 1UVQB 1NPUA 2EYSA 4K7PL 3X12B 1LHZA 2XRAL 4ZMTA 1B2WL 3BVWA 1A6WL 3VG0H 4TVPD 4IIQC 4MXVF 4G6ML 2NY6C 4XCNA 5JIKA 4GSRA 2DKUA 1YEEH 2A6IA 3D18B 3GRBA 3H42H 3MROB 1KCSL 1MW3A 4RLDA 3MCG1 4URTB 4WGVB 4V2BA 3KPSA 1W0VB 4P9HC 2F7OA 3TV3H 4BFNA 4H8WC 5E08H 1GGCH 4PR5A 1OE3A 4LSRH 1H15A 4R5VA 1GC1L 1XTMA 1SVZA 3RUGF 4GG6A 3L5WB 1NANH 5JQ6H 3B7SA 4KO5A 1L5GB 1HK6A 3QXAA 3N40P 2F61A 2N1TE 4G1EA 3AG3B 3PLYA 4Z6AT 5B7EA 2WCSA 1P7HL 5HDRA 2OMWB 4I13B 4ATTA 4ZFGL 2XNAB 3F05A 3QUXC 4EXPX 2DQEL 4Y5YB 4M61B 1DTUA 2BMKA 1JZ7A 3AREB 2CKBA 1G1OA 4QF1A 2NXZB 5I6OA 5EFIA 1FNLA 3ESNA 1XIWB 1F86A 4KKPA 1NC4D 5DT1H 5K9OA 2BNQD 1S7UA 4NWTH 3K8MA 2ZOWA 4LCYB 4WU7A 2WLYA 4HUVA 1QR1A 3F7QA 4IW4C 5AW1B 1BHGA 4N1CA 4RIRB 1OE2A 2B15A 1P6FA 1CZ8L 4H1LH 2J2ZA 2E7LA 1VZHA 1U95A 3MA7A 2R0WH 5BRZD 5BS0A 2P5ED 1QWUA 3G5ZB 4Y16A 5HGAA 4ZO9A 4MB5A 1QRNA 1WBYA 3O8XB 4WKXA 2P1YA 3NCMA 1KIPA 5K59E 2P8PA 4DH2A 2VZ1A 3LXUX 3D4ZA 4E9WA 2PYED 1UURA 2H6PB 3QUYB 5E7FA 1JI1A 5D1ZA 4YDKH 2HFEA 3KL5A 4H88L 1AZZC 2DLFH 1A1OB 3VH8B 4XN1A 4E0RB 1KBVA 3KGRA 3KYNB 3H9SB 4TSCH 4YNYA 5C0CD 4I9XA 4IU3A 3WEBA 4AEEA 5C0AD 2IH3A 1J5OL 1I8IB 3VD0A 5J9PA 3V0WL 2WB1A 4YFLI 4PG2A 4FLSA 1T20B 1M6OB 1U8KB 2BNUA 3FOLB 3JUZA 3KXFA 3QJUB 4P48A 5CCHE 4AWJC 1MCPH 1G1KA 2W95A 3F12B 5LWYL 3WD5H 3RL2B 3FT4A 3EJZD 5J57B 3ABMB 3CLFH 4CC0A 4E41D 1RZIB 2BXZA 3H3KA 4NEHB 1BM3H 3MRDB 1UM6L 3MNDA 4XE5B 4QPEA 2BDNL 2GB2A 4AK1A 2IBGA 3L1GA 5LGYA 1Z3RA 3ZDZF 3DX9B 2NNAB 2Q8AL 2IAAC 2X6BA 4WJG3 1Q72L 4UZSA 1FZKA 2ERJC 2X70A 3EJUA 4NLAA 4ABQA 3DXAE 4V33A 5LGHL 2MJWA 1QEWB 4RISH 1N70A 3QI9B 1WAAA 4YK4B 2XETA 3R18A 1ETZB 4L37B 4HXAH 2Y06L 1OCZB 1TCRB 4JCLA 3VJ6A 1MJ7H 4J27A 3OKNB 3WUWG 1BX2A 1DBBL 4OQTH 5D5ME 1ZT1A 4Z18A 1S7VB 3ZBMA 2V7HA 1HNFA 4X80H 1J1OL 2HPOA 3PQYE 4MZIA 4TQEH 4YHPA 3CQFA 5PCYA 1KJ3L 4Z7QF 4LPYA 1JDCA 1JWMA 5SWSE 4YSTA 3PP3H 1GYWA 2C4FT 4TRPH 4X4MA 4B9JA 1IV8A 2R0KH 3U2SA 3IMBA 3C5SB 4OFDA 4Y1AE 2BOCB 4G7SB 3JTTA 4OCRL 4TSAL 2P24B 3TFKC 4XMUA 2P5WD 4HKZB 2CO7B 2IH1B 2Q10A 2L7JA 3WIFB 4HLZH 5IQNA 3PJLA 3AW5A 1FFOB 1LEIA 3QE5A 1R46A 4C56E 3L7FB 1A7PL 3K6SA 4DSYA 2PPDA 3CBRA 2YC1A 1I9JH 1NAMB 3KZ8A 2W8CA 4LCCB 3QWNA 4I18C 2WQRA 1YQVH 1FJ1B 4U1JB 2EXYC 5CF3A 5FKPA 2IBZX 3BZ5A 1D7DA 4APXA 1G7HA 1KTCA 1BIIB 2V2TA 4GKZA 1FE8L 4HVBA 1M2OA 4BH7B 4QYOA 4IOFD 4CILA 4F57L 1AHKA 2DWXA 4X6DF 4TOYH 1YEDA 1DQKA 4LASH 3SKUD 4HOXA 3Q43A 3VAEA 3KMDA 3PWUA 5KANI 3DROA 3U48A 4LT7A 1S7XA 4CVUA 1ZA3A 2Q76B 5IMOB 3MMEB 3L2LA 3F58H 3T77B 3S36H 3WS3B 4R7VA 4C83A 3ULVH 5D1XB 3DX2A 3TJHC 5FECA 3ZL1A 3RIFK 2IEPA 5E6SB 5FO8A 2EDKA 3MREB 4FXLA 3S35X 3QAZB 4BINA 2IDSA 2Q6WA 4NIYE 4FFWC 2RALA 1T1XA 5T5FH 1UZ6E 3DYMA 1ZA6A 4J1UA 1D9KA 2DJUA 1SUHA 3ZSSA 1W8NA 3QJQB 1UA7A 1IGIL 3TYFB 2NY7H 2HJKB 2IH8A 2LAAA 3SPJA 3L95B 2VDMH 3P3SA 4JRXD 4OLXH 2VM4A 4HCRA 4MCZB 4Z8FH 4FQXB 2PCFA 3VRLF 1U8NB 3LSOB 5KJRL 3QHZH 3T4AB 3B5HA 3RGVD 4R0LC 5ACZB 2XQ0A 2O5XL 1A6PA 1NDGA 5C9KA 2UY7B 3HIZA 3HW7A 3HNTH 3LN5A 3FU7A 5D96B 1UD3A 2OR9H 1TTUA 4PIRF 1XSJA 1OPGH 3R0NA 4WHTA 5JXEC 2C7UB 1TUPA 3A6BL 2R4RH 4D9QD 1AMXA 5IVOA 2D3VA 3PRZA 1FL5A 1RULL 1KXHA 4OLYH 4RMBA 3G5YA 3LKSA 4GSUA 3ME0A 5T1KA 3I2CL 1ZEAL 3UCRA 1Y0LA 2KZKA 2NW2A 2CIIA 4LEEA 5DJCA 2OK0L 1RZ8A 2J8UB 4JJOA 1DBMH 2P8MB 2D7OA 4TLUA 3RB7A 4F15C 4JPKL 3GZQA 1FPTL 4HKBA 3FQTA 4ABVA 1N5YL 4BDVB 1BYOA 1VZGA 3TEUA 5EORH 3QZNA 5BO0D 5HVFB 4U0RB 1EEZB 1G5GA 3ASOB 3FCSA 4MXWH 2F7PA 4UQ2B 1TQWA 4B27A 5GRUL 3ZDXE 4Q7DA 4PTUA 3MACL 3M45A 4KTEL 1URLA 1V7NL 2VDPH 3WIHH 3CDFA 2WSKA 2GC7C 4U1LA 4JFDE 1GGYA 1O7SA 4IEFB 1IC4L 5I1CH 2HVBA 2Y5TA 5F97E 4ZZKA 3IU4L 3HEIB 4Y4KA 43C9A 4ZXBB 3QS2A 3BVNB 1OAXH 2VDQL 3GWJA 1R3IH 3IFOA 2N7SA 5F1KC 1JZ6A 3ARQA 3ULUD 1C12B 2VXVL 2JJSC 4Y5XA 3VU2A 2F58H 4LLQA 3I3DA 4GJTB 3IJYA 2YKLH 4HWBL 1YMHA 2CWRA 4XVJL 1CGSL 1KB9K 1B0IA 2ED6A 2KUTA 2HRHA 4MLIA 3MODH 3B1TA 5F89B 3SDCD 5KBNC 3C6LB 2EIMB 2W07A 4MYWB 4OLUL 3ZSTA 3BAEH 2HT4D 2MNJB 4PVNA 3VWJB 1PW3A 2QKIA 5F3BA 4JREB 4TLSA 5EU6A 1MCBA 3GB7A 3KPRD 1FVCA 2O6FA 1T83A 3WKMH 2J5LC 2G5BA 3VTAA 2WKLA 1SJXA 3MO1B 3OXSA 3L4YA 1S9YB 3BT2L 3QZLA 1JAEA 1FO0A 2BVPB 4X4ZA 2JQAA 3BP4A 3MRPB 3TH3T 4X0KA 3K4AA 2B2XL 3BIBX 4ODHL 1OCOB 5IVXA 3QYMA 4N8VA 3VG0L 4PJGE 1JWSA 1SUJA 4Y9EA 1DHKA 1KB9J 2JI2A 4XNQB 2ARJB 1U92A 3H42L 1YEEL 2CUMA 4OZIE 3GKWH 1N26A 4UOW0 4MNQD 4ZW8A 2G3MA 3LEXB 4JVWA 2BC4B 4R8WH 4JGNA 3TV3L 2BP8B 2R1XA 4BA8A 2DEXX 2WWMC 1ZLVH 5E08L 3KPQB 1DJGA 2YD6A 4CC4C 2WNKA 5ICXB 2VR9A 2P5PA 4PGEA 1T21B 3V4PH 1PZUB 3QDGA 4XPFH 2H9GB 2XFXB 3QORD 4NI3A 5JQ6L 1PY0A 4CADB 3EO1B 1MVFA 5FV2A 2GG1A 1LQSR 3W9DA 1QO3A 5BRQA 1FH5H 3L4CA 4R96A 2AJ3B 2YD4A 5DJ6A 4ZMVA 4P5TA 3SDAA 4PRNB 3ESUF 2HG5B 3LNFA 4M4RA 5J1AA 1DQJB 3TO2B 4YPGB 3U9UB 5D2NC 1FC1A 5F7MC 1P4UA 5C92A 2XG4B 5K1NA 4GBXD 4DZBA 1KBBA 5ACMA 1RIUH 2UUDH 3BPOB 2JQZA 1GHFH 1QD0A 5DT1L 4NDMA 4BHUA 4ZMPA 4NWTL 2YOAA 1P5UC 3Q8BA 4EE2A 2CGYA 3L8QA 1WFNA 5FGSA 2P7TB 1ZWIB 2R0WL 5TK4A 1EGJA 1RPKA 2HKHH 1V3MA 2DWTA 3P0VH 3IDJB 3OKKA 3WHXB 3EGSA 1EZVY 4GW1A 4NJAH 4QXWA 4S1DC 2GIMA 3HG1B 4N0CC 2OJZH 4UQ3B 4IRJC 5F72S 1M42A 1HSBA 2MH4A 5DUJA 3APMA 4UMGA 4UDUB 1OOWA 1IGYB 2QZ5A 2LLGA 5IEHA 3D2UB 4EUPB 4NN6C 4YDKL 2BP5M 3SJVE 1GC1C 1YEIH 4UM8A 2HKAA 2KHAA 4M29A 4AYGA 1X5JA 1CJYA 1OAUH 2DLFL 5EH1A 1UGNA 1JNJA 5D7IB 1IAKA 5DLLA 1MY5A 3FO0L 3SQRA 1Y6MR 2XV3A 3BSZH 3O3DB 1BQLL 5ITBH 1XGRB 3CFBB 1EO8H 2JLPA 4XXDB 3FFDA 3V8CA 4CU7A 2BWQA 1QSFB 2K9UA 1JF6A 4PGCB 4X6EA 4D7PA 4M8QA 2RACA 1MCPL 3WD5L 2H26B 1OAYH 1IGFL 5FYJU 2IGLA 3CLFL 3QS3A 5CWSB 3NZ8A 1RIHL 4TNWK 4DGYL 3KLHD 1D6EA 4NRXB 4WI0B 1L9QA 3T0ED 1P5VB 3MAWA 2OXHB 4LP8A 3VI4E 4F7EA 1FV1A 4YE4H 1WZ1H 1DEDA 3BGAA 4Q8BA 1XL4A 3ZIMA 2HJLA 2EH8H 4JKPH 4XODA 1TZHA 4E9SA 1OY3B 4GLRH 3KW7A 2AQSA 3POHA 1OTSD 1HH6B 4ZSOB 3CFKB 4DOHE 1G0YR 4RISL 5E94B 4YSSA 2DAVA 5CU9A 4IKIA 4HXAL 4GEIA 4NZJA 3H3PH 5DQJB 3S3CB 5IWLC 2EVFA 5IJBC 1MJ7L 3HZMB 2JB6B 3X3FH 2AABH 4PSRA 2E7DA 4S1QH 2VXQA 4ZFOA 3NCBB 4X9FA 4OGQC 2JJWA 1AD0A 3DOSB 2CKBH 1RLBA 2BJML 3FT0A 1RLWA 3K2MC 4ORGA 4TQEL 4G1MA 4HIPA 4Z7OF 1E28A 2FGWH 2A74C 1WPCA 2OMUB 3WTWA 4PRHD 2FZ3A 5JHMA 2R0KL 1AYRA 3O2DA 4YGVB 4EOWH 1SHMA 1HKLL 3QGVA 2FQFA 4BRVA 3NSDA 3MKKA 3BPLB 1NLDH 1WBXA 3B1UA 1FN4B 2YA1A 4H2CA 2ENPA 5ETUA 2WXJA 1E90A 4ZOAA 2G2NA 5I26A 2O5ZH 3A0OA 5F7AA 3HE7B 2G3ZA 5HY9B 2EIBA 1HSAA 2V2WA 2X53A 3EYUL 1UXSA 1E8XA 1KYDA 1ZCRA 4Z9KB 4O2FB 2X7LA 2CK2A 1Q4NX 4PJ8D 3BPNB 3VE0B 2Y7SA 1I82A 1E8WA 4FNSA 1RJYB 3D06A 2RAMA 1YQVL 1MHHA 4MJ4A 2OI9C 1QSEE 1A7NH 1E7UA 3DXAA 3MI6A 4LSVH 1A4KA 3U46B 1L9RA 4I7ZC 4H26A 5GS0H 4QRBA 3L17A 2DH3A 5C0BB 1V7ML 4KHXH 3MRQB 2QJDA 4TOYL 2APSA 1U93B 4L4VE 3L2MA 2PTTA 2CGZA 4NPYB 4FGMA 2CR0A 4J3OF 2KLRA 5MHSD 4ZD3H 2XFGB 5D5MA 2OX5B 1TQSA 1A6TA 3S36L 1YEKH 3PQYA 4X5WB 3GEFA 1SDDA 3ULVL 3WY2A 1CF1A 3DJSA 2AXJA 2I24N 3HPJB 1W91A 4FG2A 5SWSA 3QDMB 3FBQA 5AW2B 5EDSA 3TTSA 4BH8B 1XF4A 3ESPA 4Y1AA 1AQKH 3VGEA 1JGVH 1YDPA 4KTDL 4JCWA 2X6UA 4PS4H 4AV5A 3CZLA 4X4KA 5T5FL 3I6KA 4MCYA 1HZKA 3U2JA 2ZAIA 1KZQA 4L8SA 2NY7L 3OJMB 4HQQH 3J07A 4OGXH 4X99B 4C56A 1NICA 5HGHA 3SBRA 4HUNB 2VDML 2NY1B 3STZB 4OLXL 1FLRH 1MW0A 4Z8FL 5E1GA 1QWHA 4JN2B 4I5BA 1BECA 4Z0XB 1IEBB 3QHZL 4IGBA 5EBWB 3K2KA 3U83A 3DGGB 3V4UH 2N1KA 2VN3A 4KMTH 1HEHC 5PAZA 1U36A 1ED3B 2E6PA 3WS6A 1E0OB 3X11A 2OR9L 3QPQD 1SY6A 4MX7B 4AQOA 2DLHA 1K8DA 1HTYA 1XAKA 4QTFA 5EIIB 1CQKA 1M05B 4V1DB 2R4RL 4QRRD 4EN3B 2H1PL 3MRCB 3KWTA 2PXYC 4OLYL 4QD2E 4OUUA 2VW4A 1EZUA 4JM2A 1KTJA 4ANWA 3QEQD 2QSCH 2WANA 5DRNB 5EIVA 1S9VA 3DX8B 1NCNA 3TA3B 4PV1C 1QA9B 4JQVA 1GVIA 5F0JB 3C5JB 1A47A 5TDNB 5BXFA 3KVDD 2I7OA 3IDGB 4KVNH 3VMNA 3EFOB 3B3BA 4MZRA 4PCYA 3CDYA 2QV4A 1M1SA 2PCXA 5EORL 3KWWB 3SPHA 2Y72A 2EDFA 4R7NA 5I6PA 2W59A 1OTTC 5FYKH 1U9KA 1E9QB 3OB8A 3V7AE 2EE9A 4ZUTB 4RDQF 1KZYA 2VDPL 4I3RH 4NRYB 4UBDD 3WIHL 5C70A 1MQKH 3VQ1C 4AXWA 3O4LB 3KH4A 2J71A 1VRSA 2Z35B 5JW5B 3RVWD 4ZYKB 4KTGA 3BQUD 4JFTA 1RURL 5JPMA 4S11A 4Y4HB 2ISDA 4GXUM 2CJ3A 3BH9B 2NW3B 1OAXL 4OD3H 3EFFA 2NY3B 1R3IL 3Q13A 4Q9CA 3GSXB 4PLJD 4L5FE 1CMOA 2F58L 2YKLL 3F7VB 1KXVC 1F13A 1MUJA 4LLDB 4CN6A 5I8OH 2YPLE 3BAEL 1AZCA 2AF2A 1XL6A 5C07D 5DVOA 1O9VA 4NIKB 1TQBC 3IKKA 4HCRH 4QHKI 3VRIA 4MJHA 3SDYL 2CJUH 5FA4B 2FHBA 5J12C 3WKML 2JKXA 3FUMA 3LPWA 2AMUA 1EWHA 4XBEL 3QIWC 4GT0A 4JO1L 1T5KA 4A2LA 4AM0A 1PZ5B 1LEGA 2BO0A 3MC0A 5E70A 3WNLA 3MNVB 4P49A 3NEOA 4S2SA 5JHDD 3RWEB 2VLLB 5EV7A 4WF7A 3LN4A 5L4FA 2WO4A 3GI8H 2H3NA 4H20H 4KHTH 2IAND 3TBSB 1EDYA 2NXYB 35C8H 5E8EB 2XWTB 3ELQA 4JFDA 3VGBA 1FGVH 1XH2A 1VGEH 3N1GC 3EYQC 1T1WA 4XPBH 3MLYL 3IJ9A 4GXFA 4R8WL 1YYMH 1H0DB 3GMOB 4EXKA 1IEAA 2CAKA 5DC4B 1UWGH 4LNRA 1JNNH 3V4PL 4PJAE 4XPFL 4HJSA 3HC4H 1VPOH 1U8PA 2UVEA 5GSRA 5ANMB 3FN0H 3JT2A 4C57C 3FU8A 1A14H 1E6JH 3IAQA 3LPPA 1FH5L 5E6ZA 4ACPA 4OCLC 3CVIL 2ZXBA 1N5AA 5HHVH 1A5FH 4G59C 4Z7UB 2VC2B 1NMCC 1GHFL 3AB0C 1R5IA 1BIHA 1GZQA 2X6VA 5TFSH 4GSQA 2X3BA 2Z4QB 2ESVE 5HVHC 5MEND 3VD9A 2H2PD 4WI4A 5AYQA 4IJ3B 4PSPA 3QRGH 4F2MB 3ARYA 1N4XH 2HKHL 5KYWB 4PJGA 3P0VL 1CTMA 5JMRA 1E4KC 4I1RA 1NGQH 4XNDA 1IKOP 4NJAL 4YE0A 2OJZL 4NPKA 4OZIA 1UB6A 5HHXH 5HGDA 3IMRA 4JY4B 4A6YB 3K80A 4WRLA 2QADC 4QHMB 1N7MH 5LBSA 4H0IA 3NQKA 4MTMA 1P69B 1NCWH 5F9JB 1YEIL 4G8FA 4WLCA 5EHFA 4B95C 1I8AA 4BXVA 3S35L 3KPNA 1OAUL 1K2DB 4JY6B 4MZ2A 1I1AD 2UYLA 1FO0H 2ICEC 2X09A 1CT8B 3BSZL 5FUZH 2Z92B 4K3EH 3VXRD 4U7SA 1EO8L 1X5ZA 2FX8H 4NFCA 3Q6FA 1U8QB 2OPCA 2ZNWA 1U58A 4JZNB 5DMKA 3H85A 3QHFL 1LNUA 2CDGB 5IBLD 4MVBC 4N8CL 5AG9A 1MJJA 4K3JH 4ODUB 3LQAH 3IPBA 2MFNA 2DLEA 4IKLA 4KJWD 5CS7A 1CURA 1CN4A 2VM9A 3GDCA 2B1HH 3BEVA 1BWMA 2HLFD 4YO0A 1XD1A 4DEPC 1WZ1L 4U33A 4PM1A 1JF5A 3D33A 2EH8L 4R26L 3K1KC 5L7XH 3AS2A 2NMSA 1GW6A 1OCCB 3B8YA 1P7QB 3HAEA 1IT9L 4K8RH 2LU3A 3NJMA 4XBPB 4YZWA 5A3IC 3ESMA 4GLRI 1CFBA 4LEBA 4H13C 4M6OH 3SE3A 2OTPA 1ETJA 2PCPA 3RTQA 4G8AC 1UA3A 3H3PL 5TDPA 3PV6B 3RLSA 3AU0A 4UQBA 4MJIE 2X4NB 3POCA 4NCC2 1IB5A 3DJTA 4PHZA 2AABL 4TLTA 2UXTA 2BIHA 4CMHB 3LIUA 2FO4B 4S1QL 1P7KB 5ADPH 3SJVA 3TS8A 1Q9OA 4HKXA 4XRCA 1QI3A 1ZHLB 3FTSA 4KKLD 4NZUH 3GZKA 4RMWA 3ARDD 2FGWL 4LLUA 2JLLA 4UF7C 4TUOA 4XCFH 4EOWL 5BZXA 4MAYC 1ETB1 3VO0A 1NLDL 5C0DA 1EGJH 2WV3A 3B6SA 1DQMH 3MRFB 4F7PA 1AS8A 3ARGB 4JG0H 2ZG1A 4X6BB 2O5ZL 1G7LA 4Q74A 1R3LA 4HSCX 2D4FA 5K1VA 3X14A 2F5AH 3W81A 1KG0B 4X7TA 5DRXB 1UEMA 1NGZB 3O0RH 4QNPE 1RK0A 3OAWA 3VI4A 4Z5RB 3KCPA 2VLKD 2Q0ZX 3LDBB 4XBGB 1HH9A 5GRVL 3RKDC 1A4CA 3FNKA 4Y9FA 2LU5A 5E5MB 5GRYA 4DTGH 3IK2A 2OZNA 1A7NL 4LSVL 5CSZA 2MKLC 4MNHB 3D09A 1P0SE 2PO6D 1CLOL 3FK3A 4CA4A 3ZIYA 2J20A 1UD8A 2OTWA 3BD3A 4ONFL 4TPRL 1ASPA 1AIFB 5E95B 4ZO7A 4KHXL 2DWSA 1MHPH 5IFHH 5K9QG 1YY8B 3FZUD 2E47A 2R4SL 2VN4A 3VCLA 4LZKA 4AVJA 1NC2D 3G9AB 5J13B 2EZ0C 4ZD3L 1FFNA 1USQA 1YEKL 4L3CB 2D9QB 4HEPG 2ZOLA 3HG4A 3OB0K 4I85A 5F7DB 1WUZA 1R19A 4EIGB 3X13A 3FH7A 1A7BA 4K4KA 5BZDA 3JV5A 3QNYB 3QXDB 5HYIA 4QOKD 3ARPA 1ZXKA 4MGXA 2EO1A 2BIQA 3GJEB 1AKJD 1AQKL 4CMMB 1JGVL 5E8NA 2VXSH 4Z7IA 4PS4L 1QLEH 5DQ9B 3QDJD 3FT3A 3U4EB 1CK0L 1JZ2A 1DSWA 3EGDA 2CLRA 3DARA 4LLAA 1FCCA 4YHZL 1QFUL 5AVSB 5KJ4A 5HDBE 4JFVA 3BZ4A 4OGXL 4HQQL 5CEXB 4P23A 2F2HA 1HDMA 1UXWA 3FUNA 2P5EB 4XMZA 1FLRL 5L6YH 4W70A 3LNIA 4QAWA 2VDNB 4ENEC 3GMNB 3OWEA 2B3IA 1J18A 4RMTA 3NIDF 2VXQH 2IFFH 3QIBA 5D2LB 2Y2TA 4GO6B 3V4UL 1HCZA 4Y5VB 4KMTL 1QSEA 3RDTB 3TIEB 1IM3B 2ENSA 3MOBL 5EU5A 2FD6H 1X5AA 5AVUB 4OI7A 1T2QH 4AQEA 3RY6C 2PPAA 4DGWC 1NPNA 1UJ3C 2VKWA 1NPJA 4L4VA 1UCBH 5I8EA 3U2IA 5IW6B 2OJ1A 3G6JB 3B2MA 4QRTB 2DWYA 2EDMA 5C0CB 5J6GB 5DGRA 2ADGB 3SKMA 4GKNB 1IE4A 2DM7A 4XMLH 4JRYE 5C0AB 3GXTA 2B1AL 4HX1B 1XB6A 2N7AA 2QGCA 5HHME 4KROC 2AEPL 3L3OB 4NC1C 3ULVC 1QFWH 3P9WB 2GI7A 1RZFH 5IHUH 1A7RL 4RAVB 1H19A 3UTZA 3K6IA 5IMKB 2VUKA 3LXAA 3VXMB 3ARFC 4FYSA 4X7EC 4KVNL 5EOCH 4WTZG 3ZDXF 2YFOA 3DMMB 1W8OA 3LQZA 4K7PY 4X4XB 4AUYA 5JZ7D 3N41F 3X12A 2DLGA 4WWKC 3RIFF 1JWUA 5FYKL 4YDIL 4X5QA 1VACA 4M6MH 4WU5A 5AZ2H 3D18A 3G6AA 1XGUA 4I3RL 4R2GD 1MQKL 4IJTA 5CEZE 2WLHA 1A6VH 3MNZB 1W0VA 3C60D 3BHBB 4I0PC 4BCYA 1MIML 4KVPA 3EJJX 5B38A 2B20A 3NEXA 3IFNH 3SBQA 4NO0B 4N6RB 1L5GA 4IIQB 4UYQA 2X0VA 5D7IE 2AEWA 2Y07H 3MSPA 5IB3B 4XAKE 1ZSDB 3FCBA 2YAPA 1F6AA 1QWNA 5HGGS 5ITFA 4BK8A 3PAZA 1T4WA 1SOKA 3OBAA 3NZSA 1QSFE 1YLBB 3TCTA 4BUQA 2XNAA 3CH1B 1JN6B 5I8OL 2WMPB 1GZPA 4DVBB 2ZP9A 4LRIC 4M61A 3RWGA 1DFXA 4CJ1A 3AREA 4HCRL 2J1WA 3X2QB 1AOHA 3RVUD 3UTQB 1G6RA 3NJFA 4M3KB 3UAEA 4IKKA 4LCYA 5IFAL 1MF2H 2VRKA 3UAJD 4NBYB 1JK8A 2WHVA 4TUJA 1PLGL 1E5UI 3Q2WA 3MV8E 3AQYA 1J5DA 3U36A 3GTTA 1WJ3A 2N0KA 4YMPA 1DDHB 3SPGA 4RVBA 1SY6H 1JVLA 3TN0D 4GUPB 2EE0A 1VFAA 1J87A 2X4QB 2CJSA 1T4KB 1TVHB 2EC8A 4WFEE 4JR9H 1FGVL 1U8JB 1EVTC 1HQ4A 4U4IA 1VGEL 5HYSA 2QLVB 4XPBL 2YUWA 3T4YB 3U0TB 2QELA 4LPXA 3EJRA 5GRWA 4P99A 2BVYA 5KVDL 1SYVA 2DMKA 4C8XA 1UWGL 3LKOB 1JNNL 4XWOC 4E0RA 4EMZA 3HC4L 3DRTB 4HMCA 4XCYA 1YAIA 3QWRA 2ATPB 2EXSA 4HFWA 3FN0L 4HYTB 1BW8A 3AQXA 2H4EA 3QIUA 3TEYA 2E59A 1A14L 2GTZA 1PMYA 4AYFB 3A3YB 1T20A 1U8KA 3FOLA 4GRLD 3BH8A 4BSVA 1OL0A 1XXDC 1SLUA 2WYHA 2YPLA 3RIAF 5B7MA 5HHVL 3VI3B 2IPTH 4XXWC 4UNVA 8CGTA 2AK1H 3AZUA 3TO4D 5AVVB 1ODUA 4TNVK 4FA7B 5KW9H 5FW8A 4HJTA 4WO4A 3AVEA 5TFSL 4BYHA 2XC8A 1ZLWK 2UWEF 5MEQB 1RUKH 1U21A 4IK6A 3QRGL 1EANA 1N4XL 1VFBB 3MJGX 1AH1A 4L37A 4WSGA 4PJDE 2PNDA 4LP4A 3BP6B 4PW9A 3L4UA 1OWWA 3BC9A 2E46A 2I32A 1P1VA 2MQCA 1N7ML 5I15L 2N3JA 1U8OB 2EECA 3L3DA 4PJAA 3NK3A 1IM9D 1LXMA 2OTUB 5F7EH 2ZWYA 3G08B 2TSBA 4LOVA 3C5SA 1FO0L 3GBEA 2PTUA 2ENYA 4J3UA 3P77A 4YC2C 3DUSB 5FUZL 4AZ8B 4K3EL 5KBLA 5CINH 3C2AH 3GSUB 3T2PA 5D6CA 3CZKA 3LEVL 4MXQC 2C3VB 2B39A 5E2TH 5E6ID 3TBTB 4BE5A 5JQHC 1RAMA 1G6VK 4YFEA 5A40E 2D03H 2JKWA 3VI4F 5EZLA 3IDMB 4TQ8A 2MRYA 1K3ZA 2DI8A 2OFQA 3OAYH 4JKKA 3Q48A 4K3JL 4NKIL 2AC0A 3LH8A 3LQAL 43CAA 1AO7E 2AJSH 3MGAA 4M7JL 3W0WB 3VFUB 5HHQB 1X5YA 4QHNB 5BOZG 4EI6B 2B1HL 1HYSC 2N59A 2ESVA 3ZY7A 5KS9E 4UDTB 4WZ9A 3DV6B 5L7XL 4J3SA 4F8OA 1VZIA 3US1A 3DTXA 4X6CE 2H32A 3IXAA 1MPAH 4K8RL 1KGUA 2X4PB 1EFXD 3AADB 3ARZA 1IRAY 5J7CC 4M6OL 4ES8A 3DDGA 2IMNA 4YDMA 3A6CH 4P46C 5IMOA 1OZUA 1RJCA 3MMEA 1KV7A 4DK6A 3ZMNA 3EBIA 4I18B 4OIIL 4Z7VF 1UKTA 1WWCA 5I2IA 4QRSB 3O9WC 5IROD 1KTDA 4E2OA 2VERA 2X38A 4FLOA 4H8HA 2YA0A 4PJXE 3X1EA 5HD8C 4YDLC 5I5JA 4CVWA 3BP5B 2WN2A 1KPUA 4NZUL 4PJ9D 3WE1A 4JJHA 3OC5A 2QT6A 2XIBA 4PWGA 3V9FA 4OLEA 1PLBA 1SM3L 2DQGL 4GUCA 4XNMB 3TVMC 1S7QA 3MV9B 2ZNXA 4WEMB 3SODB 4BHUI 3IVKA 1DBKH 2BXYA 3QCTL 4YHMH 4XX1G 1DQML 3NCEB 4AY0A 4D0DB 5IMMB 3JWNG 2WKOA 2ZUQC 3NFPB 1AGEA 1JS4A 4FN0A 1PBYA 4LAQH 5DMYA 4FQXA 1S9KC 3O4LE 2W94A 1U8NA 4WFFE 4Y9CA 1SEQH 3O0RL 1WIOA 5DUBB 3KDMB 1BLIA 4G8IB 4FNRA 5FA3B 3SGDH 5LBSH 3ECBB 2QGDA 4F58H 3EBHA 3OKDB 5GIRA 1LO2H 1N2RB 3RE0A 1KCRH 3MUZ1 5IOKA 1RHHB 4DTGL 3KR3H 2NY2C 4NI6A 3JWOH 4PB9H 4AEFA 3VX0A 5DDHA 2OL3L 1C5BH 2C7UA 3BKJL 2Z34A 3D0VB 3NESA 4O4YH 3EZJB 5EN3A 4D9LH 1MHPL 3K3QA 4M48H 4MJIA 5IFHL 3MUHL 1XZWA 3S5LG 1VGKB 3HBPA 4R0LB 4KMQA 4EDWH 3S8GB 1GAFH 1ORQB 2PWDA 1FYTB 2R2EB 3U7YH 4QKTA 4QJ5B 5H94B 3F00A 4L9LA 3HS0A 4CVZB 1VESA 3TIDA 3B43A 3BEWB 1MH5B 1OT1A 2P8MA 3K4ZA 4U3CA 2NR6A 4BRJA 5IF0B 1FNHA 3GXFA 3EZ8A 3UTTB 1M1XA 4MAUH 2D7TL 5FYJD 5GRXG 4WI8A 1ACYH 2VXSL 1QLEL 2E7LC 4UQ2A 4NP4H 3HAEH 3P2DA 2WKGA 4YX2H 1QABA 5GGTA 3QZWB 1TIUA 4Y16C 1UH3A 5FYLE 2WBJA 4M5YH 4I4WB 3H55A 3LS5L 3PDOB 4HV8B 3BMWA 3VXQA 4F24A 5K69A 2Z31D 2OMBA 5AL0A 4F33B 5EUKB 2AI0H 5AD0A 4RFEB 1A6AB 2FT8A 3B8SA 1UD2A 3P4LA 5D1ZC 1GSKA 3V4LA 2X87A 1VAHA 2IFFL 4ZFOL 2ZYSA 5AW7B 2ZXDA 3NA4A 2WQWA 2BSDA 3KWVA 3MUJA 2O30A 3ARUA 5IQOA 5JORA 1GL4B 2FD6L 1CE6A 1Z1WA 1T2QL 5E1HB 5T33H 1S4IA 5GS0C 5ANME 3AGWA 3MRKB 3VW3H 3FTWA 1UCBL 3FB6B 4PG2C 5F89A 4Z3EA 4LB8A 1A1MB 3BH4A 1DCEA 3D4CA 4OQ1A 1TENA 5IQ9B 2W0KA 3IGFA 3F85A 2Q3ZA 5KVGE 4ZMQA 3RFRA 3CDCA 3UBXG 4Z7UE 1QFWL 5DLMH 4PJ5D 5GGRY 4GKSA 5ESAB 5C7XH 4PRAB 5TQ0H 3IDIA 5G2NA 2WXIA 3MO1A 1QFWI 1Y6KR 4XOEA 5I1KH 1AFVH 1C16B 1KEGH 2OQJA 2BVPA 3P69A 4KH2A 5EOCL 2GCYB 3T6WA 3BDYH 3S6CA 3MRPA 3ZE2E 3VXSD 4RCAA 4FYTA 2N7BA 3KPMA 3VFNA 5C9JA 3QYCA 2N4IA 3BVTA 5LB1A 3LRLA 1WF5A 1CYWA 3RWCB 2J5LB 4XNQA 3CHPA 5AZ2L 1IZJA 2ZF9A 1ETA1 1RJLA 2BHFA 2CRZA 4OW6A 4Q97A 3PGFL 5DSCA 4FQ2H 4KVCH 4QJ4B 1ILSA 2BP8A 3WDIA 4HKJB 3WFBH 3PJSB 1Y6NR 5C0IB 3MRIA 4QGTA 2XXMB 4W6WB 3SSGA 4CKQA 2XFXA 5GZOA 2WVVB 3MLZH 4AV4A 4CADA 3EO1A 3VVWA 4Y19D 2Y07L 5DD5H 5HPOA 3H9ZA 4KXBA 4ZUUB 2DTMH 1A8ZA 5ICYB 2AJ3A 4MHHG 3ULSA 5I1AB 2DS4A 2WQSA 4JRYA 3CC5A 4B7IA 3FRUB 3MLVH 2EINB 4K2UH 1DQJA 1UWXH 1NEZG 3I6GA 4QYAA 4CJ0A 2GK0B 4E68A 4X2UA 1MLCA 4ZUVB 3V4VL 4LCUB 2X9ZA 4MB4A 5AENA 2G75B 1SDYA 5SX5H 3ZTNH 2JKJA 4ZMXA 3B2XA 1SXZA 4NKOB 3SKJH 4Q58C 4G9FE 1MF2L 2NZ9C 3N43B 2DKMA 5IG7B 3CVHA 1SXSA 3BP7A 4NQCD 5I16B 1TZAA 2W9EH 2XIDA 5D2NB 2D3JA 3AUWB 2ADFL 2BP0B 4FNUA 4OZGE 5J6HB 1GTNA 3TZVA 4ZS6D 4XNBA 4FL4C 3FO1B 2NY6D 1QSVA 2X4RB 2RQEA 1OTUC 4JG5A 3VA2C 2BCKB 4E9YA 5FO9B 1O9WA 3MKGA 2L0DA 2G4GA 4KUCD 1IGYA 2VLME 3WXWH 1P5UB 3S3SA 3VG9C 3V8OA 1WZKA 4JFFE 5JIIA 4PCKA 5H2BB 3ZQ9A 1E9PB 3QQ9C 1LGVA 1WWWX 5D7IA 1X9UA 3B7RL 4HUWA 1KCVH 5I18H 3VFVB 2XY1A 5C09E 4IBYA 1I8MA 3ILQD 3D87B 1WSST 3RZCD 1D9KC 4MD5B 5LDSA 1QLRB 1UUSA 1MNNA 1ICTA 4PGCA 1QSFA 5HYEA 4GKOA 1WD8A 3GJFB 3MXWH 4MB1A 4BK4A 4JG1H 2A0LC 5A7EA 4L8DB 2IPTL 3APDA 3Q2CA 3QUXD 2OR7A 5E4EC 4F8NA 2JIXB 3QB7C 2J1XA 3F3HA 2WZPA 3ZKMC 2AK1L 4TVPE 4AJVA 3NJVA 4MMZA 4UINH 1MFUA 5E56A 1CICD 1P5VA 3EHBC 3BZEB 2OXHA 3OPUA 1U2CA 5KW9L 4NGHL 5EU4B 1A7QL 3PHOB 3ZL2A 4ZFFA 4OKDA 1OARH 3FKUS 4PBVC 4TNEA 4PRDA 3MV8A 4N5EC 1RUKL 1INDH 1ASOA 3CFKA 4ODVL 4A66A 3ECQA 2NY4D 4OZFB 3TM6A 3KGSA 3RIKA 4Q4IA 5J6SA 5L2KB 1MFEH 3FFCD 3P2TA 5IVZA 3MV7A 1UZ8A 1BF8A 4GG8A 3CXDL 2VUYA 1M7UA 4JDTL 1GH7A 4PGDA 2WYTA 5ESVA 3T8VA 3ROOA 4CW1B 3PGDA 2JCCE 4KOBA 1JPEA 2VERN 5LG6A 1EBAA 3I50H 3S3JA 3KBFA 1G6RH 2XWDA 4A7VA 1E8YA 3FONA 3LZFH 2OMUA 3QEQB 2NX5D 4U1KA 3VFMA 4JFPA 2FE0A 3QPXH 4KBPA 1IBYA 3D12B 2NSMA 3IRCA 2VZOA 3IDNA 1E6OL 2AJXH 1K5NA 2YPVA 4HIIB 4YGVA 1KYAA 2BNQE 3B2UD 5CINL 2IPKA 3C2AL 3BUTA 3V0EA 5AFAA 2P46B 3KYOB 4K07A 5ILTH 2XN9D 4FQHB 5BRZE 3HE7A 5HY9A 3R7RA 1YHPA 2LLNA 5IIEB 1CG9A 1DUZB 2P5EE 1G87A 1ILUA 3OMAB 1F41A 2VQ1A 1NBZA 3LRHA 2AJSL 4ODTH 4Y4KC 3VE0A 2APWA 4J3XA 1T6WA 1ACCA 4L0ZA 1RJYA 4EAEA 1N0LB 1KJMB 3WY1A 1HNGA 1JUFA 2PYEE 5CZXD 3EIFA 2JTDA 4Y5XC 4L5FH 3EO0B 1ZS8B 1MPAL 3ZMEA 4DPCX 4L05A 1XH3A 4TS6A 4PJDA 1U93A 1G5AA 1L3NA 2EEAA 1H3PH 2X9YA 5C0CE 1T1ZA 5DZNA 1TZIA 1G7QB 5C0AE 4G8EB 3EYVB 4H40A 1KPRA 3BAWA 2QKIC 1A64A 4LCWB 2OI9B 2VZSA 1HINH 1X4ZA 1Z2KA 4YH6A 2DQCH 1PS3A 3N91A 3LRSA 1G0XA 1VDGA 4E41E 1BYNA 4XR8C 1G7IA 1CL7H 3MR9B 1ND0A 5DJZB 5KN5B 3RNKB 4LBAA 3WAKA 1AG0A 2DPKA 3US0A 1DBKL 2ZSWB 2WCGA 4GP4B 4WUUB 5HJDA 3IXTA 5F9AC 4YHML 4KJYB 4QMEA 4JPVH 4X99A 2FX9H 1HEZB 3T3MB 1HJCA 1QFPA 1ZDSA 1R5WB 3UCQA 3N3EA 1F11B 4YSOA 3LQAC 3PL6D 4Z3TA 1AO7A 4JN2A 2VDLL 2X89D 3PWLA 4Z0XA 1SEQL 3UL4A 3S5YA 4JANB 4PWFA 3HKFA 5LBSL 4XOAA 3NCCB 1LO2L 5KS9A 1I75A 1D5MB 4HMDA 3FUFA 4X6CA 4HIEB 1ED3A 4K8RC 3KR3L 3AU1B 1AS6A 3JWOL 1F18A 3DJ9A 1CDHA 4MX7A 3W11D 4XH2B 2UY6A 1C5BL 5EU7E 4D9LL 3SDAC 5CIPH 3D69B 4WI3A 5AAWA 4IM8A 2FWLB 2OSWA 4ZRGA 1HVXA 4EDWL 4DUXA 2HZHA 3HE6C 4N24A 4PJXA 3U7YL 5C6TH 5AW5B 4ERSL 2P5WE 3EYFB 3NJGA 4KFZC 4UQCA 1I3GH 3TH2T 4IMKA 1E40A 2WN3A 2AK4D 1UH4A 1EJ6A 1P4LB 4PGZA 5EG6C 4PWHA 1E27A 3T8MA 4MAUL 5LQBH 2DEYX 3KVPA 1ACYL 3O6FA 4KXZH 4L4JA 4RMUA 2VLRB 5DS1A 4LRNH 4LAJH 1CXFA 2PXYB 3K7UA 4M1CC 1D6VH 1NBYB 1JFQH 2H32H 1EZLA 5FOBB 1G7JA 4M5YL 2IADB 4KPHH 4HETA 4XWGL 5CLTA 5KVFE 1FZOB 1FAKT 1ITCA 1FGNL 2RH0A 3EYSH 1NEUA 3L3IB 3O4LA 4NOFA 4U6VH 4XB3A 1U8LB 3DDFA 1IAOA 2AI0L 1NGXA 2DM3A 1CYXA 1SXCA 4Y4HA 4OR1A 2Y3AA 3GHPA 4G9DB 4Q2ZB 4PJEE 4R4ND 4Y2DD 4OD2A 3TYGH 3OAUH 3FB8A 2K70A 5T33L 2X10A 3CN3A 4MDRA 3ILEA 3NDZE 3VW3L 1VA9A 3PCYA 4LKCB 1FVEB 1UT9A 3GXDA 1I1YB 1XCXA 3FU9A 1J8HD 1WLHA 1L6XA 2PW2B 1REIA 2ZE0A 3UEZA 5HYFA 5CD5D 1NIFA 4XBMA 3VFTB 3FO2B 5C7XL 4PGBA 3QEHA 5AALA 5TQ0L 3V95A 2ETWA 1CIUA 4JRXE 3TWYA 4YUEH 2YS4A 4FMVA 3PGCB 4K3HA 1AFVL 3ZR5A 2GAZB 2QQLH 4N2LA 3EOAA 3CDZA 5IUCA 3BDYL 4BFIA 1RUPH 1GPOH 1SEBA 1TJGH 5EC1B 4YDJB 4ZAKA 2TRYA 1TMCB 3H0TA 4RSVA 4MA1B 1MNUH 2JELL 1KFAL 1TQBB 4S1RH 3O2VH 3TBSA 1JPGB 5J12B 2YQ3A 4XNZB 1E9OA 3QIWB 4LLVA 3BAXA 4D9QE 5D7IF 2XBDA 1NL0L 3GMOA 3NZUA 1SF5A 1U3NA 5GS2H 1I4FA 4XGZA 1JV2B 4APQC 2FT6A 3PG2A 1B2YA 3T0AA 5ANMA 4HULB 5DD5L 2FNBA 5ID0B 1OGAD 2DTML 1V3JA 4MMYB 4KKBD 4OGYL 3NA9H 3IFLH 1IZKA 3OF6A 4BQ6A 4YHKH 4AUJA 5TH2B 4DP6X 5GGTH 2CLVB 1ROWA 3NBNA 3MLVL 4K2UL 3OLIA 4Z7UA 2QHLA 4I3SH 3ECVA 1PIGA 1H6TA 5A2KH 2CLZA 3DO3A 2YD5A 4BA0A 3CFQA 3KLDA 1Q1JH 5BJTB 1F97A 4P8QA 1NDMA 3TP4A 2IBZY 4XN8A 3SKJL 2O93L 1UJTA 4MKMA 3VACA 2XICA 1CR9H 4ETQB 2B8OT 1MAMH 2O6DA 4JO3H 3WJJA 4QRPB 5KAQF 2W9EL 1DJHA 5KYWA 4KQ3L 5KTEH 2XA8H 4N4YB 4UOJA 5GGRB 5LBVA 3ULUE 3W39B 2P3YA 1MFDL 3KHOA 1NMCB 3AB0B 4FFYA 2ZWZA 3IMSA 4JY4A 4KX8A 4NYLB 4A6YA 5DK2B 1NGPH 4QHMA 5KVEE 4KY1H 5EBLB 4L8BA 4P2OD 3WXWL 5HVHB 1UT2A 5JA9A 4AJYV 3KPLA 1G84A 4PJ6A 3K5RA 5JW4M 1H3XA 2CIKB 4O9HH 2WZAA 5E4AA 4LSPH 1K2DA 4MJ6A 1ZSHA 4HWUA 2KT6A 1C5CH 3KPRE 5J3HD 1WZMA 2BSTB 5G5DB 5J8OA 1FHNA 1KTBA 3E6HB 1A9EB 4P5KA 1U8QA 5KYYB 3KH3A 1IQDB 5GGSA 2QADB 4L8SC 1QOKA 1P6WA 3MXWL 4XZ4A 4JZNA 2X1WL 4JG1L 1MI5D 1ZT4B 3QR1A 1AG6A 4ODUA 4DZ8B 2YAMA 2ODIA 4L3EB 1E3FA 1HHHB 1A9BB 2ICEB 4KV5E 4UINL 4PI0A 3SZKC 4IGBC 4FF9A 1KN4L 4G9FA 1PZCA 1KF9B 1MFVA 4QTHA 3E0GA 3L16A 1WGOA 1OARL 4MNQE 3LZOA 4KAQH 4XPGH 4PJDF 4X8XA 1DZ0A 1T89A 3D3VB 3LKQB 4GQPH 5D1QC 1INDL 3WS6C 1PZ3A 5JHLA 5C0ND 4OGAD 1K4DA 4PRPB 2AV1B 4PYHA 5FV1L 1KLUB 4OZGA 2ZXCA 4JQIA 4KJQC 1GOFA 3V6ZA 3BUBA 3VSVA 1E5AA 1NKGA 1SJEB 1MFEL 3KYKH 3QCUH 3U4KA 3WFDL 4X7SH 4HWNA 1GKEA 4PJBE 4U4BA 3E8VA 4JM2C 2H8PB 4DEPB 3GMQB 1P7KA 3OJDB 1JJUA 4H1LB 4YSRA 4FQLH 5AVXB 1KT2A 2VE6A 4JFFA 3I50L 2XWXA 4JQVC 3ZZLA 4MKTA 5F8RC 3T1WA 5C6PB 1JZJA 3LZFL 1ZVNA 3QJFB 3QPXL 5JO5B 5C09A 3B2PA 1DE4A 4P4KD 1ADWA 3CVHH 3MNMA 4P06A 4LVEA 3U7WH 4G2AA 3T0DA 1I7ZA 4HJJH 5C0JA 1NGYA 1JSYA 2KPWA 3B2VH 1UD6A 2ZX5A 2PW1A 3Q0HA 2IVFC 4ZMLA 3NFSH 1AACA 3OJ2C 1HOEA 3D9AH 1JE6A 2BY1A 4UMSA 2F54D 4Z5RA 5JPMC 15C8H 3PNWA 4XBGA 5KSVA 3Q8CA 1F1GA 1N68A 2ODHA 4MAYB 1T3FB 3LZRA 5F1SA 1SZNA 1MCEA 3REWB 2DYSB 3QZOA 3SIKA 2QPEB 4LMQE 2J6EA 2OSYA 3LHPH 4L5FL 5T1LD 4TNVF 1TNNA 3WMQA 1AIFA 2D7NA 2V7NB 1NDTA 2XXCB 3NZHH 3T65B 4XC1L 1QPKA 2OZ4A 1F1DA 5DHDA 4NM4H 3CZEA 4WIQA 2JCCA 1CGWA 2PPFA 1JNHA 5CHNA 3P4OB 3U6RA 4XXCA 3MRHA 1KGCD 3UJTH 4EN2A 1QVOA 4RMRA 5CJ5A 1R1CA 3VWKD 1L9SA 1GJWA 4CMMA 1JYXA 5DQ9A 4ZO6A 1NC4A 2GY7B 4K5MA 2BNQA 2JWYA 2HVJB 3MBED 4RDQG 7TAAA 4UOQA 3JTBA 4JFED 5FHBH 5TD4A 3OKEB 1HZLA 3QUHA 2GEQA 1ZT7B 5F7YC 2F19H 4P2RD 4JPVL 5BRZA 3CZFB 4JN1H 5IQ7H 1IAIH 2P5EA 4AKPA 3GMNA 1XF3A 3TN0B 1L7TH 2QV2A 3GJFK 4A38A 3ZE1E 4GPVA 1XZ0B 3HI6H 4LPWA 2PYEA 3FUHA 1ZGLB 4R4BA 3TIEA 1ROCA 5EO1A 3DV4A 3GK8H 5TF0A 2Z7YA 2VH5H 1OP5K 2YPVH 1F4XH 1F4HA 2EDEA 4KI5C 4J2QA 1BVOA 4EI5D 4OJDH 1OSZA 1OD7A 5C0CA 5J6GA 3L08A 4PRHE 2BHUA 4WCYH 5C0AA 5I8CB 4HX1A 1N3NA 4NNPH 1S7RA 2DB8A 4HIXH 3V9EA 4YZFF 4UZGA 3CN1A 2E74C 5C6TL 1JZIA 1L9TA 2R69L 3L9RB 5HHOB 2KYIA 4LVHC 5T1MA 1FC2D 3APCA 4LOUC 1CE1L 3GGWA 3FYEB 1G1CA 5DHMC 3TH4T 4E41A 3B3IB 5LQBL 1HXMB 2JKIS 2CBPA 3EDKA 3EJPA 2A9AA 2ZZUT 3WN6A 3KE0A 4DVRH 4K23H 4LRNL 1T6VN 3FQRB 2NNFA 1VCBC 1XCQB 1KENH 4KROB 1D6VL 4K9EL 1JFQL 4NBZB 4U6XB 2BY3A 1LO0H 1TQVA 1HWHB 4KPHL 1T04B 5IHWA 3SQBA 3EFDL 4HPYH 1MREH 1HHGB 3EYSL 1X4XA 4U6VL 5EC2B 3LRGA 5F6HI 4XN5A 3ARFB 4QR7A 4O5LH 3ARVA 1MCIA 3AACA 3REVB 1WRFA 4ZOEA 1SHWA 1BV8A 3H1ZA 3MRGB 2R0LH 2QMKA 2F7RA 3ATAA 4WWKB 4BFKA 5MHSE 3DVNB 3PYCA 3TYGL 2DIAA 3OAUL 3JWOC 2VDMB 5IQMA 4JFXB 2OMTB 3G04B 3HNVL 5FF6A 4XC3L 4JZJA 1DDTA 4Z7UF 3WYRA 3P1VA 4PLKD 5DMGD 1H6EA 1I8KA 2CHNA 3BFWA 4I0PB 1JN6A 2UZYA 1KPVA 3WCYA 3I6SA 2Q87A 3LNHA 3VQLA 2P5WA 3H2PA 5DYFA 2V33A 3NEEA 4IS6A 3MRNB 2F74A 3D6GA 4MJ5B 3IM1A 5I5IA 2VZ3A 1QBML 4FULA 1MCHA 2XCMC 3JTSA 3HMWL 3L7EA 5DHYB 1ZPUA 2QQLL 1DYZA 3BUQA 2MKWA 1PZSA 1RUPL 1GPOL 8FABA 1TJGL 2W60A 3R8BB 1MNUL 3SE3C 2GFBB 3O2VL 2LHAA 3BAJA 3UACA 5AW0B 5L2KE 3RTQC 3CFNA 1T4KA 5GGUB 3SE9H 4HJGB 2EIZA 5JNYB 3H9HA 3UPAA 2GBUA 3BGFC 1KB5A 1DVTA 3DGCR 5CEYB 4QRRE 4L8CA 1QEXA 3QUKB 4PY8J 4HJ1A 4PJEA 5B3JF 5CP7B 5F96H 3ZLQC 3DIVA 1J1XH 5T3ZL 1NCDH 1BFOA 2HUHA 4XZUB 2FR4B 1GGIH 3QEQE 2PWHA 3DRTA 2VDPB 4AE1A 2YEZA 2YZ8A 3RHWK 1YN7B 2GUOA 2BOLA 3MPCA 3WY4A 1EZVX 3S5ZA 4LESA 3GHBH 3NA9L 4JGMA 3IFLL 4JCMA 2CDFB 2GKIA 2RFXB 4GW5A 4YHKL 1GGUA 1I3UA 2GSGA 4GAGH 3QQ4A 4M5ZH 3SD5A 5I0DA 2CDEB 4FQJH 1BMWA 4M7LT 2ZKHL 2LFGA 1AKPA 3ATEA 1U8IB 5LCVA 1SDAB 3K71B 3QEUB 4FQQA 3NT0A 3GBLA 4JRXA 4G7YH 1B88A 1Q1JL 4N0UE 4OFQA 1MQ8A 1EMTH 5E1AB 4OZGF 5MEQA 3IN2A 4A1RA 5L88L 1OSPL 4K55A 1CR9L 3CHOA 3EOTL 4HS8H 1AXSA 1MAML 3WTUA 1B0RB 1VFBA 2NLJA 2NUPA 3PHQB 4O58H 3BD4A 5KTEL 3GPSA 4C47A 3CK0L 4OJYA 2EIDA 3RVTD 4NO2B 2R1WB 3OC8A 3KBEA 1UCTA 3L5HA 1EAQA 2NYYC 1TTCA 4KY1L 4QTIH 4A68A 2Z8SA 4Y89A 4Y8DC 4UU9A 1U8OA 2HTKD 4P04A 2OTUA 2R9HD 5C07E 3MUUA 4O9HL 1HHIB 2HVKB 4LSPL 4ZPVB 1KYUA 3HFFA 3OR7A 3PNRB 2I9TB 1ZHNA 4HWEH 5DD6B 5IEKB 2WY3B 3VFWB 4K7FB 1EIBA 3EDFA 3DUSA 2WC7A 3GSUA 3THMH 1Z3GH 4TULH 3DIDA 1JV5B 4BKTC 3TCXA 4GOSA 4QXTB 4QO1B 4M1GH 5IJCC 4G5ZH 4P23C 2YGVA 3V4PB 3T3ME 2WQAA 4FS0A 4L1SA 1CU4L 4NXKA 1QTSA 2IANE 1M7XA 2PETA 4JPIA 4QHNA 4EI6A 1KCBA 5JDJA 4YC2B 1C5DB 2QHRH 2QLYA 5SWZB 1AVAA 4G6JH 4UDTA 4IBSA 3DV6A 4KAQL 5EUOE 4KH9A 1AS7A 1C08B 1TYJA 2AV7B 3RPKA 1IGTA 2ITDB 1M53A 1IVLA 4I9WD 1FBIH 1S5HB 1WAPA 4PJ7B 1IO4C 1KMGA 2BVQB 4AM0Q 3QCUL 4X7SL 5CCKH 2OV0A 2ENJA 1KJVA 3ESVF 5J1SC 4NQDD 2F53D 4U1NB 1WA1X 5KVGH 3WU1A 3D4GA 2R2CA 1EHNA 3SDCA 1J5IA 2VC2H 4FQLL 2YAOA 5BO1L 1RZJH 3VNZA 5JOEA 1OZTG 5AUMB 2I9LB 4URKA 3KPRA 3QO1B 5EF3A 1TLKA 1IL1B 4W9LC 4XNMA 2KZ1B 4P46B 3L48A 1B0GB 1PD6A 5JYLA 4ICXA 4Z3FA 5C08D 1TCMA 3O9WB 5DJ0B 3U7WL 5IW3A 1UOKA 1MDTA 5IMMA 5MENE 4BUGA 3CCHB 3B2VL 3NFPA 4ZFZB 3MX0B 4YDLB 3EG9A 5D2LF 2AKRA 2EDRA 1A21A 5I0ZA 4FFYH 3ROLB 3S37X 4RQQB 3U30C 3D9AL 5DUMH 5E7BA 15C8L 5AL8A 2BZ7A 3PJNA 4MMXA 4WNQB 3TVMB 3B4NA 4ZNEE 2DJMA 1S7SA 2OSLB 2V17H 4MNQA 2MNUA 3ZKNC 4CNIA 3H7BA 1CLVA 3PY9A 1HIML 2APBA 2V9UA 4OCWH 5G55A 4JFYB 3EH1A 3G6JF 2GT9A 4XCNB 3LHPL 1MCNA 1WISA 2ZUQB 1EAPB 2J1KA 2A6IB 3Q8EA 3AJ7A 3QORA 1TXKA 3D0VA 4Y4FD 3L4WA 2EUZA 5F70A 5F21B 1F8TH 3KPSB 4Y19B 3NZHL 3OSVA 1OQXA 4PJBA 5E9AA 4PR5B 3VXRE 1H15B 1ORQA 5KZCB 5EWIH 4KK5C 5H94A 4GG6B 3HUJE 3NIGB 4CVZA 1N8ZA 3D50A 4XNAA 3QXAB 1MH5A 2NY2B 1U8MA 3EJSA 2ZX6A 2F9BT 3UJTL 1RJZB 3AS3A 2FCBA 1XSKA 2IAMC 3K5SA 4G1EB 4GBXA 1SYSA 4L48A 4YIQB 1R9FA 5D6DA 4KJPC 4NO5A 1N6QH 1A1NA 3FQ1A 4H2AA 2FUTA 2G5RA 3D85D 5GJTL 5JHLH 1W2KT 2BMKB 1JHTA 2BVTA 2RQ8A 3QUGA 2D4DA 4JQIH 2F19L 4QF1B 6CGTA 2EE2A 4HV8A 4JN1L 5IQ7L 5K9OB 1IAIL 4FZEH 4X4YB 4WU7B 2PP7A 2X6CA 4HUVB 3QUZD 1QR1B 4FLQA 1IAII 2L7UA 4GAYA 1KFGA 3MA7B 2ZX8A 4RMSA 3HI6L 3M1BB 3U0PA 2HCZX 3FUKA 3GIVB 5BS0B 5BOPA 4Y16B 2F0CA 5HGAB 3GK8L 5BZZA 3L9YA 1QRNB 4P5RA 5DJAA 2CUHA 5E9NA 1UOWA 3QIUC 1KIPB 2YPVL 2P8PB 4QXUH 1F0LA 1KBPA 2OP4H 3FB6A 4TQPA 4PY7A 3JT0A 5IQ9A 5D1ZB 5FO2A 4WCYL 3DPDA 2J21A 1R3HA 1NOLA 4NNPL 4E9XA 1IGMH 4NENB 3VYPA 5BW7A 2NY5H 3N9GH 3ARWA 1M7DA 1WCBA 3BKYH 4TVPH 5SWQA 1UM5L 4Y2OB 4CBZA 1L6PA 4U1MB 4IU3B 3W82A 2IH3B 5J9PB 4WO4C 1U8HA 4GP8B 4WWID 3KXFB 2BNUB 3I6LE 4HJIA 4QHUB 3TF4A 2ZUXA 2VLKE 3FT4B 4HAKA 2J6EH 4QJ3B 3TBVB 4TN9A 5IJDC 1NGWB 1LO0L 3RWCA 1ES0B 3GM8A 1FSKB 3FUJA 4FAAB 2V0AA 4HPYL 3H8NA 2HMIC 1DANT 2C9AA 2OZ4H 2YUZA 2MOVA 3K8KA 3ARRA 1FZKB 2X70B 1YY9C 2XVLA 3CFEB 3QPKA 5KSAD 3PWPD 1Z9SA 2R0LL 1BXVA 4R97C 2FLMA 2W0FA 5FFGA 1WEJL 2V3DA 2WQUA 4LGRB 4XPAH 3S97C 3IB4A 3VJ6B 4XMWA 2LU7A 3UG5A 1MVUB 1BX2B 2A6DA 2KI6A 4QOKE 4PRHA 3VI3F 5I1AA 3BLKA 5KBPA 4PWEA 1JZ8A 3DOHA 4N1EA 3QDJE 4YHPB 2GK0A 3AY2A 2Y6SC 4N8UA 1JWMB 2OS7A 4MLSA 1W15A 3JV4A 1OF0A 5CKAA 1YN6A 2VDNH 5BV7L 1J0IA 4B9FA 3LXBA 3PUCA 3I75A 3RVXC 1SFDA 2XN2A 2ZPKH 3JTTB 4DKEL 1M7IA 2C3GA 2OSXA 2B4CH 5EULV 4PJ8A 1OK8A 5I19L 4HPOL 3D3VE 2GJJA