2IAAC

Crystal structure of an electron transfer complex between aromatic amine dephydrogenase and azurin from alcaligenes faecalis (form 2)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
ACDVSIEGNDSMQFNTKSIVVDKTCKEFTINLKHTGKLPKAAMGHNVVVSKKSDESAVATDGMKAGLNNDYVKAGDERVIAHTSVIGGGETDSVTFDVSKLKEGEDYAFFCSFPGHWSIMKGTIELGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
molecule keywords Aromatic Amine Dehydrogenase
total genus 30
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2iaaC00
3OM3B 2FNWA 1NPJA 4DPBX 3TASA 2BZCA 4G7QB 1BYOA 3FS9A 3EH4B 1AZCA 4GYBA 2CAKA 2HRHA 2PCFA 1NWPA 2BW4A 1NIBA 3SBRA 1B3IA 2OV0A 3FYIB 4F2FA 2BP0A 3NJFA 2YAQA 2PPAA 2EILB 4EF3A 3JT2A 4A68A 1DYZA 2N0MA 1AAJA 2ZWNA 3CZUB 4QKTA 2PP7A 1RZQA 1SNRA 3PAVA 3ASNB 3IE9A 4YSDA 1HAUA 1NINA 3HEIB 4AKQA 1IUZA 2Y1AA 1BXVA 3AG4B 1FA4A 2IDFA 3CVDA 4L0PB 2XV0A 2HX9A 3TU6A 4A2EA 3ABGA 4GXFA 4DP5X 2DV6A 1J5DA 1W8EA 3S8FB 1HAWA 3GXUB 2HX8A 3UACA 3QJSB 3FU9A 2FJSA 1OCCB 5B1AB 4DPAX 2OCCB 4A2GA 1L9SA 2FT7A 4YSCA 1JVOA 4HHWA 1PNDA 1GSKA 3IBOA 3KW7A 4E9XA 1YLBB 3QQXA 1MG3C 2YXVA 4YSTA 3X1BA 5EHFA 5I5MA 3QJRB 5PAZA 1OF0A 3IN0A 2XVBA 1RCYA 1ZIBA 4GP8B 1EHKB 1QLEB 2Q9OA 4X4KA 2B3IA 2VN3A 1IBZA 3T6WA 3D12B 1W6WA 2CJ3A 1T5KA 3PPSA 3NJHA 4WKXA 1J5CA 1HFUA 3NSCA 1OE1A 4N8UA 1KBWA 5B3SB 1AZNA 2FTAA 1CUOA 3EH3B 3FPXA 1VLXA 2I85A 4HZ1A 4YSOA 5B1KA 1ASQA 3DIVA 3X1EA 1CYXA 1M9WA 5LDUA 4YVUA 1IC0A 1OCRB 4E9QA 2QDWA 1RZPA 2PPDA 3NT0A 3X2QB 1AZRA 2HLEB 1WA0X 2X88A 2XV3A 4UAHA 3FU8A 1GS8A 4G70B 3NSFA 1GR7A 1JZFA 4HCFA 3DTUB 4BXSV 3RYMA 2CCWA 4HAKA 2QT6A 4DP9X 1L9QA 4GY4A 2MTAA 3BVDB 3S3DB 3IEAA 3FPYA 5I5JA 2BW5A 3MX0B 1ZPUA 1NTDA 5I5IA 2FQGA 1BQRA 2UXFA 4DP1X 3CVBA 2H47C 3NJGA 2GC4C 3CDZA 3FQ1A 1MZYA 1OCZB 4GP4B 2H3XC 1BXAA 2PPFA 1CC3A 2Q5BA 4G72B 1NIFA 2JFCA 4YSUA 1JXDA 5I26A 2HZHA 1V55B 2GB2A 2OJ1A 1XB8A 1XMEB 3X1GA 2HX7A 1KGYE 2FT8A 4JHUA 1KDIA 2VSMB 2XYBA 1PLCA 1ZDSA 2BWDA 2YXWA 1AZBA 4RH4A 3ASOB 1N70A 1PZBA 3T9WA 3WIAA 4HCIA 2BP0B 2PP9A 5FC9A 6PAZA 1SDDA 3WKPA 1JZJA 1GS7A 1KDJA 3H4FA 1PY0A 1ADWA 2HRGA 2YAEA 3T71A 2EINB 1GY2A 2B08A 4YSQA 4KNUA 2J5WA 1JZEA 1URIA 2AVFA 3WG7B 3WI9A 5D4HA 3PLYA 4AKPA 1JZGA 2XV2A 4BXVA 5I6MA 4M3HA 4DP4X 2AANA 3ZX1A 2CALA 4PAZA 4NB7A 4JKNA 2VW6A 2YQBA 3ZIYA 5B1JA 1ETJA 2AFNA 2IWEA 4DP2X 4E9RA 5D4JA 1ILSA 1E30A 3DKHA 1KV7A 2GBAA 1PAZA 1OOWA 1SF3A 1BQKA 4E9VA 4W9ZA 3C75A 1AOZA 1L9PA 1ZIAA 1AR1B 1SHXA 3NSDA 3NJIA 4P5RA 3PAUA 1E65A 3BQVA 1N68A 1AS8A 4HIPA 1WS7A 4E9SA 5B1JC 4A66A 4Q8BA 1X9UA 2XWZA 3NYKA 2PPEA 1TEFA 1XB3A 2PP8A 3FSWA 3JTBA 2XU9A 3FSZA 1ET8A 4W1TA 3AZUA 4Q89A 9PCYA 1V54B 1AS6A 4YSSA 5AFAA 4KNTA 4KOCA 2GI0A 1EZLA 2ZXWB 3X1NA 2WO2B 4TXVB 1DZ0A 5TK2A 2AZAA 2FQFA 2GIMA 2P80A 2UX6A 1KCWA 3TBBA 1BXUA 3FU7A 2IDTA 1GS6X 2QDVA 2AZUA 4DP7X 1BQ5A 2JKWA 1PMYA 1M56B 3FQYA 3KW8A 2J57A 2VMJA 1ZV2A 2JXMA 2GHZA 1NIDA 4E9WA 1XB6A 1AACA 3AW5A 1ZDQA 3NJLA 3V9EA 2YAOA 5A7EA 1NIEA 1PZAA 2BZ7A 1ILUA 5B7FA 7PCYA 1BEXA 2VW7A 3NJJA 2DWTA 3UAAA 4HALA 1BYPA 3SBPA 3PCYA 2MRYA 3GDCA 4AX3A 4YSRA 2NRDA 4YSAA 2XXFA 2VM3A 2IH8A 2YAMA 2FQEA 2ZONA 2YAFA 4DP8X 2UXGA 1JXFA 4F2EA 2CBPA 4HHGA 3AG2B 2YARA 3N55A 1WA2X 1L9OA 2BO0A 4M4RB 3FSVA 4AZUA 2EIJB 4DP6X 1R1CA 4UANA 1WA1X 3TBCA 2WO3B 4A2FA 4G7RB 3X1FA 1A4BA 1AIZA 4G7SB 1F56A 1A4CA 1IKOP 5TK4A 1WAEA 2RACA 2GC7C 1X9RA 3PXLA 2E86A 1MZZA 1J9SA 3ABKB 1QHQA 1OV8A 1UATA 1TU2A 2QPEB 1ASOA 2VM4A 4BK5C 1AZUA 2QPDB 1NICA 2PLTA 1E5ZA 2X87A 4NAJA 4YVNA 3ZBMA 3H56A 3WNIA 2PPCA 4DPCX 4DP0X 2XX1A 3WNJA 1SF5A 3HB3B 1JOIA 4KO5A 3NJKA 2IAAC 4YSPA 8PAZA 3T6VA 2R7EA 1TEGA 1RKRA 1SDDB 3CVCA 1GW0A 4AKOA 4HCGA 4BDVA 2XX0A 3S8GB 3AG1B 2YAHA 6PCYA 1PF3A 5PCYA 4KO6A 1PLAA 1ET5A 2WSDA 4PCYA 2FQDA 3QJUB 4NERA 1AG0A 4FAAB 2ZOOA 2IDSA 3H4HA 5ANHA 4QLWA 1KYAA 3U25A 2DYSB 3WKQA 1PNCA 1OE2A 1J9RA 2CUAA 2BHFA 4A2HA 2BP8B 1JERA 2XLLA 1SFDA 3EF4A 2I7OA 1JXGA 1A4AA 2J55A 1AANA 1PCSA 2TSBA 2EIMB 5I28A 2XUWA 1ET7A 3FYEB 4YL4A 1AS7A 1CYWA 1A8ZA 1ID2A 5E9NA 1FWXA 4CSPA 2A3TA 3UGEA 2LLNA 3AG3B 2GSMB 5F7AA 2BWIA 5AZUA 5I6NA 3OQRA 5B7EA 3T6ZA 5I6LA 1IBYA 1JZIA 1QNIA 3NP4A 3FQ2A 1NWOA 4P5SA 3UABA 4E9YA 3MBWB 2IH9A 4F7KA 5B1BB 1PLBA 2IDUA 3UADA 5I6KA 5IY5B 2BP8A 3FU7B 1FFTB 1SFHA 4ENZA 2H5UA 3V9CA 1SHWA 3OMNB 3ERXA 4BWWA 2YAPA 4G71B 3AY2A 4BWTA 4AI7A 1SJMA 1TKWA 4KO7A 3PAZA 2DYRB 3QJQB 3EHBB 3QJTB 2IWFA 3OMIB 1E67A 3TA4D 4YSEA 2FWLB 4E9TA 3N2JA 1JVLA 1V10A 1ASPA 1NDTA 1J9QA 4WTQA 1L9TA 3IN2A 3FT0A 1NPNA 1M57B 2W88A 1MDAA 5B7MA 5I6OA 2I7SA 4FA7B 4JHVA 1A65A 1PZCA 1I53A 3OMAB 4N4YB 5F7BA 1AQ8A 4UF7C 4CSZA 5I6PA 3ABLB 3NSYA 4MFHA 4K9JA 3OD3A 3S3CB 3L45A 1GY1A 4A67A 1JZHA 2DWSA 2VSKB 2UXVA 1GYCA 3S3BB 1L9RA 7PAZA 1CURA 2TSAA 4KOBA 3T6XA 1WS8A 3QPKA 2IWKA 3NJMA 2W8CA 5AKRA 1A3ZA 1NIAA 2VW4A 3NP3A 3ABMB 2J56A 3GYRA 1AG6A 2UX7A 4KNSA 1J9TA 2FT6A 2HXAA 4A2DA 1MG2C 3NJNA 3G5WA 5D4IA 3SBQA 2R7EB 3CG8A 4BWUA 2UXTA 4ZK8A 3QJVB 2XXGA 4BDVB 4GP5B 2PCYA 3UAEA 1E5YA 3CDZB 1OCOB 2IDQA 3SQRA 1KCBA 4KO9A 1NZRA 1W6LA 1BAWA 2Y69B 3ZDWA 1OE3A 3FSAA 2DY2A 3EH5B 1KBVA 2P80D 2EIKB
chains in the Genus database with same CATH superfamily
1QSEE 4GINA 4G6FD 4KZDL 1S3RA 4TULH 2B9BA 4B95C 3TASA 2BZCA 4RSVA 4Z7IA 3EH4B 1AZCA 4HFUL 5C2BH 4KI5E 5JXAH 3TO4B 3H8NA 4MCZB 5IHUH 1DQQA 1NKRA 3IDYB 5IHHA 4L4JA 2MQCA 1NBVL 2OJEA 3ZE0F 4Q14A 1MF2L 3IMRA 2IGLA 5KYWA 3VWJB 3FN0H 4HEPG 5TH2B 1P6WA 3VMOA 3ZDZF 1GYWA 1R5VB 4QTIH 2ZX9A 2XTJD 4XN4A 2VLJE 2R0KH 4ORGB 3JV4A 2P49B 4QKXB 2XG4A 4NQXA 3SE8H 4UM9B 1DJSA 2AC0A 5F71A 3K6SA 5LGHH 4PP1C 1JGLL 1J05B 1JNLL 1PEZA 2BSED 3P77B 4I88A 3QXTA 5CD5D 1U8NA 4GXFA 5DLLA 5DVKA 4IJTA 4TQPA 1Z9LA 1IBFA 5CHNA 3GMRA 1IGTA 1JL8A 3OZKA 4J28A 2ZNXA 3ILDA 4XPFL 2K9FB 3QAZB 3RJDA 2FJSA 3TO4A 3T3ME 4FQIH 4FJYA 1TR7A 1P5UA 4FQQB 5HGGS 3RKDC 4HHWA 4JM2C 2AMUA 2WQ8A 5ETUA 1R5IB 2YD2A 1FYTD 3ULUD 1KCKA 2YPLD 3Q01A 4KROB 4K7PY 4JY4A 4R3SA 2P3YA 4XNMB 4Y2DD 1AQHA 2WSPA 4WW1B 1TUPA 1S7SB 2FGZA 4HKBB 3VU1A 3PL6D 5EBMA 2R2BB 4EMZA 5DXWA 1IBZA 1MJ8L 1LO2H 3MRMB 3N40F 4UM9A 5IQ9A 3A67L 4POZD 4OSUH 3GJFA 4ZTPH 3HNVH 3SKOA 4PJCF 4HK0A 1ED3A 3ZTNH 3BT2H 4N6RA 4E41D 2DQHL 1L6XA 1NPUA 4CILA 3IJYA 5DK0A 2CLZB 3QUYA 1EFQA 1YJDL 1QFUL 3OX8B 5D5MA 1PW3A 2I24N 4Y4HD 3SYCA 4EI5D 3ZE1F 1LLAA 2IO5A 1RI8A 2K70A 3BFWA 3HW7A 1VEPA 3ZU8A 4NJAL 5D7IF 2BNRA 2L3BA 1DN2A 3AUWB 3LXUX 1K2DB 5DD0H 2A9DA 4P57B 3H0TB 5EIQA 3L1OH 1DQLL 1FO0H 2GTZB 5BNXD 4LRNL 2WLYA 3QUYC 5ABAA 3ESUF 1QRNB 1ZHKA 2CDEA 3PIQB 5FV1L 1NOFA 3CFBB 2LQRA 3MJ7B 1ED3B 1F4AA 2IXQB 5G55A 4PJDB 3VXRE 4JLRA 4GMTH 4ZJ9A 4JZNB 4AZ8B 4EN3D 1DR9A 2IH3A 3ARFD 2CLZA 1IKNC 4YAQA 2K3TA 3V0VB 4EXPX 4CC4A 4XXWC 5TDPB 3V4PA 1CGTA 5D7LA 2JE8A 3TURA 1WT5C 2J1ZA 4R90L 2FO8A 5EC1A 5CR8A 3HLAB 1G6RA 1VRSA 1AD0A 3MRPB 3MV9B 1TXKA 3DYMA 4GS7B 3O6FB 1PLGL 5CCHE 2VYRE 4N90E 4S1RH 1VZHA 3MJWA 1JHKL 2D8KA 1QKZH 4KC3B 4FFWC 4NQDA 2NR6C 2J72A 1I1YA 2I5YH 2EDLA 4L8SA 3PIQA 4NQTA 1KIQB 4HHAB 5T33L 3MLXL 4IBLT 3TV3H 1RIUH 5LG6A 3WNKA 2IXQA 3UDWC 2H6UA 3VXPA 3ZRCC 4Z76B 3BW9B 3FO0L 4BHUA 3SE9L 3BP7B 1WP6A 1JYWA 4LKCB 3L4YA 2ZKHL 1OSZA 2JH2A 4OZGF 3S3PA 3PABA 1KDJA 4QEGA 2NY0C 3PXJA 2J2ZB 3QQDA 2I07A 4ODUB 4O9HH 5EC1B 3QEGL 2X1XR 1SJEB 2BMKA 2W9EH 4KKBD 3EH2A 2BS9A 4RWYH 4AVIA 1PAMA 4H88L 3P40A 4PAZA 3HRPA 4ABQA 4G6JL 3RHWK 2YQBA 3OXSB 4JFOB 5GISL 1IARB 1S4IA 3M86A 3O8XC 4GBXD 3MACH 4XMTA 1WHOA 1ILSA 4I8DA 3LIUA 4HHAA 3SZKC 1KFGA 1NGWA 3L13A 4NQCE 1OOWA 3EYSH 2Q20A 2MWCA 1TJGL 2QPSA 2EC9T 2J12B 4PW4A 4WFED 1XGUA 4YBQD 4LCYB 5ES4B 1CG9A 3KL3A 1H3WM 5EBLA 4DN4L 3BQVA 1ZT1B 1GGUA 4L3EE 5IVZB 2HG5A 5AB9A 2AGJL 5BV7B 4FQLL 4Q8BA 3AWFA 4IBYA 2ZCHL 1FVCA 1PCXA 4FFZA 4WUUD 4TNVK 3MLPA 2XU9A 3U46A 4L4TB 4TNEA 5LCVL 5FDWA 4KY1H 5LNDA 2MKWA 1A25A 4AIZA 5DDHB 1NMAH 2CBMA 4NZDA 4KNTA 1XTLA 3X1NA 3JYCA 3OL2A 5EG6C 1FFNA 4LVOC 2YJQA 2GIMA 4ZFZA 1NGWB 1DN0A 4YHML 1XF3A 3PQYB 4G1MB 4NNYB 3T0AA 2L7JA 4U1NB 4H20H 2VDNL 5HYSG 2GK2A 1YAZA 3AT0A 4UAOB 2A83B 5HHOE 4LCYA 3MLRH 1F3RB 5FKAA 5EBLB 4PJ5D 3A23A 2F54E 3IU4H 4J3BA 5C0GA 1U8PA 1G4MA 3KPQA 3OBAA 1ZDQA 3CBRA 2WYZA 4WFFE 3H6AA 4WY7L 3AQXA 3CC5A 2C3XA 3S4SG 1YPZA 5FDWB 3U46B 4EQ2A 1OF2B 2X2IA 1BEXA 5FM5M 1J12A 3RTQB 2E6QA 1BYPA 4XNUL 4PLKD 4DAGL 4YDVA 2WXOA 2WVUA 2VKWA 2YAMA 3QCUL 3UPRA 1HHJA 3GGWA 1O0VA 3DMMA 3QIWC 2GITB 2UXGA 4NYLB 4AEIL 3IXTB 1U8MB 2CBPA 3CN4A 1FE8L 3OR6A 2WXQA 3E38A 2NT0A 3G7TA 3MRLB 3QR1A 3VFWB 1IGYB 2X5PA 5KS9E 4PGDA 3WUWG 1C9SA 1IGFL 3T0DA 5E1AB 3LD8C 1ND0B 4LHJB 5T1DL 4E41A 5DUPL 1DQMH 1KGUA 1A1MA 4PY7B 4HIJB 5KUMA 2VDQH 2UZIH 1ID5I 2CXGA 1NCBL 4HIQA 2V3DA 1BYNA 5BJTB 5AW3B 1SJVA 4CGTA 1OF2A 4YC2C 3KCPA 3QARA 4Z18A 4OZFH 1U95A 2QPEB 4PBXA 1MJ7H 3IDUA 4CMHB 4EI6B 4F7TB 4X98B 5JLZB 1KELL 3CDFA 3SQOL 3FFOA 1RV6X 4UBDD 5B3NA 1EAPB 3ZYOA 4TUOB 1JE6A 1U8MA 4QRPB 2QHRH 3BDBA 3ROOB 2GYSA 1SDDB 1I7ZB 2DI9A 2P44B 4GBXB 4IGBD 4KUCD 4Q7DA 5EV7A 2AQSA 2ROXA 2CXKA 3HMXH 3UJJL 3O2DL 5GS0H 1G7PB 2HFFA 4WCYL 5D1ZB 1NC2D 4IIZA 3TCXA 1KWGA 3RVUD 1GZHA 1Q9OA 3BVXA 4ODXB 2CQVA 1CGUA 4YHZL 2IDSA 4PS4H 4CN6A 3C8KA 3ZSSA 4C57C 3MBWA 1E27B 4WO4C 5I66A 4ZUUB 5EOQL 2UYLA 3AAZA 5F7WC 1OE2A 4O00A 5BVJB 5I73C 5IR1A 4HG4K 1JZ6A 3VW3L 2X1OA 1P5VA 1G7JB 3UP6A 2FCBA 4LCWA 4EZJA 1KPRA 1BEYL 2AJUL 1DQQB 1GH7A 1KCUL 2QR0B 2D0GA 4B3EA 2R9HD 4XOAA 3QPQC 2XQ0A 4XH2A 4GI8A 5I6XB 2W38A 3PHQA 4MJ5A 1CYWA 1A8ZA 1CD8A 2AXJA 3GSVA 4NKDA 4ZFGL 3GXTA 1A14L 2NW3B 1P7QD 1EUTA 3GSNB 5JNYA 1U8IA 1DVFD 3KPRD 1ZANH 3QA3B 3VM5A 4H25B 3GMQB 3SZ6A 3ZO9A 4HS8L 1JZIA 5DJ0B 4ZMTA 3HI5L 2R29H 5IFJA 5DQ9A 3PPEA 4E9YA 3VFRB 3EUDA 2DD8H 4XMPH 4Y8DC 2R59A 4ALAC 3FUDA 3OSVA 4HJ0D 3DDGA 4MAYA 2P5WD 4FL4C 2VLRB 3JVGA 3ERXA 4LCUB 1IC4L 5J57B 2YAPA 4KY2A 2XWXA 1I3RA 4M4PA 3IMBA 3V7AG 2N01B 2AK4D 4TUJA 1JRHL 4GAYB 4J2XA 4JY4B 2PETA 2YFOA 3L54A 1HZLA 3TBTB 2Q87A 3OMIB 5GZOC 1GL4B 2NYYC 4X6FA 4JKKA 2XYCA 4R7DB 2CCLA 4M61A 1M3IA 1T3FB 3CXFA 2QSVA 1CS6A 1EXGA 1SLWA 4QR7A 3VFRA 2VXQH 2XPGA 1NUNB 1DDHB 5CZRA 2VR7A 4X8GA 5IHBA 4OKDA 3GLZA 2HH0L 1NCOA 2NXZB 2ARJQ 5D5MB 2EC9U 3VCLB 5K9OA 4Z7NB 1CLOH 1M7UA 3SDAD 3P30H 3S37L 3SDXF 3FZUD 2VLJB 4JMXA 3QFJE 4BQCA 3GZQA 1K4DA 1CICB 4HMCA 4QXGL 3TBTA 3TCLB 2NSXA 3KH4A 2RALA 5I1CH 2F8XC 1IO4C 2GHWB 4K3DL 2OTUB 5L8JB 4D9RD 1HSAA 5AKRA 2HTLD 3RJQB 2ITCA 1RP9A 3BJLA 4PYHA 1AG6A 1RK0A 1T22A 5LAXB 3HR5B 1WCQA 4OM0L 3W56A 5I0XA 3I50H 4PJFF 2FT6A 1R5WA 1X6NA 2HXAA 1YEJL 2EIZB 5ADPH 3QXAA 4YPGB 2ZPKL 5FCUH 4XVUD 4NO0B 1MFDH 5GS2H 1DJYA 4HEMA 3VI4E 3IU3A 4BDVB 4FABH 5T3XL 1KLGB 3KXFA 4XXDB 3ZT7A 3FCSA 5AW1B 5F2FA 5G4OA 4EZKA 1AMXA 1C08B 3G5XB 2EKSB 2VIRB 1BXXA 3O6FA 2VDPH 4OVUA 5C07E 1P53A 1OTTD 4M5YL 3MRNA 3SPIA 4G8GD 3L8QA 5BUPA 1LWHA 1WFJA 5HPMB 5KG9B 1NUGA 1UKSA 2P5ED 2QHRL 1KMGA 4JK0D 1P7QB 2IOIA 4GYBA 1RK0B 1T22B 3BDYH 4OAWA 2F15A 5LAXA 5MERA 2BXZA 3IDJA 4LARL 3VD5A 2FR4B 4XNQA 3EYFB 2MQ3A 4LKCA 4YWGH 4WAFA 5KN5B 4NWTH 4ZUTB 5F0LB 1KG0B 3VXMD 1ZS8A 1BFOA 4OD1L 4NIYE 4HH9B 1YEDB 4PWGA 1MWOA 3LMJH 3KS0H 2VL5A 2A9CA 3HEIB 2EKSA 2VIRA 3B37A 1TYJA 2R15A 3FFCE 3QXVA 2O5YH 3I02A 1G7MA 2DMGA 2F74B 1J8KA 1WFOA 4U6XB 5EZIL 4LSRL 1Z7JA 1CFNB 3Q8EA 5T1LD 1TLKA 1J5DA 3BD5A 3QDAA 3RNQA 3ZKND 5F9WB 4IEFB 2PYEA 2MCMA 5I0WA 4XP4H 1U33A 4F3FA 3FU9A 3F7KA 2IMNA 4G80A 2FO4A 2ZF8A 5D2LE 1BZ8A 4OUOA 2ROYA 4CSTA 5KN5A 4QCIA 4UMGA 1INEH 1S9WA 3QXUA 5IVZA 2ZKXA 3MV11 1I8LC 5FYLL 1WAPA 3MV8E 4U4BA 1OF0A 5DFTA 3VXUA 4R7VA 5FXCH 4QXVA 3RBGA 4HPOH 3LH2L 1AVAA 2VDKL 1MCSA 3K46A 4W9EC 3MNWB 4JO8A 1MAMH 4WU5B 4Z7WB 3K8LA 3EYUL 5EZJA 4BK5A 3L3DA 5J0BA 4XCCL 2B4CL 2YMTA 1CFNA 5JW3L 3TX4A 5GRXG 2BSTA 2EE0A 3CBJB 2J44A 4JR9H 4XRCB 3WEBA 4HULB 3ESNA 1VLXA 2I85A 2NLJB 1QZ1A 3AB0B 4HA1A 2EXWC 2P28B 3DHPA 4FZEH 5F44A 1MCIA 4KITB 2AV7A 3X11A 5C0AA 3WXVL 3U0WH 4ZNEA 3KPMA 5HD8C 4KRPC 3MCYA 1JGVH 3BSHA 1F6LL 5K59F 5D71H 4GRLB 1OAKH 3QUZC 4WU5A 5E9DA 4A7UA 2EQDA 4LVHC 3FQWA 3TWCH 2WO4A 3PFUA 1AHWA 3L95A 1PKQB 2CHXA 2HT3D 4G6KL 3QWRA 4IIQB 1J8RA 2W94A 5AQ0A 1XCQB 5I1JL 3CCHA 4BFRA 3NMEA 5I1GL 3DXAE 1NTDA 3VD7A 4PP1D 5C97A 1E43A 4XPGH 4X4ZA 4A7GA 2YD7A 2X41A 3BKMH 3WJMB 4A7QA 2BIMA 3D48R 4N0YL 4QJ4B 3V4VL 3UCRA 2JV6A 1G9ML 4IOSA 1G84A 4R0LC 4J3OH 4X7TA 2NXZD 3E9UA 3O2DH 5IJVB 2B16A 3O4LE 4KRMB 2X6VA 1HCYA 4KGLA 3QQ4B 4JY5H 1H15A 5F0PB 3O2VH 4ZPTA 2CA3A 3DURB 1ZLUH 4HF5H 4ZW5A 3TEXA 4NT6A 2DMHA 1CFTA 1CE1H 4S1DD 3RUGF 4Z7UF 1PS3A 1NCAH 1MCOH 1EEYB 2WM0A 1ZDSA 2BWDA 3BLKA 1A8JH 4X98A 3K4ZA 4OW6A 4Y4FD 2YPLE 1P4BH 4ZPVA 5E99L 2ZSVB 1NLBH 1YZZA 5KJ4A 1U2YA 3PWLA 5AYUH 3UDWA 6PAZA 3ROOA 1J8HA 5KSBE 1S9YB 5L4MA 3NZHH 5AVSB 3PWVB 1ADWA 4MMZA 1QI3A 1UYWH 1A6ZA 5IMLB 4N2FA 2XV2A 4MX7B 5F7FA 4BXVA 4P04A 4M3HA 4ODSH 1E8WA 2CALA 3MGTA 2J8UF 4Z0BL 1WWCA 5I6XC 5SX5K 2R29L 4OF8A 1GOHA 4O2CA 5I2IA 2HFEA 3NTCH 1LVEA 2AXGA 2AJYL 2X7LB 1EFXB 3OG6B 4MGXA 5IVXE 3NZ8B 4XNAA 1KENL 1SF3A 1UACL 1U8OA 1BQKA 4CC4C 5L2JB 3LNHA 1UEMA 3Q3GA 3TP4A 3K74B 2WZPD 5DO8A 2JK5B 1SHXA 3PWUB 1GC1C 32C2A 4PLOB 5J13C 2HJLB 2Q3ZA 5C0CA 4XH2B 4CU8A 2BERA 1E65A 5IBUB 4XWGL 3RY4A 1INDH 1U8QB 1JHTB 4I2XE 3CHSA 1F00I 1FNFA 3ZE2E 5JNYB 2ENQA 3ALXA 3V5KA 1YAIA 4G1EB 5C0FA 4PGEA 2IQAA 4DKTA 3CVHL 2IAND 2CMRH 1HXMB 2XFXA 3IS1X 4JQIL 2Y2YA 2MOGA 4Q52A 3B5TA 2ZXWB 3EFFB 5BV7L 4Y88A 3QB7C 3O45B 4ZOAA 2A0LD 2GEEA 3HAEH 4TNFA 2VDOH 3N6YA 2KDYA 4MAYB 1N5YL 3W37A 1BXUA 5L2JA 1FF5A 1TJIH 4D0CA 1Q9WB 4NRZA 4LSDA 5C0AD 2ZPKH 3IDNB 4GEIA 1A3LL 1RZFH 4DP7X 2COQA 1H0DA 3BUTA 3MRHA 4WTZA 5HPOA 4AEHL 2J57A 2WB7A 1XH2A 1PX8A 2DBLL 5GZND 1OZTG 4QHPA 5A2FA 2UY7B 1ZV5A 2CNZA 3US1A 1KELH 1WQVT 2MCPL 5IVOA 2O6CA 5IV2A 4GAGH 1CT8A 2CKBH 3L2LA 2FUQA 1T83A 3WYRA 5CJBA 2DWTA 4D0DB 3SBPA 1FBIL 2CHNA 2XFXB 1VF5C 1XF1A 4A6YH 4J8QA 3P4OA 4N20A 4YSRA 5ADOL 4J12A 3MACL 1A2YB 2GW5A 5J6GB 4OLUL 2G2PA 3KGUA 2KERA 2XBTA 2OQJA 4D8PB 5CILL 4Z7UE 1BF5A 4N9OB 4RFNB 5EEXA 1CLCA 4O4YL 1L9OA 1TQTA 4UQ2B 2Y5TB 2YMXL 3FHAA 1RY7B 3BWUF 4E9LA 1AGCB 5LGHL 4QHLA 4UANA 2UY7A 3NACH 4OCXL 1UJTA 1WBZA 1SYVB 2BC4A 1A4BA 1AIZA 1TZAA 2C1OB 3P0VH 1IKOP 4AWJC 2B15A 3MBXH 3QHTC 1UOWA 4Q9QL 2GC7C 3JWNE 2V9UA 3VGHA 3CUPB 5K39B 1QSEB 5E8DL 1RSFA 4X6DA 5KSAA 2VKXA 3P11L 4OZHF 4RETB 3ZZ1A 1UJ3B 4YK4B 5IKCA 1KUMA 2O6EA 2PW2B 3ZBMA 5I28A 4P4RA 1MRFL 2BFVL 2QGCA 3ETBJ 5L2KB 1SF5A 3Q44A 1MFAH 3QXAB 2PO6B 1JCKA 3KMDA 1FZMB 2UWEB 2R7EA 3CH8A 5C71A 1I1FB 3N44B 2C9UA 4PVNA 4UQ2A 4BQ8A 5HDBB 4LF3B 3EO0A 1SBSL 4JUTA 1W72A 4PV8B 4RZCB 2XKNB 2XQYA 2X4UB 1AG0A 1E4KA 2A9AA 1BPLB 2DJSA 4O51B 5E94B 3OWEA 4LVNC 4MA8H 1KYAA 3CHQA 1RZJL 3MJ8B 1U2HA 3PWPE 3EF4A 4XI5D 2AXWA 5GJSH 5I30L 1IAIM 3DC0A 4XNQB 2J55A 2XN9E 1DVFA 4K5PA 3HBGA 5G4MA 2MQGA 5DEGA 2EIMB 4WFFD 2OSYA 2FYYB 1I1FA 1E42A 1WAAA 5JDSA 4DVRL 1TKWB 5FO8B 5D9SA 4F8TA 2YR3A 3G5VB 5E9NA 1G7IB 1T0NB 1BZ7B 1WISA 1ZRUA 4HKJB 1OOAA 4NCDA 2GSMB 3V5HB 2JKXA 3MLWH 1UA3A 4DOHE 4ZMQA 4F7CB 3N9GL 3SPVB 4G5ZH 5I6LA 2BJML 3BN3B 1CR9L 1KOAA 3F12B 1YJDH 5EEUA 4UYPA 3BUIA 4Z7NF 1CFSA 3ECUA 1BJ1H 1BOGA 4OF0A 3UADA 1ACYH 4PMFA 7CGTA 2BDNL 5TDNA 2Y07L 3N1GC 4PLJC 3MJ8A 3HUJF 2WTRA 1DCEA 1SFHA 4HETA 2NNCA 1IL1B 2D9CA 2JI2A 3L3OB 1TPXB 5IB1B 2YSTA 5I9QC 4MZ3A 2NZIA 3F7YB 4LO9A 3CD4A 4I48B 4XXCA 4YFLF 1DVTA 1T20A 3RWDA 5KVFH 4PSRA 2XRAL 3A6CL 2BNUB 5DVNA 3WS3A 1I9IL 3B9AA 4FDWA 4GW5B 4LSPL 5C86A 3QRGL 1ASPA 1IGJB 1I4FB 2SODB 4K8RC 2MPAH 2V7HA 4PG9B 4CMHC 3QZWG 4CN1A 1U58A 1UD2A 3DHUA 3KPPA 3CNKA 3FB6B 12E8H 3O6FD 3LN4B 1HHHB 5D7SH 4TTDC 4XWOD 2XNAB 5DHDA 2Y2WA 3PREA 2NR6D 1MELA 4ANKA 2QTEA 2V2WB 5FOBB 4JY5L 2ED9A 2NLJA 4PJFE 4WSJA 3TFKC 4A7VA 3F8UB 4QXUL 1XGRA 1WFUA 4Z7WF 4MD5B 4YGVA 5D72L 1G1CA 4WSKA 5EUOF 2WW8A 4JREC 5DRXB 4ZAKD 5C0AB 2BHYA 5EBWB 3UXFA 4LBAA 3J8F7 1NAML 1N7ML 1S7TA 3MUY1 1KB3A 1AO7A 4XP6H 2IWKA 2ZOWA 3D4ZA 5DZ9A 3AXIA 2D3LA 4BKTC 3LEYH 3ZHKA 2GBTA 3A67H 3TV8A 3VTMA 2IV8A 1BFTA 1OPOA 4U05A 3ZVVA 1U8LA 4BINA 1VZGA 3FF8A 3HPJB 1FO0B 3VVWA 5I24A 3PP4L 1UVQA 3G04A 3NCJH 5LBSL 3MLSL 4L4VE 4HIHB 3UAEA 1QFUH 3B9KA 4OGYH 3SDCC 1EXUA 3PDOA 1GKOA 5EA0L 5GRYA 3IBEA 4M9OA 3MODL 3EGXB 2H8PB 3DO7B 4KO9A 4OLXL 1EGJL 4LOEA 5DJAA 2DMBA 1RPQA 2YBRA 4OSUL 1KIPB 3SJVB 3NCWA 3TPUB 3GIVB 3DECA 5FYKU 5C0IB 1QW9A 3II2A 3HE6A 1ZLUK 3WN6A 5HYJE 3FN9A 3HS0C 1MFBH 2UWEF 4LZKA 5SWSE 1BYOA 3DYOA 4DN4H 5MP6L 1TZIB 3UYOD 5DJZA 1ZA6A 3V79C 1OTSC 1YN7B 2ENJA 4HXBL 2Z1PA 3AY4A 3ZPDA 2WCGA 3CQQA 2VAAB 2PPAA 1MIML 1N5AA 5DD3L 5HGHA 2GJZB 4ZO8A 1T1ZB 2F5AL 4RGMB 1A6ZB 2G3NA 1RZQA 4P2RD 5FX3A 3ZR5A 4CU6A 3D18A 1FP5A 3U9WA 3DLQR 4DERA 5E8OA 1DE4A 2OX5A 4POZC 2H8PA 3DO7A 2A1WL 1IUZA 5A2JH 4RISL 4PB9H 4RX4D 2X6BA 4UNTA 3UOAB 3AS2A 2Z3FA 3BKYL 3CWGA 3GIVA 3I6KB 5SX5H 4GIOA 1AKJA 4DP5X 3KPTA 2NQDA 3ZE1B 4WZ9A 5DMGD 3PQYE 4P2RE 2HX8A 1AJ7H 3CN3A 3U1PA 2ZKHH 5D7SL 4F33A 2VJ0A 3Q3GB 5SX4I 4W4OC 2FLRT 3DNKA 1KTKE 4G59C 2ZX5A 4J8RB 3QI9C 1QYGH 4GRLD 2WBJC 1N5AB 4PJ6A 4XP1L 5E9AA 2DQCH 1BQUA 3ZHNA 2F54B 2KL6A 1YEKL 2X89D 3QJRB 5BZWA 1ZLVH 3SHSA 4AQAB 5I5MA 2GSGB 4XMKH 1CU4L 2YEQA 1CDCA 3D85D 4LB8A 3UTTA 3DPBA 2PWDA 3LRSA 2EO7A 4X6CA 1UXWB 3OKNB 1OQXA 5DEFB 2XG4B 1K5NB 2IQAB 3ZT5A 5F7HA 2HRLA 2VERA 4PJ5E 4CVWA 2VNCA 2YRLA 1C5CL 4IJ3B 4ZMOA 4ABUA 5CD3A 3ECBB 3I6KA 2X2JA 3BVTA 4IDLA 3TBWA 2H6PA 3BD4A 4AC2A 1IKFL 2JJTA 4KUZH 3GMRB 3TS8A 2C34A 2QPUA 1T89C 3N42B 3U82B 5LG1A 2HG0A 3X17A 3MRCA 4XO3A 2XZAH 5B1KA 4YWGL 5TF1L 5I73B 2WINA 4E9QA 1YPZF 5J11C 2DQFA 2C7UB 3I6GA 4J27A 3C5SA 4BRVA 1YMME 4R3SB 4XNMA 1H6EA 5LAPA 5BQDA 5C09A 3WFHB 3X2QB 4J7RA 4NP4H 2WBWB 1PZDA 1JPEA 1ZSDB 3MRQA 4LOUC 4YLCA 1K5NA 2IADA 3WLBB 3CHRA 4NQVA 3ZDZB 4ADJA 1JZFA 4B9CA 2DWYA 4LIQE 1MY5A 1T66D 4OCRL 1MFBL 1E6JH 1YY9C 2DWEB 3MV7E 2F8VA 5F6HI 3EJTA 3IJYB 5ECJE 4HUUA 4D8PA 1CO1A 3AQDA 3VG9C 1PBYA 2F0CA 2YS4A 2VMFA 5IQOA 1X5LA 3F5WA 4MNHB 3ZKSD 3LS4H 2AJYH 4LCIH 3ZKMC 3ARFA 3BT2L 3RWJB 2WKOA 4I3RH 1WBZB 3FTVA 5GZNC 1SQ2N 4KVPA 4G72B 4YX2L 2JFCA 1QBLH 1Z9OA 4EN3B 2XWJA 4A6YA 5KSVA 1I7UB 4DEPB 4HXAL 3S5LB 3CPLA 3FCBA 3F3HA 4JZJA 1H8OA 1V55B 1RUAL 2FAUA 1Q1JH 1MVUB 2IADB 1BM3L 1ROWA 1TMCB 3LNEA 2NY5C 1FNLA 3P9LA 1KDIA 2XYBA 2YXWA 3VFUA 1FPTL 4KFZC 2ZG2A 2OFQA 1PQZB 4GAJH 5B3JF 3I3BA 5L2KA 4KXCA 4MA7H 2BK8A 3KPOB 3WIAA 5E0QA 2DI7A 4HCIA 3E6HA 3FUJA 5IFHL 1JDAA 5GGQL 3VYPA 5EUKA 4HKXB 4IRSA 2VRQA 1QSED 2XWBA 1BG9A 3T77B 2JKRM 2DLGA 2EXSA 4LF3A 1WBXB 3F85A 4U6HA 1G6RB 4W9LC 3BFQG 1XR9B 2BVOA 4KHTL 4EN3A 3BISA 3NACL 3UIZA 3UTOA 3ZX1A 2YGVA 4YHPA 4FKKA 3L5WA 4ZUSB 5D7IA 3S5LA 4MS6A 4DP2X 1EDHA 3IFLL 5EF1A 5HGBA 3MREB 3MR9B 1LDPH 3LB6D 5JOEA 5AVVB 4HJUA 1JAEA 3S2AA 4XHJD 3OJDB 1BVLB 1ZIAA 2WXMA 4PJXE 2AJVL 4U0QB 5IFAH 4XC1H 5ESAB 5BXFB 4PJ8C 4YIQB 3REWB 1INQA 1H8SA 2BHUA 5K9KA 1ZLWK 3G6DH 4QHKI 5D9SB 4EDWL 3DX4A 3U9PL 4R2GB 1CDYA 1Q0XL 3DA0A 3J7HA 2OSXA 4M6AA 2Q10A 3BZDA 2Y36H 3BIBX 1XH3A 3RWHA 3CLWA 4JFSA 3F12A 3MQIA 1OHZA 3OV6A 2NDFA 4R97B 5T3ZD 1IBGH 2R8SL 4KHXL 4TXVB 2AABL 3K8KA 3MR9A 3LHPL 4FN0A 4K4KA 4MQXC 5TDNB 3MRDA 1RXLA 1KCWA 1XHHA 2G2RA 3RVVC 5BRZD 1YYCA 3RZCA 1RJYA 1A9EA 1SQMA 4TUKL 4GJTB 4ABVA 3LSOA 3TN0D 1XD0A 4PI2A 5ESAA 4CVZB 5BXFA 3CXHJ 1RUPL 1NC4D 1DFBL 1XVSA 2F7PA 4AV0A 4YDLC 4RWYL 2QVIA 5F0JB 5IJBC 4UQBA 3AITA 4E9WA 5H94A 4ZMPA 4PRHD 4JCWA 4B53A 2OP4H 2J8OA 5LNGA 3NCMA 4XP6L 4HWEH 2OULB 4GI9A 1BAFH 1I4FA 5HJ3B 5KS9F 4F20A 1RQ5A 1SEQH 1UADC 2GJ6E 2XWDA 5HVHC 4PRAB 4RMTA 5D2LF 2M8XA 4AIOA 3SIKA 2V5YA 4CVXB 5BMFH 2G2RB 4H44C 3HUJA 4WDIB 5IREA 2XETA 5AAPA 3ARED 1QASA 2VN7A 3HG0A 4DP6X 5C08E 1R1CA 4O58H 4RX4A 4ODSL 4XX5A 1LE5B 4WW2F 4G7RB 2E8YA 1U8CA 3LKQA 1I8LA 3EDKA 5HHPB 4OZ4B 4J6RH 4U3HA 3S36X 2ADIB 3QDMB 1Z5LA 3BEWA 4FP8L 1LO4L 4PIRF 1MLCB 1NQBA 3ABKB 2XICA 4U1HB 4R4FH 4FRWA 1TTBA 2ZQKA 1HCFX 4PJDE 3H9SE 4NAJA 4UILL 3FOMA 5GIRA 3H56A 4H1LG 1A02N 2ETWA 3FTSA 1SN0A 2A74B 1VSCA 3UFIA 3D5OF 1IC5H 1Q1PA 1USZA 3MRLA 3IFLH 3TT1H 3BP6B 5JIHA 3TVMD 1A6VH 2V7NB 4JPVL 4PS8A 4JFVA 3HZMB 4YXKL 2BDNH 3D34A 3VI3F 4JO4H 1X7QA 4GSQA 2WSDA 1MFUA 3AJ7A 2J7LA 3OVUB 4PY7A 5AG8A 4DFHA 2FQDA 1OT4A 4TSCL 4LEOA 3WXWL 4PJGF 4OZ4A 4WJKB 4N8VG 4PUBH 4K7PX 4Y16C 1NLDH 3LKPB 1Z5LB 3BEWB 4ODTL 2EH7L 3MLTA 4M02A 4LP8A 3FTWA 1LEGA 3B5HA 1NFDF 1YNTF 1E9PB 3K81A 3THML 1XT5A 2AABH 1NC2B 2X9XA 2ITDA 1AANA 2XWRA 3DBXA 4K3GA 1W15A 2VAAA 3QEHA 5T8IA 2N7BA 2ZUYA 4JO3L 1I7ZA 2AITA 2MCPH 3MRIA 2VDRB 1T1ZA 1RFDL 3RWFB 2WUCL 3POHA 4FJZA 5I1DB 1AO7D 3DIFB 2VT0A 3TO4D 1KYDA 2BM3A 4M48L 3D18B 1RFDH 4UTBH 2IFFH 5F7AA 2KQNA 1G9NH 1M7DB 2W59A 2OX5B 4ZS7H 3WE1A 4F8QA 3I75A 3CLFL 3LTVA 4JJ5A 4DGWC 5E03A 1XF2B 3ZZQA 1DUZB 4PV1C 4Q9RL 4Y2LA 4TL5A 2X12A 1MFCH 3RX8A 2FBRA 2H5UA 1IGFH 3OPZL 3EO1A 2CO7B 4PPTA 4BWWA 5IVXF 4HLZH 4XCEB 3ARDD 1VERA 2CGZA 3KCWA 2XVKA 4OUUA 1FCCA 4Y4KC 1E3XA 3OLDA 3BGFB 1RZGB 1IE4A 3T3PB 2CU9A 1EHLL 3OPUA 4JHAH 5CBEA 3BAEH 1T4KB 4MKTA 4XBEH 3QWRD 1HNGA 1M7DA 3MCKA 4X6CB 2X4OA 3KLAB 5JIPA 1CXKA 4OJFL 4L4TE 1K85A 5A6LA 4DT2A 4I0PB 5F96H 4HDIA 4Y2DB 1WIPA 3IN2A 1PG7L 1PKQE 1BBJA 5C0BD 1CWVA 1DUZA 4S1QL 2YEZB 3TBWB 3KL5A 3HNTL 2PO6C 1A7OH 1D7FA 1MVYA 1RPUA 1ETZB 2XZZA 2NQ3A 4FLQA 5I6PA 3ABLB 4XCEA 1JGDB 2OL3H 1UURA 3K6FA 1T04B 4GT0A 4NKMA 1KPUA 5GRWA 3T1WA 5AZ2H 5FEBA 4OF5A 1M6OB 3FTXA 2DL9A 3V7AE 2K78A 4HUMB 1T21A 5MEPB 4Z5RB 2A6DB 3BGMA 3VA2C 1DVQA 2F53D 4IOFC 4TQ8A 2HVKA 2VR4A 4HC1L 2Q8AL 2ZT9C 1MRCL 5EEVA 4NQEA 2D7TH 1MI5A 2Z31A 4PU2A 4NRXB 3IGLA 1B3JA 2VW4A 4NQVB 5DCCA 3ULVC 1SRDA 2G3XA 2X4SB 1EX0A 1G43A 2ZJSH 3H2QA 4MJ6B 1SEQL 4P2RB 2Q3XA 1DJZA 1LGVA 4JRXE 1UXSA 4DEWA 4V2BA 2WWKO 4F5CA 2D7OA 5AOKA 5FO2A 4X50A 4GQRA 1L0YA 3WIHL 3HRZA 3CQPA 3B9DA 4B9PA 4BWUA 2YN3A 1YECL 4LCCB 6FABH 5AD0B 4MNQD 1CXIA 1WWBX 2WLZA 2TAAA 1JGDA 2WXFA 5EU6E 5IT2L 3MRRA 3NIDF 2EDFA 1B2WH 3SYQA 2JLLA 1I7RA 3DOSA 5C6TH 4EO5A 4Q2ZB 1WZ1L 3C60C 3FSAA 4NZTL 1FC1A 2JIXD 3TCLA 2XZCL 3EH5B 1FH2A 2VO5A 1TT6A 1TEYA 2OTUA 2E7LC 1NKGA 3QUHA 1IQDA 1QI4A 1MQKH 3P9LB 2DJ4A 5SV4A 3FO2A 3N3EA 4J3WA 1VPOL 2VLKB 5CMAA 1NWPA 2IANB 1SGKA 4AYEC 2Z7UA 1M7IB 3NCCB 3AUVA 4P5KB 4APXB 4BZ2H 1TQVA 2QVTA 2BP0A 5CEZH 3FUKA 4Z7AA 5CCKL 1HINL 1KT2B 2LT9A 3DK2A 1AAJA 4LLQB 5L8KB 3RUGA 5T1MB 4QHNA 5HGAB 4NO5B 5C7ZA 1NDMA 5KYUA 2YN5A 5F1KC 3ILEA 1G9HA 4XHQA 4AL8H 5CR1A 1OM9A 1C08A 3G5XA 4J1UA 5AKVA 3WFBL 4U6VH 3SDXA 1OAXL 4GS7C 4Y16D 3NIDB 3ARGC 5AW5B 3NDYE 3L5WB 5D7IB 1Z0MA 3L4UA 2GKIA 3ABGA 2DIEA 4LLYA 3ME0B 3ZMNA 1KEGH 1L0QA 5JHLH 5CEZD 3MV7B 1SLVA 3UTZA 3HMWL 1OSYA 2WLNA 3IFOB 3MRKA 2WXJA 3FO2B 3Q5TA 3UACA 3QUZB 4OAWB 1HE8A 1BJMA 1G7LB 5F3FA 2ENYA 2WOBA 2A73B 4DVBB 2XN0A 5ABDE 2RH0A 2Z31C 3CZFB 1INQB 5B38G 5F6IB 4X7DC 4AENA 2BOBB 4PBWD 2Z8WC 3SDDC 1X4XA 4OD2B 1DANU 3CSYB 5KYUB 5GGQH 5DZOA 2PW1A 1FORH 1I3VA 5D2NE 5DS2A 1XCXA 4AMWA 5GS0D 5JIIA 1SMOA 4QXUH 3T6WA 1SY6A 1HILB 3EJQA 3VXUD 5BV7C 2YD4A 2W1NA 2CE6A 4QJ5B 3M7FB 3DJRA 3C08L 2YMXH 1BQHA 3SODB 3L5IA 1RUAH 3V10A 1YYML 1NCHA 4C59B 5EOCH 3QUZA 5T5FA 2VLRE 3CSFA 4GNKB 5CKAA 3QUKB 3GLEA 4MLSA 3ZRSA 5ID1A 1CUOA 1U91A 3FQ4A 3GKWH 3CZFA 4KQ3L 1G6RH 2P4AB 3QCVL 5DC2A 4ZW8A 5IW6A 5TJWK 1QSVA 2PPDA 1FPTH 3O3EA 1FL3B 3HAEA 2EACA 4JANA 4ZSOA 5LCVH 4XB8A 1WBYB 1MWAL 1KB5B 4E42A 5EPMB 2NNFA 3D0LA 2HA1A 3DYPA 4GXUN 3GSRA 1VHPA 3ES6B 3AABA 2WVVA 3BI9X 3K3QA 4NS0A 2IOMA 2ZYRA 2E9BA 4KK8D 3F58L 3I74A 3WXVH 3MLVH 1FQ9C 4KRNA 2JIXB 3E8VA 2X2UA 3WE6A 2AEPL 1T2JA 1N5YH 4Z7NE 2LGNA 3U6XS 2DH2A 1CR9H 4ZZKA 3CDZA 3FQ1A 3RWCA 1J5HA 1IFHL 1EWHA 3I2CL 3R19A 1GZPB 1D6VH 1MCJA 5FHAL 4XN8A 4L2LA 3DSFH 3QR0A 1WEJH 3QDJD 5I9QB 2IMMA 5E9DB 3H1ZA 5CAYB 3JWNH 2XFGB 4DN3L 5C9KA 5K9JH 5AOLA 2FGWL 3OKMB 1NBCA 2DQ6A 1ICTA 4R2GD 5CU5A 3EDFA 1A7QL 4UIKL 4DCQA 2PXYA 4B9GA 3WE6B 1B9KA 1I9IH 1VA9A 3U1SL 3T71A 1JHLH 1G7HA 2HJFA 2B08A 3Q1SH 5C2BL 1K3IA 5BRZA 1U9KA 2R83A 2VDQL 2BOCA 2C3VB 2CZNA 4MQTB 3NN8A 5T1KA 3G6JB 5HY9A 2YRZA 1H15B 4LEOB 2G0KA 1KPVB 1JK8B 1MVFA 1PFCA 4PGBB 1QR1A 4H8PA 3LRMA 3QYCA 2IWEA 2PXYC 3G08A 4JDTH 1CFTB 4OJDH 4XTRD 1A7NL 3BSZH 4XN7A 4EBQL 1RUQL 4XTRC 1UD8A 4Z3FA 1XZ0A 5HVFB 2PTUA 2ZKWA 3FT2B 5I15L 2DN7A 3VSUA 3JWDH 3WCYA 5ALBL 3GK8L 5BOPA 1S9YA 4RRPG 5KBDA 4TN9A 1N4XL 4HIPA 1NCAL 2VLKD 5I1DA 1KCRH 3X13A 4IBTA 2VN6A 3ARUA 1X9UA 2Y7QA 4XBEL 4YO0B 1BD2A 1ZOXA 5D1QA 3NYKA 4F2MA 1TCRB 4K8RH 1XB3A 4ZXBC 5EEWA 4JRYE 3G6JA 5D6DC 4YZFE 5HY9B 1F1DA 1KC5L 3MHZA 2X6AA 1KGXA 3Q2CA 3QULA 4BFEA 2EEBA 2LFEA 5JIQA 3ZYZA 4N9GB 3AREB 1EZLA 1RUPH 4F15C 3VFOB 3S96A 5JPMC 5TK2A 1TFHA 2FJHB 4H20L 1DL7L 4XPBL 3W0WB 3D9AH 3GSUA 3OZ9L 4F37K 4FFZH 4PJCB 2JCWA 5E24E 3Q1EA 32C2B 1A6AA 3ZKQD 2YA1A 3FQRB 1KN2H 2BSBA 3TYGL 1A14H 4LQFL 4NCC2 1T1YA 3ZKXB 1I8KB 2NY6D 2OMTA 4HXBH 2YRBA 1HWGB 2Y7QB 2WTOA 3IFPB 1LMIA 3ARGA 3AW5A 5JW4R 5D1QB 1X6LA 1XGTA 3WD5L 4H8WC 1N9PA 4PJAE 2Z65C 3VFTB 1A1NA 3R8QA 4NBXB 4TVPH 5C0CD 1WPCA 3ML8A 1T1WB 2VM3A 1YMHB 1KY6A 3S96B 4F57H 4ORZC 4ONGL 5FR3A 4XVJL 4G8FB 1EEZB 4H26A 2JJUA 3HPLB 1DQIA 3TJPA 2R2CA 2WSKA 5C3IA 3V4PH 2NW2B 3X3FL 2B39A 3OTTA 3QIBC 4NKMB 3W1ZA 4PEEA 1RK1A 4QHMA 1I8KA 4NGHL 1FNHA 1T21B 2A6DA 2YA0A 6FABL 2NX5D 1OGAA 2VZVA 2RACA 2JCCF 4OLWH 2GFBA 3BPCA 4OJYA 5LN4A 5IIEA 2E86A 2NTFB 4OZGA 3VFVA 2NPLX 4EUPA 4XXWA 4ODVH 3N1QC 4YDKH 2G5RA 3ZE0B 4DKEL 1BD2D 2LV4A 3QRGH 3DX8A 3UL4A 2BX5A 4ELKA 5HYEA 2CPCA 1VFMA 4ABWA 3CVIL 1JOIA 4PRBB 3DRQA 2HLFC 1TEGA 3CFKA 3HRZB 2Q2LA 2I32A 2OMWB 2LHAA 5T3ZH 4YBLC 1TIUA 4YDJA 5FGSA 2Z91A 3Q5OA 4ZO7A 1A7RH 4JKMA 2VLMD 5IBLD 2Y2TA 4PCYA 5JHLL 5HDRA 2IGFL 1GRWA 4KKRA 3WEOA 4YHKL 3UEZA 5ANHA 1XIWC 1C1EL 4DGUA 2RGSA 3ULUH 3S5LG 4HGWA 5KSAB 1MCHA 3P4LA 4HPYL 3GB7A 4IHOB 1V7ML 4W9IC 4X4XA 3WFBH 1UB5B 3UZEC 3A6CH 3V0FA 2VXUH 4UOZA 4I9XA 1DQJA 3NCFB 4W9DC 1T1XA 1IM3D 1KLUA 2PW2A 1P4BL 2Y24A 3V6OC 1Z66A 2VLME 4ELKB 4Y1SA 4DO5A 1YUHB 3M8OL 4OJFH 3H7BB 4CADB 1A6WL 4FHBD 4OCRH 2WVSA 4W9FC 1NBZB 5INDA 3IDMA 5T1MA 4FQXD 2HRPL 3AWGA 3EO0B 4BHUI 5GS3A 1R3KB 4L37A 1ZHLB 3GTVA 1E4KC 3MUHL 1AQKL 2CR6A 4MJ2A 3OPZH 1IIIA 1TVHB 4OCNC 1IBYA 3C8HA 3X12A 1XAUA 3II3A 5CXPA 3ZQ9A 1CDBA 4RVBA 2BRRL 4OD3L 1A0QL 4HGWB 1WZ1H 4N5EC 5BS0E 5LKNA 1WJ3A 3SEPA 1MHHB 4NBYB 3BAIA 3GC3A 1OGAD 1A4JB 1WD9A 1KLUB 3VXQA 4CA4A 3OMNB 1HQRB 1J0IA 1I1CA 4TSAL 4OV5B 2O5ZL 1B0RB 4G8GE 4G3YH 5T1LB 3ALPA 4FTVD 2PYFB 1ANUA 2FYYA 4HC1A 4P23A 4CMMB 3MNVA 5IGXH 1V3LA 5INDB 3MUGB 3G5VA 3FQXB 5H37G 5F72S 2ZWLT 4M8RA 3NCBB 3ZSTA 3RURA 1PYWA 3SOTA 5BZDB 2FWLB 1KFAH 1KN2L 5AW4B 2X4RB 4ALAL 4OQTL 4XOEA 1QLRA 4WTQA 5F7KC 1L9TA 1F13A 4LEEA 3OXRA 4PJXF 5B7MA 4HFWA 4Y19A 2O5XL 5JXED 2M26A 2WLLB 4IRJD 1T7ZA 3BRFA 2CDGA 1UA6L 3VRIB 2PNDA 3GWJA 1JSYA 2ZUVA 1NA8A 5FYLD 2NX5A 2ODHA 3HOGA 2FWUA 3HE6D 2ERJC 4MS8D 4N0FB 4OR1A 2ADFH 4EN2A 1QPXA 2ZCLL 1WDAA 4NUMA 4ANWA 1H6TA 4P23B 3RFRA 4TTGA 2ZCLH 3H53A 4XWOC 1YJDC 3OKDA 1OW0C 1CLYL 4RISH 4JANB 4WWID 1YEEH 1PYWB 4KDVA 5FIEA 4E42B 3EBHA 1FUNA 1BLNB 4HMEA 5ICUA 3ABMB 1GPOH 4N8VB 5ADOH 1J5OL 4P46A 1RIUL 1CFQA 2LABA 2JB6B 3BESR 3EJYD 3HE7C 1U3HD 3V5DB 2X3CA 1ITCA 4MCZA 5JHDE 5DSCB 2CDGB 5GGSA 4X5LA 4M7JH 3B2VH 3PU7A 4NUJA 5J6HB 3KNBA 1CPUA 2V2WA 1T7YA 2Z6FA 2Q8BH 2VDML 4OFYD 5DURD 2AV1B 4X9YA 3QQNA 3QBTB 5TH2A 5JPNC 2WQVA 3CDZB 2Y72A 4OLUH 4G9FB 4TM9A 4OZIE 3ZGIA 4R96A 3WFEH 1RUKL 3OLEA 2ZAHA 2JCCA 1NZRA 3JV4B 3G5ZB 3WIIH 3GINA 4B6ZA 3NA9L 4JCMA 1AXTH 3QNYB 3DETD 2KUTA 3GRBA 1FNEA 3LIZL 3VI3B 4QYOA 2GSIA 1DQTA 1F02I 2O4EA 1DJXA 2DJUA 5H2BB 2A6IA 5KBMA 1A0QH 4I1RA 2F53E 3IVKA 1KXHA 3P9WB 5CUSL 3RG1C 3SBRA 2XIDA 4FFTA 2AMGA 5H37H 4Q97A 1ZVYA 2X4TB 5FGCE 4F7MB 3HPJA 2PXYB 1QD0A 3NK3A 2AEOA 4P5TA 2BVPB 3VW3H 3VH8A 3CZUB 4OZHB 4Y4FB 5HP5A 4X83A 1SUJA 2DBJA 1TENA 5JUEL 5KOMC 4AMXA 1A6PA 2R4SH 2BSEA 4NN6B 1D5MA 2OMVA 4UQIM 3L5XL 2EXYD 4Z3TA 5CEXB 3BZEA 2DLFH 2NNRA 4DFIA 1VKXA 2BVQA 4LASH 3WN5B 4ONFL 5DEZA 4LASL 5ICXB 3CVDA 3ULUE 2F5BL 3IM1A 4TL4A 3IDXL 1BP3B 2VXUL 4W70A 2CM5A 5DMIL 3KJ4C 3ZZLA 2DWXA 4KX8A 4PJHF 4HOXA 4XVTH 1TMQA 4CW1A 3OX8A 2HKAA 1D5ZB 4O2EA 4TPRH 4AQ8C 2XXMB 2FT7A 3RL2A 1NFDE 3GSQA 1HTYA 1AGEA 4FULA 5E8PA 3V0GA 1XL4A 4HKZA 1O6TA 4DNLA 2YXVA 3T2PA 3MU3A 4JDZB 1A5FH 3OAYK 2L7QA 3OKEB 2WIIB 5CGBA 1TQUA 4AUYA 4NM4L 5BW7C 2QKIA 4Z7QB 4W6XB 5GRUH 4GP8B 4XVOA 4N5ED 3WTUA 4X8CA 2V8LA 3WAKA 4I89A 1W6WA 3UYRH 3DETC 1GJIA 2NDGA 1IEAB 4DGYL 5H35B 2R1WA 4MJIB 4PJ7B 1Q8MA 3C60B 3VFOA 3VXNA 3V6OA 4OT1L 8CGTA 3FTYA 4Y2OB 2HN7B 1BJ8A 1OE1A 3BC9A 3IPEA 4N8UA 5FGRA 4CW1B 4Y5VB 5D1XB 1FVEA 1FE8H 3UZEA 4L1SA 2W92A 4GKSB 1U8JB 3EH3B 5DHEA 2ADJB 4PJHE 5E5UB 4DK5A 5HBBA 1FRGL 3OHXB 4N3TA 3BX7C 4G82A 2ESVD 4IMLA 1BZEA 2QDWA 1RZPA 5FFLA 4O5LL 5BVPH 4XAKE 2NY3D 2Z4TA 2WIIA 3DPDA 4DKEH 4UAHA 5HDQL 4Y9EA 4G5ZL 3PWNB 4AQZA 2GY7B 5DEFA 5FWQA 4KKPA 2C1PB 1ROCA 1I1YB 4MDJA 3WAJA 3NBNA 2FX9L 3GBNL 3L6FB 4MJIA 4PJ7A 3ECBA 5F21B 3RA7H 5IEHA 1YMHA 2ESVE 3MN8A 1URZA 2IAMA 3AVEA 4N90D 5J13B 4KTDH 3D0VA 4NFCA 4G8FA 4H26B 1QUNA 3ZXAC 4F7EB 1DUYA 4NPJA 2FQGA 2VQUA 5DHYA 2ICEA 5HHXL 5E5LA 5BO1H 2OR9H 1U36A 1G5GA 3CMOL 4Q9RH 1QPKA 4CC0A 2P42B 3HJEA 3EJYC 2WINB 3T0EB 1RK1B 1MW1A 1WTLA 4QHMB 5FW8A 5DO2D 3L7EA 4GUPB 1V3KA 3WFHA 2Q5BA 4A63A 4WHYG 4NAQA 4DZBB 1LM8V 4MMXA 3HIZA 4XN2A 2L04A 4ATWA 1U93B 4ZFOL 4XPHH 1PIGA 1J48A 2HX7A 2RTTA 2E6PA 2FT8A 1PG7W 1TU2B 3QNFA 5DD6A 2WVTA 5ESQB 4PM1A 4MB1A 1NJ9B 2XN2A 4FFVC 2CH8A 3T9WA 2RCSL 5AENA 4Z77B 4I9WD 3QDGD 3RVWD 4ZFOB 1E0OB 5IHWA 5FC9A 1FZKB 2ALWA 3OGCB 1UM6L 4RDQF 3GSOB 4NNPL 4RFNC 1ZT1A 2ICEB 3S34L 3VJ6A 4YDJB 5DT1L 5HYJD 4XPFH 1LP9E 2FVNA 3RZCD 3BQUA 2OA9A 4ZYKA 1HEHC 1CBJA 4UT6H 3NRQA 1H5BC 1TQCB 2VO8A 3MZGB 2WZPA 5CLTA 5KYNA 1R17A 2F1AA 4PRIE 3OJ2C 2R9HC 2WXHA 4JFDE 1OW0A 4XP4L 5EO1B 3RWEB 5JYLA 1MVUA 4PCTA 1HHKB 4X4XB 1BW8A 2NSQA 4LAQL 4K73A 2JB5H 3DKHA 2KZKA 2FSEB 5SWSB 3FAWA 1KJMB 1KV7A 1PAZA 4W9ZA 4EE2A 5L4FA 4Z0XB 4E5XA 1T03L 1INEL 3Q2LA 4AW4A 3KPOA 4DGYH 4FL4B 1QSFE 9CGTA 4UILH 3CFMA 3PAUA 1Z9PA 4PRID 1UM5L 2M83A 5JXAL 3T77A 1WE5A 4HEPA 4Z1PA 2IDCA 4XVSH 3JV6A 1SOQA 2AXFB 2WY3B 4PREA 5CLZA 4JPWH 5I1LB 4Q6IC 3HHSB 4GRWF 3OAUL 4LBEB 2K45A 5CNHA 2G9HB 4UT9L 1AJ7L 5IUSA 3VI4F 3JWNG 5DJ6A 1NOAA 4EI5A 3QORC 5ENWA 4DN3H 3DMMB 3WTWA 3FNKA 3MLZL 4WO4D 4RFEA 3K0YA 3T04D 4FG4A 4OV5A 4WUUB 4G8EA 4Y19D 2GUYA 2OR7A 1RLBA 1IFHH 2EYSB 5IJDC 4P3WA 5D7KE 4M29A 1ADQL 3OC8A 2OXHA 5EIIB 1BOYA 2WJ5A 1WICA 1XB6A 3O0RH 4ZT1A 4DQOL 4DUVA 2YAOA 4V33A 3F6JA 4ZFQA 2BNQB 1QQDA 5LQBL 2VXTH 1EUUA 4Z3HA 1N0LB 2Z9TA 3RL1A 4L48A 5K33A 2AQ3A 2MJWA 2VRKA 4FI8A 1KTDB 3F7VA 5JLZA 3E1ZA 5ENWB 5GJSL 5JOFB 3K5SA 3TEYA 3SCMA 4ZW3A 2C9QA 3O2DA 3ULSA 5CCJA 1EAPA 4LLDB 3AQZA 1UWYA 5G2NA 1CGXA 4ZZFA 3ROLB 4LOUD 2KLTA 5ELIA 2KZBA 1HU8A 5ICZB 2BIQA 2FNBA 4HBQA 5CN2A 1CL7H 2WWMC 2ZOKA 4F9LA 4K94H 5KSAD 1GGYA 1JVKA 1MUJA 1QI5A 3C8DA 4Q9BA 5ADPL 1BHGA 1N2RA 4X8XA 5EB9A 4BCYA 1OTUC 5A43C 5HJBA 2NZ9D 2I60L 3GSWA 5DZNA 1J1XH 2GQHA 2ZCHH 4HGKC 3UJTL 2Z93A 3POCA 1PDKA 3GD1C 4N2AA 2NT1A 3BZFB 3PXLA 4KTDL 2QEJA 2YD8A 5FWRA 3FT3A 1CVSC 1CFQB 4K3HA 1G7JA 4FNLL 5CCGE 1F1GA 3SCMB 5LLIC 4R0LA 4K5LA 4DPCX 5BOJA 3WNJA 4HWZA 4BH8A 4NHCH 2YD5A 2GUOB 4XO9A 3IGKA 1XSIA 5F7DA 3QDMD 3JWOL 2EO1A 4QRRE 4J5VA 4U7KA 4IDJH 1NANI 4K2UL 5F8QC 3U4AA 3BH8A 3V7MA 5JOPD 2FHCA 4GRWE 2NW3A 2YFNA 2HKHH 4ZXBB 3BAJA 5E7BA 4RCAA 3QJUB 4B3VA 2ZUQB 1FVDA 4FAAB 2I27N 5DQ9B 4K8RL 4UUJA 1HESA 4FS0A 4KQ0A 3FRUB 4WW2C 1LQBC 2MCG1 3K71B 2HT3C 3LRLA 2G60H 2BHFA 3IDGA 1YY8A 1SFDA 4IGBB 4UU9A 1MCEA 1IMHC 1BFVH 5IF0B 3SDDB 2DMKA 3QS3A 4XVJH 4WNSA 3RAJL 4JPKL 4ALAH 4G7VH 1I3RB 4FP8H 4PB0L 1NH6A 4A55A 3VWJA 5CEZE 5KVFL 1J18A 4OZHA 4K5NA 1N12A 4YEFA 1R5VA 3BH8B 4CSPA 1RJLB 4LRIA 4L8BB 1OSPH 3ATFA 4ORGA 5CZXD 5AZUA 5I6NA 1JGVL 4M8VA 3WN5A 2W9DL 5B7EA 1F8TH 1JI1A 1R3HA 2ZX7A 5EUOB 4NQDE 3H55A 3LKPA 3R0MA 2UZYB 4ZQTA 5DRNA 1LEGB 1USQA 5DWPA 5JHDB 5JMRA 3D39E 2XY2A 3EOAB 5DHVA 4ENZA 5EF2A 3ISYA 2B1HL 1HINH 2G75A 4PWIA 1JPFB 3GSQB 5DRZB 1ZLSH 1K8DA 5AUMB 1U2CA 3PJNA 3VDBA 3BIKB 4BWTA 4HKZB 1XBRA 3HG5A 4GUCA 4PR5A 2MHAB 3HMXA 4X6CF 4H2CA 2JJVA 3UAJC 1YECH 3IT8D 5A3IC 5C7XL 3H42L 3O2WH 1H3PL 4D3CL 3DSFL 3AQYA 3H9ZA 4AOFA 3RVXD 2IWGA 4E9TA 4U0RC 5LGJA 3ARDB 3Q43A 4BSJA 5HDQH 4KPHL 4TQHA 1OSEA 4NOBA 2YGNA 2VZUA 3SY0B 4WNQA 3LQZA 1XF2A 5TF1H 5IMOB 4JHVA 2AEWA 4Y2OA 3KGTA 4R5XA 3P9MA 4JDEA 5DK0B 3AWEA 3WJJA 3UBHA 4KKCD 5JA9A 8FABB 3D51A 4N2EA 3OHXA 4C58B 5KW9L 4R2GC 1HZKA 3P0GB 3WFEL 1IEBA 1RZGA 2BVUA 1AE6L 2X40A 3PAYA 5CP7B 5AW2B 2MHAA 2BVTA 4P57A 3R06B 4FKEA 5DR5L 3RGVC 2Z7WA 4FI7A 5I8EB 2TSAA 3NIGB 4JFHD 1R47A 3ZN6A 4LEXL 4ZFOA 4OZFG 1MJUL 1J5IA 5HGDB 1ZHKB 2CDEB 2DYPB 4WK2B 4HDIB 3TZVD 4Z8FL 4KGJA 1ZE3H 3QFDA 1G6RL 2WBJB 3GRWH 3FHEA 2IAMB 4P99A 2DQJL 2FR4A 1NMBH 1SY6L 4XP5H 2X89A 3A4EA 1NFDB 1MCOL 2OMYA 4WFGE 3V0VA 3T8XA 1JDCA 1CICD 2EUWA 4FXGC 1FG2B 3FULA 4XPAL 5D6CA 5JIKA 4HLZG 5CIPH 4W9KC 2Z7ZA 1PG7X 2VXSH 3MROB 2X4NA 4DZBA 1A3RH 3B2XA 2VDNH 4N1CA 2OMXA 4U6XA 2ZKYA 3C5JB 2M1KA 3N41B 5HDBF 4IBVA 2XPZA 1KIQA 4NJ9L 3MLWL 3O41A 4OF7A 2ZICA 4MRBA 4YHLH 5JW5A 3L5XH 3WTYA 3WU1A 3PNWB 1GGBH 1HHIB 3TEZA 3EZ8A 3WIFA 2NMSA 3DX1A 1CLZL 4OLVL 4G11A 2C7FA 4S1SL 4FG0A 3TA3D 4JO2L 1G94A 3CE1A 2E7HA 1S9WB 3LQMA 2GIXA 5KS9A 4X8JB 1AR1D 2H9GB 3ZMRA 4PIBA 5E51A 3T2QA 4K9EL 3UEQA 1HAUA 4E41E 1YEGL 4NO3A 4ZUWA 4JG0L 2QMJA 4JFFA 1P1ZA 2Y1AA 3HE6C 3QNZA 2VDRL 2F61A 4JPIA 3BVWA 1SJXA 4ISVB 3WEAA 2DMCA 5ERWA 3QIBB 2X42A 1I1AB 3KPRA 3O41B 4N8PA 3RY6C 2P24B 4OKVA 4UQAA 4X6BA 1S78C 2A4ZA 3BN9C 4LDEB 5KANI 1OCCB 5IK3B 3P0YH 1V3MA 1JGLH 1JNLH 1JN6A 3ARDC 5MI0C 1JNHA 1KT2A 2FX9H 2A4CA 1FNSH 3MJ9L 5EHFA 1MQKL 1S7UB 4RNRB 1OWRM 4HPOL 5HGAA 2E7BA 2APWA 2Y3AA 4I18A 1ORSB 4QGTA 3SOBH 1RCYA 4UT9A 5GGUB 3CVHA 1P84K 1ZLSL 1P4LA 5I0ZA 4JFFB 4AG4H 1P1ZB 3QNZB 2K8QA 5FYJD 3KPNB 3BVUA 4JFXB 4L8DB 1QTPA 4UB0L 4AGOA 3NJHA 5D72H 2EIBA 3OJMB 3QORA 1DSYA 3FO1A 1IAOB 2XG5B 4K3JL 1KN4H 2FL5B 3D08A 4KK6C 5JO5A 1W9XA 3QI9A 3A5VA 3T0EC 3EAKA 1FN4B 4LCWE 4PRPD 4HJTA 1AZNA 2OYKA 3LZNA 2Y6SD 3FPXA 5JA8B 4N26A 4L0YA 4UINL 2FIRT 1F4HA 1ZXKA 2EYSA 4HBCH 4P59L 5DZVA 3BAYA 3JVGC 4N0UE 3T3PE 1EJ6A 4KK6D 1NMBL 2BIIA 2E9GA 2E7CA 2N3JA 1ZHNB 4JFEA 5FS5A 5EIIA 3KGSA 1HH6B 4GW4B 2ZG3A 4MXQD 4MVBC 3RU8H 1H9DA 1AQDA 1SOKA 1UWEH 2YXMA 3CVHB 1UM5H 4LGSB 3FQTA 3P73A 5BMFL 1FAIH 3KYNB 2R4RH 3GJFK 4ZFGH 5D93B 4PJBA 4HZLB 5MHSD 2JWYA 4GXVL 4UQCA 3KLSA 3BSZA 2TRYA 3F7VB 4HU2A 4APQC 1XCWA 3NEXA 4LSTL 4P4KD 4G43B 4B9KC 4NENB 1DEEB 5TGBA 5DVMA 3QHFH 1DQLH 5GGRB 4QRTA 4P07A 3DRTA 1U91B 2QSTA 4HIIA 2YD6A 1EERB 3HZYA 3R1GL 4F58H 3DUSB 2FECL 2EEFA 3DI3B 1B4RA 2ZXQA 1ZAGA 4GMTL 5IW6B 2ZXAA 4M00A 3WSQL 5I1HL 1HWWA 2OJZL 2C3HA 3FUMA 2KMWA 3ORJA 4ZSOB 1LP9F 1QFHA 1U8KB 3A4FA 4MXVF 1KB5A 5EPMA 3BZFA 4WWPA 3KCPB 3LHPH 3ES6A 4K71C 5CM1A 3FT3B 2A6JB 2KPWA 1ZVSB 1HI6A 2WLIB 4UM8A 5EZOH 2DKMA 5GRJH 1MCQA 4L3ED 2DIBA 5F7NC 2A9ML 5HXMA 4WUUE 4U6TA 4KROD 1BGXL 1UH3A 4JQXC 4M7LH 4J4PD 3QGVA 2ZTBA 3QO0B 4PBDA 3QDJB 5B39A 1I1AD 2MFNA 2BPBA 3U2JA 4KJPC 5C92A 2C9PA 3KH3A 3RZWA 4LVNB 4RAVB 3PY9A 3KJ4B 1CL7L 3UBXB 4NAMA 3FT4B 3MAWA 3VYNA 3PGFH 3EOYG 3BH9A 4HOWA 3C8KB 5B1JA 4EJ1C 4M1CC 1KYUA 2GK0A 1W0VA 1ZJAA 3SGJC 5BVJA 3LRHA 3QRLA 2DM2A 2GBAA 4XCYB 2LAAA 2WLMA 4FG2A 4RBPH 1K4CA 2R1XB 2IANE 2G5BB 2VXTL 3UTSD 2QSCH 4XC3L 4LHUD 2R0KL 3GXIA 1CXLA 3HFFA 4YUEL 1N68A 5AZEH 1E3ZA 1THCA 2P5PA 3VMPA 3MBEC 4LKXB 1I8IA 3QIUD 4WKZB 4JQVA 3WEXB 3WNLA 1TEFA 4PUBL 1U8IB 3JXAA 4F92B 3MRFB 1OGPA 2WKOF 1L6ZA 1E5CA 2QKSA 3FT4A 5SWZA 2R2HA 3VNYA 3VXOA 4KV5F 2WO2B 4GKOA 4AT6A 4NGHH 4RFOL 2CIKB 3B6SB 2E7LA 1E8YA 4PG2C 4CBZA 3P77A 1KYOJ 1M56B 1NAKH 4ELDA 5C0BA 5HHQA 4QRRB 1MF2H 1K8DB 2OI9C 1KGJA 2YKLL 5EF0A 1D6EA 1D9KA 1CDIA 1N6VA 2ZOLA 1C5DA 3O6FC 4FNLH 2YOAA 3ENEA 4GO6B 4WKZA 3V9EA 4ERSL 2DQGH 1Y07A 3K4AA 3KBFA 3CUPA 1SN2A 4X6FB 1BIIB 1LEKB 1I9JL 2APTA 3QEUB 5E5MB 4DPRA 3EDJA 3CFBA 3GS4A 3MJ7A 2D4DA 3TCTA 4AX3A 5AW6B 2CRZA 2R0WH 5SX4H 3QZWB 3APFA 3LVEA 3REVA 1OAQL 1D9KC 1WSST 1FGNH 2YWZA 3P9MB 4JDEB 4LCIL 4HHGA 1JK9A 4LSSH 2YARA 5D7LB 3SGDI 8FABA 1R9FA 2BZDA 1CFBA 5EIIG 5C0BB 1DBKH 2QJDA 2WYIA 4YGAB 4XNBA 4CN4A 3WY2A 1NEUA 1S7QA 1CD0A 4ZW7A 1Q72H 2Y7MA 1T7XA 3VXSA 2WZ0A 4G2AA 3TBVA 2CHZA 1C5DB 5G5DB 3HE7D 1UM6H 2A9NL 3ARPA 5KJRH 4YDLB 4K5MA 2XQBL 5FA4B 1NCGA 3VI3E 3HCVA 2RQEA 3F7PC 4BUQA 3T8MA 3B2PA 5HGDA 3WL9B 3EFOA 3ZUCA 1QHQA 2BCMA 4Y2DC 3OAWA 1WUZA 1BLIA 4JFTA 5E95B 3ZL1A 4DP0X 3T4AC 3KBHE 3BW9A 1A9VA 1R5WB 3FZUC 1I3GL 1PSKH 3D2TA 4S11A 3LNGA 1FFOB 4NO0A 4TOYL 2CRIA 1CDJA 4BDVA 1YEKH 3TF7C 3AM8A 5TE6H 6PCYA 2YQ2A 1R3JA 5EU5B 4AVJA 1MN4A 3K72B 4ZNEE 3L16A 4NN5C 4NERA 2CJUH 5HDLA 1ZGLM 2D2OA 3GMOB 2Y06H 1DBBH 3CX5J 5F1IA 5JW4N 1E2WA 2X28A 4N28A 5E2VH 3U7WH 2DYSB 4PVBA 5E9DE 1H19A 1V3JA 2NTFA 2EABA 4OZGB 5AALA 4MNQA 4EUPB 3CHPA 4L9DA 3KGRA 4J2QA 5TD4A 5BPPA 5JDJA 5KBPA 4GW1A 3DX8B 2XBDA 1LNUB 1CG9B 4WTXA 2FK9A 4HSAC 1PJWA 1EO5A 1NAKL 2FH6A 2OMWA 4KK5D 3UAJD 4QTFA 3UBGA 2EDNA 4H0GA 2Z91B 1FVCB 1MAKA 4XMLL 3K0WA 3AG3B 4Z7QE 2YD9A 1UB6A 1KLFA 3QISA 1L7TL 4AXWA 3WS3B 1NCWH 4M1CD 1HYRC 3QUYD 4HGMA 2G9KA 4HJJL 5C0NC 2F74A 3ULVL 1V27A 4MMXC 1WCBB 2LAGB 3FB6A 4BH7B 3BT0A 1OTUD 4PVLA 3HJ0A 3ML9A 2WBKA 4ZFZB 3B2DC 3FH7A 1CF8H 4JFUA 2BINA 4Y16B 2L7EA 1UUNA 3FU7B 4JW3A 2H1PH 1W91A 1WZAA 1KB5L 3EOBA 5AZEL 2RD0A 4U2YA 1D5XB 5CFAA 2DM4A 4A6YL 3PL6C 4NN7B 4MBRA 4RGOL 2JTDA 3TNMA 4UDTB 5FKAB 1KEML 1XGRB 1Q9LB 3LZPA 2H0JA 1OAQH 2WOYA 2AQQA 4FEIA 1IC7H 5CSGA 1OB1B 3II1A 3EHBB 2IWFA 1ORSA 3UTSB 4M48H 4JGMA 1UB6B 5C07B 2ZYHA 5FO9B 3TFBA 2APFA 1KCUH 1W0WB 5E2UH 1KBKA 2IFGA 3L3IB 2OCFD 3MVSA 2KZWA 3NEEA 2IG2L 1TPXC 3IXAB 4RBPK 1HH9B 5C0DA 5F7UA 4F91B 5I17A 2GITA 1E6OH 1PZCA 2PR4H 1T66C 2LLLA 5TDOB 3PHOA 1FN4A 3CFQA 3ATDA 1LQSR 2VQ1A 2DQDH 2ZNWA 2OJZH 5MENA 1ZVHA 5C0EA 5DJXB 4HIHA 1TZHA 3F6IA 4YLBA 4CDGC 2PYFA 5EOCL 1N10A 3DO3A 3FMGH 1AQKH 3V4UH 3MUGA 4JG9A 4KDTA 1WTGT 5E8EB 1A1MB 4UV7H 4I2XA 2CM6A 2HMID 3FFCB 1VAHA 3TJHC 4KHTH 3BRDA 4NKQB 1QACA 5CSZB 1KIPA 3SJVA 3P2BA 1CURA 5FO9A 4D9QE 2B4CC 3KPLB 3O3DA 4AQEA 3VSTA 3QQ3B 1NIAA 4OT1H 4U1SA 2ZP0T 2VDQB 5F9JB 2KLRA 3VU2A 3E8UH 4CGUB 3ESOA 4FC3E 3MNMA 5KVFE 5I17B 2R2EB 2WLLA 1EAOA 1XGZA 2XCMC 3BWAA 5TGBB 1HKFA 4HCRA 5AWNL 5DTFB 3T0WA 1TVDA 1J0KA 4QRTB 1KBGH 2ARJA 2D3NA 5GPRA 5SWSD 3QJVB 2O26U 2PCYA 3RIAK 3VWKC 3QHFL 5J5EA 4KI5D 1OCOB 4PJAF 2KH2B 2OL3L 4I9WE 1O7SA 4OZFB 4X5PA 1BAWA 3VAEA 4G9DB 4Z7WE 4LFHD 2V2TB 2H26A 3W9EB 3PGFL 3WHE0 2JKSA 1E50A 1R3IH 1BLNA 1E27A 1RSYA 4ZUUA 1AKJB 2GT9B 3CH1A 4FADA 3O11B 5IR1B 2A6JA 3J2PA 3U1SH 5SV3A 2YLHA 3ALWA 4BFFA 3INUL 1GC1H 4PJ8A 5DU7A 3VXTA 2A4EA 5EORH 3ZHFA 2QR0A 2N1KA 1ZTXE 3NFSH 3ZMEA 4DW2L 3DOHA 3N41F 2BY1A 3QDJA 5DJ8A 3JT2A 3WKYA 1QSZA 1H3PH 4D3CH 1EHAA 5K9JL 2EDXA 5DK3A 2O6FA 2DLHA 1Q90A 1ZT7B 4RMQA 4WFGD 3DVGA 2Z4QA 4OZFA 4O02A 2P5WA 1D3CA 5I8OL 3IF1B 4H25A 4Z7VF 4KXZI 3MGTB 4ANVA 4XCFH 2XV0A 2HX9A 1KYOK 3MLUL 3M07A 5JQ6H 1MH5A 1SHSA 3L7FA 1EFXA 3NA4A 4YH6A 2NXZC 4R97C 4BKLB 4JKLA 3SDAB 2YEVB 1U8OB 1QA9B 3EO9L 3MV01 3QJSB 4L3FA 5C07D 3RWIA 4UI2A 2R1XA 3E80A 3T0XA 2D03L 2WLKA 2X4TA 3C6LD 3BPOC 3MYJA 4OBRA 2WLHA 4S0HA 4RIRB 4YSTA 3EUUA 5DMJB 3LEVH 1YEWA 2VE6A 1S5IL 3OR7B 3TIEA 2XVBA 2Y25A 2HVBA 2FWOA 3G6DL 2R4RL 1JWSA 2E7DA 2I69A 3AM8C 4PGEB 4LESA 4YL9A 2E75C 5CFHA 1REIA 5TFSL 1T5KA 1JF5A 3PPSA 4B41A 4E0RA 4FFZL 3VXOB 2X0WA 1MH5B 4GIAA 1FYTE 4LP4A 3BPLB 1EAJA 4UQDA 2DWEA 3FFCD 4A04A 4PRDB 3MLSH 3SSGA 4JZOA 1X4YA 1X4ZA 4LNRA 1E4HA 2NY1B 3RWIB 1Q9WA 4NRZB 2ENPA 3MRJB 4TKWA 1P5UB 1T6BX 4V1DE 4RFOH 1DSFL 3D25A 1AGEB 2RIKA 3KVDD 3QG7L 1XQ4A 5GHWH 3HNTH 1D9KB 1R19A 2B59A 2XWJB 1AFVL 1WA0X 2X88A 2XV3A 1KXQA 1G1YA 3IJ7A 3FU8A 1E40A 5EBMB 5C9JB 5C08D 1YEIH 4N85A 1GAFL 1HSAB 1GR7A 1JRHH 4NHCL 4MNGE 4M1DH 3K2UH 4XZ4A 1OO2A 4YJZL 2GCYA 3T8VA 3DX7A 4UOQA 5KOVC 1YSOA 2NY7L 4JN1L 2FJFA 1KGWA 3BVDB 4GQ9H 3JTTA 2DWDA 3IU4L 1QFOA 4DKAA 2AK4A 2IQ9L 3V52H 5J6GA 4N68A 2QFPA 2XQYK 2EDRA 1N26A 4P2OB 5I5IA 2Z8VC 4U1MB 4HKXA 4IRSB 1VCAA 2EH8H 5LCVA 5IMMB 1EK3A 1L5GA 1QEWA 4XXDA 2K6YA 1UA6H 1QBLL 3O6MH 5EDXA 5CBAB 2BNRB 3UYRL 4FA8A 2YRPA 3LHAA 1X5IA 4Z7VA 1JXDA 4UQEA 1MNUH 1KBGL 2OTPA 3S3JA 3H0TA 4XCNB 3TLRA 1SJHB 2W5PA 3V8CA 5ISZD 4AVKA 1XMEB 3X1GA 3PWJB 3WL9A 5KG9A 3SYOA 1E8ZA 1OB0A 1P7QA 4PLJD 1E3FA 4PLNC 3ASOB 4LLAA 3EBGA 1RZ7H 3QCTL 3T5WA 1CF1A 5CLYA 4K0OA 1QUNB 2PP9A 4ES8A 2DBLH 3BFOA 2IBZX 5TDPA 3RLSA 1EO8H 3V4PB 4C54A 3W5NA 4KAQH 2D03H 3JZYA 2HRGA 2BIHA 2EINB 2EADA 2HTKC 2N0KA 3FFDB 3EO9H 3GMNB 2XIIA 3H2WA 3TTSA 3NCYS 4ZD3H 3L7EB 4GUPA 4XO5A 1I9RH 4NPKA 4AKPA 1DTUA 5E6RB 1G0YR 5FUOL 5I1AB 4TUKH 3SDCA 4OFDA 1DBMH 3I02B 1BSIA 1P6FA 4FABL 2VW6A 3KR3H 3U83A 3ZHDA 3ZIYA 3GZPA 1AO7E 4BFIA 1RIHL 3S4SB 5LHDA 1ESOA 3PWJA 1LK2A 3RNQB 3NJXA 1IILE 1QX1A 1RH8A 1CFVH 2FHFA 3D87B 3LV3A 4WI7A 3VXPB 3DHMA 1HWHB 2DQEH 2GBUA 3L3GB 2XTJB 4TNWK 4Z77A 3BP7A 4KTGA 5FGCB 1OHQA 3IRPX 4BKSC 4DW2H 1FZKA 4CJ1A 1WV7T 1MREH 1W72L 1A7RL 3VH8G 1OM3H 5JDSB 1SHMA 1DBJH 3LPWA 4NWUL 1XDTT 4KRPB 1KENH 5CJOL 3GS0A 4Z8FH 1GGTA 4CNIA 4NI3A 3N0PB 4EIUA 5HHOD 1AOHA 2NUPB 1WZLA 2D73A 2HT4C 4N1EA 3QDGA 4LEXH 4AYSA 2D3VA 4JFOA 4TMPA 4JE0A 5GQBA 1L0PA 3SKMA