2IAJB

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with atp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
427
structure length
415
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
total genus 103
structure length 415
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2iajB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajB03
1KLMB 3CDWA 4ECXA 3DLEB 3HVTA 3V6DB 2OPQB 2HNDB 4EO8A 3N6MA 2OPPA 4DG1A 4J9MA 2B43A 1JLAB 3FQKA 4MKBA 4K4YA 3IN5A 3TAMB 4F4YA 1LWEA 4O4GB 1HYSB 3DI6B 3GILA 1RTHB 2WCXA 4Q0BA 4G1QB 2UUTA 3PVXA 5KFSA 3ISNC 2E9TA 4R5PB 4WYLA 3Q8SB 1SH2A 1JLCB 4MIBA 4IRDA 2B6AB 3EZUA 4ZVHA 3PW4A 4NRUA 4FBUA 1N5YA 2AX0A 5C25A 1VRUB 2YNFA 4LSLA 2OPSB 1FKOB 2IC3B 4O44A 4MKAA 3Q8RB 1HQEA 3OL6A 4JV1A 4H4MB 2F8EX 4TXSA 3V6DA 2RF2A 4GC6A 2JEJA 3CWJA 1TL3B 3KLGA 3MR5A 3PR4A 1JLEA 3BQ1A 4ECWA 5KG2A 4U7CA 5KFLA 4EO6A 1S1UB 3C6TA 3QIPA 3H40A 1RT5B 5HROA 2HAIA 2R8HA 3V6JA 2I1RA 2AWZA 5KFUA 3ITHA 5J2QB 3V4IA 3D5MA 1RT2A 3IS9B 2FVRA 5KFTA 5KT5A 4K4WA 4F4WA 3RB0A 3KLIB 5I3UA 1RT4B 4R8UB 2HNYA 2R8IA 1FKPA 2YKNB 1EP4B 3MEDB 4NLOA 5KG6A 4NLWA 5F8HA 1FKOA 2IC3A 4WXWA 1FK9A 4IFVA 3JYTB 3V81A 3H5XA 2BANA 4URQU 4Y34A 3T5JA 1QE1A 1JLFA 3I5AA 2O5DA 5KFFA 1HNVA 4KV8B 3MFHA 1UWBA 3I0SA 3LANA 4RW4B 5HBMB 4U6PA 3MR6A 4EYIB 2IJNA 2ASDA 3VQSA 4NLQA 2UUWA 1RA7A 4NCGA 4QWCA 3T1AA 4H54A 1T3NA 1HPZB 2BQRA 1GX5A 3DOLA 2YNIA 3H5UA 1RTDA 4NZ0A 1RTIA 3M9OB 4ED2A 1S9EA 3DMJA 2ILZA 4RW9A 4RW8A 3CJ3A 3E51A 4ECQA 1HNIB 4WZMA 3SFUA 1QAIA 4RNFA 1RYSA 2J6TA 5HP1A 4RUAA 4MIAA 1QE1B 3BSOA 5KT6A 1KLMA 1QAJA 1IKYB 1S9FA 1ZTTA 3I5BA 4DG1B 3KLFB 3BQ0A 1HQUA 3UDLA 3DLEA 2WONB 3I5CA 1RAJA 4Q8FA 1S1XA 3KJVB 2XCAA 3G86A 1TKTB 4IG3A 4MK9A 2RDIA 4RNNA 4ZHRB 3MECA 4MFBB 2WB4A 1TV6A 3DYAA 3DOKB 2B6AA 3BSAA 4KSEB 1IKVA 1DTQB 3PJXA 3NBPA 1N6QA 5L1IA 4J9KA 2R8JA 1VRUA 2YNFB 3HKWA 3QLHB 5F8LA 4I2PA 4GC7A 3GIMA 4I7FB 3DRSB 1C1CA 3IGNA 1R0AB 4ECRA 1SV5B 2V4RA 3NMAA 4O44B 4LSLB 2ALZA 1N48A 5J2PB 3IGVA 3RAQA 1N4LA 1OS5A 4J9PA 4IQXA 1YVFA 4KO0B 3IRXA 2BRLA 3V6KA 4XO0A 2FLLA 5KFKA 4IDKA 4R5PA 2W7PA 4J9LA 1TKTA 5C5JA 4IG0B 1JKHB 3DM2A 3KK3A 4PWDB 3OSPA 4ZP7A 2D3UA 1TKZA 1GX6A 2IM2A 4TQSA 4F4XA 3PW7A 2IMWP 2DPIA 4NLGA 1N5YB 4K4UA 1T05A 3KHGA 4PUOB 2HNYB 1ZTWA 1LW0B 2XI2A 1IKVB 3KLEB 4J9SA 4EBCA 1NHUA 5K14A 3OL7A 1D0EA 2FJVA 4NLYA 4O3PA 4I2PB 3Q8PB 4LSNB 1JLEB 4IFVB 3V81B 4TYAA 5KFEA 3DDKA 3MTKA 4F4ZA 4IH6A 4K4TA 4ECVA 3RBDA 3KNAA 4Q45A 4G3IA 1RA6A 3T19A 3BSCA 4URGA 2BANB 4RW4A 2HNZA 2IBKA 3C6UA 2FVQA 2HNDA 2W9CA 3OHAA 4R8UA 4FS1A 4NLRA 1LWCB 5FDLB 4RNHA 4QWBA 4ECTA 1S97A 1EETB 2E9RX 3ISND 3I0RA 2C2DA 4ZPAA 5F8GA 5T14A 1C0TA 4TLRA 4DEZA 5KFIA 4QWDA 1TP7A 1WNEA 4Q0BB 3T5LA 3KLEA 2JC1A 5C24B 3MR3A 4H4OA 5L9XA 5JUMA 5DG8A 4TQRA 2UVVA 3QGHA 3H2LA 1J5OA 4IH5A 4TYBA 4Q44A 4ZP8A 2OPQA 3FDSA 4M95A 4RNMA 1LWEB 4XPCA 2BE2A 4DL2A 5KFCA 3GIJA 2BRKA 1HQUB 3N6NA 4MK7A 2YNIB 3H4DA 3CIZA 1HYSA 1JIHA 4DL6A 2IM0A 3FQLA 3GV8B 5F8NA 3E01A 3PW5A 5KFPA 1JLCA 2YNGB 4ED8A 2ATLA 3D28A 3KHRA 1RTJB 5EUHA 4YR0A 3BGRA 5KG1A 4RUCA 3FRZA 4ED0A 1S4FA 2OPSA 3NAHA 3IG1B 2ILYA 1S9GB 2VG7B 5J1EA 1VRTA 4K4SA 3PR5B 5I3UB 4I2QB 5DG7A 1K1QA 1CSJA 2W8LA 1JLGA 1RT3A 1IKXB 2GC8A 1N56A 5JXSA 1SV5A 1FK9B 1S1VB 3DLGA 1TVRA 1C1CB 1XR6A 2AGQA 4ZHRA 2V0NA 4IKAA 5KT2A 5L1JA 3IS9A 2AU0A 2ZKUA 4ID5B 2FVPA 3QIDA 5KFMA 4QW8A 5EWGA 4ZPDA 1S6PB 4WXOA 3PW2A 4HYKA 4J9OA 1XR7A 4RW6A 1S1WB 4I7FA 1TKZB 1FKPB 2YKNA 4F50A 1S9GA 5K14B 2E9ZA 1T05B 2IJFA 4NLDA 4RU9A 2OPRB 5J2NB 3QZ8A 2RKIA 3KMSA 3G6YA 1JLGB 3KK2A 4ED3A 3G6VA 4O3RA 4WZQA 1S0OA 4KB7A 3HVTB 4IDKB 4EEYA 5F9LA 4NCGB 4WFXA 5HP1B 1HPZA 2R2UA 3C6UB 3KLHA 1RTIB 5I42B 3KHLA 3MFIA 1RTHA 4PUOA 3EPGA 1S1TA 4MH8A 3LP2A 4KBIA 4Y2CA 4LSNA 1RDRA 2I5JB 1JLQA 3KMQA 3GV7B 4IRKA 5J2MB 5CYMA 1SH3A 3NKYA 1HNIA 4KHRA 2GIRA 4O4RA 4DL7A 1RT7A 5DGAA 5KFAA 1S6QB 3PHEA 3KK2B 5DLFA 3DRRB 2JEFA 1J5OB 2OH2A 3KK1A 4NYZA 4ZVGA 1DLOA 4NLPA 4IR1A 3GYNA 3I0RB 3LAMA 4ZMMA 3DRPB 2YKMB 2BE2B 3QGGA 2IAJB 4IR9A 5KFNA 3CVKA 5KFVA 3DYAB 2DPJA 5C24A 4KFBB 3NAIA 1DTTB 4O3NA 2W9AA 1KHVA 4ECUA 4O3QA 4WE1A 5HLFA 1K1SA 5CYQA 1BQMB 5KFJA 1RTJA 1TL1B 2AGOA 3SI8A 2UVUA 2IM3A 3EPIA 1S0NA 4ICLB 3TVKA 3JYTA 2QV6A 4DL5A 4DL3A 4B3OA 2B5JB 1IKWA 3BQ2A 1HNVB 4KV8A 3E01B 1DLOB 4IG0A 3KK3B 4PWDA 1TVRB 2HWIA 3H5SA 2YNHA 4Q8EA 4RW7B 5KG7A 2JEIA 1NNDA 5KG0A 4J9QA 1LWFB 4NLUA 2C2RA 3DM2B 4KKOB 2WOMA 4JV0A 2VG6B 3IG1A 1T03A 4ZP9A 4LQ3A 1LW0A 3CJ2A 5D3GA 5J1EB 2XGQA 1RTDB 4ID5A 3M9NB 3BSNA 4EBEA 4ECZA 3TQ1A 1D1UA 2ASJA 2J6SA 4FBTA 3H4BA 5KFQA 1KHWA 3OL8A 2WK4A 4J9RA 3OSNA 1JLBA 1SUQB 2BR0A 1C1BB 3CO9A 3JSMB 2HMIA 1Z4UA 2AQ4A 1JX4A 2EC0A 1S0MA 4YR2A 4MK8A 1TL3A 4NLXA 3HVWA 2W9CB 5KFGA 5C42B 3FFIA 2YNHB 4NRTA 3M9MB 3QIPB 1LWFA 4Y3CA 1HARA 1RT1A 1S1WA 4IH7A 3RB4A 3NGDA 2CKWA 3QO9B 1MMLA 2AX1A 3UPFA 3GIIA 3G6XA 3KOAA 4PQUA 1C0UA 3MEGB 5KT3A 2ZE2B 3LP0A 2RKIB 2W7OA 4R0EA 2R2RA 4YP3A 4EYHB 4K4VA 1JLQB 2D7SA 2JC0A 3SFGA 3LP1B 3DRSA 5J2MA 5F8JA 3RB3A 1LW2A 1MU2B 3M8PA 4ZPBA 3T5KA 4WFYA 1QUVA 4I2QA 3FFIB 3BR9A 2VA2A 4RZRA 1IKXA 2AGPA 3TAMA 4FS2A 2OPPB 4M94A 3OHBA 2YKMA 4Y2AA 4ED1A 4DL4A 1S1VA 2YNGA 1I6JA 1HMVB 4TY8B 5CYMB 3BGRB 4TY9A 4O4GA 2ZD1B 2IAJA 2WHOA 4ZVEA 3DRRA 5KFHA 1REVA 1C2PA 2VG7A 3T5HA 4KE5A 4ZP6A 2ASLA 1TKXB 3UQSA 5KT7A 1TL1A 1RT3B 2R2SA 2RDJA 1RT6B 1IKWB 1XR5A 2VG5B 2OPRA 3DLGB 3CJ4A 3HHKA 1BQNB 4KFBA 2WONA 3CDEA 1TQLA 3LALA 4QWEA 2JLEA 4ECYA 4IRCA 4ED6A 3V4IB 3H5YA 1S1UA 4O3SA 4RW6B 5I42A 3DOKA 2BQUA 1RT2B 2V4QA 4KHMA 3BREA 2RF2B 3DLKB 1IM4A 3NBPB 4H4OB 1N6QB 5DQIA 2W9BA 4K50A 3LP2B 1RT4A 1JXLA 2JEGA 1C1BA 3M8QB 2CJQA 4ECSA 2BQ3A 1JLBB 1SUQA 1U09A 4ZPCA 4WYWA 2VA3A 1RT7B 5HROB 3MEEA 1SH0A 3JSMA 2FVSA 2HMIB 2VG6A 1S6QA 1T03B 3CDUA 4QWAA 3OLAA 4K4XA 4J9NA 3V6HA 2C28A 5D3GB 4X2BA 1UWBB 3RAXA 1S10A 5DG9A 4JV2A 1EP4A 3MEDA 4NLTA 1NHVA 1W25A 3H59A 3DI6A 4LQ9A 4RW8B 4RW9B 4YR3A 2D3ZA 5KFWA 2UVWA 4WE1B 1VRTB 2ZE2A 5C42A 4HKQA 4YMEA 5CYQB 5KFOA 3RB6A 2XCPA 3H98A 3FSIA 1RT1B 4ZVFA 4QPXA 3MF5A 4IOBA 5DGBA 4ED7A 4B3OB 3DRPA 1ZETA 3KHHA 4NLSA 3LP0B 5DQHA 4KAIA 4QW9A 5HLFB 3KLFA 5L1KA 4G1QA 5DLGA 1RYRA 1EETA 2GIQA 2D41A 1S1XB 3KJVA 1S6PA 1RT5A 3N6LA 2C22A 4IG3B 2WOMB 5KFDA 5EWEA 3GV5B 3ITHB 5J2QA 5EDWA 5C25B 4TN2A 4EBDA 5KFXA 3QYYA 4ICLA 4Q43A 3Q8QB 4H4MA 1REVB 2XWYA 3OLBA 5KFRA 3NL0A 5F8MA 2B5JA 3C6TB 1RT6A 3KLGB 3QLHA 1T94A 2QE5A 2C2EA 4WFZA 1BQNA 4TY8A 4URSA 4RW7A 3BJYA 3OL9A 4K4ZA 2VG5A 3KLHB 3KLIA 1TV6B 3QGIA 4KKOA 5KFZA 3CJ0A 5EWFA 5HBMA 2J6UA 5L1LA 3GQCA 4KO0A 3GIKA 2IA6A 1DTQA 5DQGA 1S1TB 2FVCA 1JKHA 1TKXA 2I5JA 1R0AA 4OL8A 1S48A 5KG3A 5F9NA 3DOLB 5KFBA 5KT4A 2XGPA 2W9BB 2R8KA 1S49A 3PZPA 2FJXA 5J2PA 1C0UB 3MEGA 3KLVA 3ICLA 3QZ7A 2UVRA 4IFYB 3IRXB 1JLFB 3RBEA 3KK1B 2XC9A 2V9WA 2R2TA 2WTFA 4NLVA 3I0SB 3MEEB 3M8QA 1JLAA 4JUZA 4O3OA 5KFYA 2FLPA 5KG4A 1IKYA 3PW0A 3MR2A 3LAKA 3CJ5A 1S9EB 3DMJB 4YQWA 3QO9A 5KG5A 5F8IA 3DLKA 2XI3A 1DTTA 3UR0A 2W8KA 3PJWA 4PQUB 1LWCA 5FDLA 3HVAA 2WRMA 1HMVA 1BQMA 2R8GA 3MECB 1C0TB 1MU2A 1LW2B 3M8PB 2ZD1A 4XPEA 4MFBA 2FJWA 5J2NA 2HWHA 2IM1A 4RNOA 2FLNA 3LP1A 2HNZB 1HQEB 4IFYA
chains in the Genus database with same CATH superfamily
2NS1B 3CDWA 4ECXA 3V6DB 2BDPA 3ZZYA 2LQJA 3N6MA 2OPPA 4MIWA 4EO8A 4DG1A 1R89A 1JLAB 4MKBA 2V94A 3R2CJ 2C2NA 3FZ2A 1VYAA 1EKSA 2KB2A 2RHSB 3AXMA 3TAMB 2FD2A 4P52A 5D0HA 4R25A 1HYSB 4LFCF 1U7LA 2FHOB 2HSEB 1NK9A 2Z4PA 3BH7B 1Q16B 4XK8C 3FSXA 4G1QB 2UUTA 4N8NA 2JZ5A 4ZPWR 5E33A 3MCNA 5KT5A 1SJFA 1PAEX 5FD1A 2KT3A 4LVNP 1SH2A 1J5EF 1EKRA 1S99A 2HVIA 4ZVHA 4Q2LA 4KTQA 1YQHA 4O44A 2C3YA 1FKOB 2IC3B 1E6YA 2L9NA 1XMBA 1XWLA 4MKAA 3HP6A 1SJ3P 1M5PC 1JMTA 1F9EB 2BMBA 3V6DA 2HBYB 2NUUG 3CIMA 2RDDA 5DRKA 1Q5VA 3MR5A 3A8IA 1V9OA 4ALZA 4FF1A 4ECWA 3CCMS 4U7CA 2ACYA 2F1FA 2B51A 3IR5B 4NX9A 5KFLA 3TVZA 4C11A 4U67Q 1R6VA 1M5VC 2R8HA 1EARA 4DV1F 4FNIA 2I1RA 3N28A 1VLOA 2VASA 4C2MA 3ITHA 5J2QB 3DCAA 3QWUA 3KNGA 1Y4ZB 2FVRA 4N77A 2VU5A 5K5MA 5KFTA 2RB7A 3NLCA 3CJKA 1BY9A 5H9EK 4B9VA 5K8PA 1FEEA 2MQMA 3OXLA 3T9NA 2QMUB 2ZH4A 4NLOA 5F8HA 4V19J 1HNWF 2I2YA 4TU8A 3HHDA 2HHVA 3BGFA 3JYTB 4ZLPA 3H5XA 1K0VA 2POKA 1FXLA 1QE1A 2KO1A 3ILLA 3QATA 3G8TA 1CEZA 2O5DA 1KQKA 3Q8VA 3ETMA 2UXDF 4RW4B 2BABA 3A8KA 3MR6A 1SKRA 2OJ3A 1B99A 2IJNA 3NNHA 1NXIA 1VQNS 4NLQA 3AH6A 1PYTA 2FHJA 2ZOFA 4NCGA 3BV8A 4DR3J 4JI8J 2HIQA 1RLCL 3RJMB 3T1AA 1Y5IB 2ZEJA 3MHYA 4PYAA 3SYZA 1JJ4A 5H1SV 4DV5F 4B9SA 3H5UA 1WC0A 1EQMA 1RTDA 1SXLA 3JTOA 3K5LA 4ED2A 1KVJA 2P6TA 3DMJA 1NHKL 2A1BA 2W2OP 3KUHA 1SQEA 3OXGA 3CJ3A 3R7BB 2LCWA 4USIA 2JVRA 3UCGA 1HNXJ 3QAEA 3FEXB 2GFFA 4RNFA 2RQKA 3D6MB 2G1DA 4NYPA 2J6TA 2MDAA 3GPAA 5HP1A 1BMQB 2J76E 3BSOA 3CT9A 2GQCA 3AOCA 1QAJA 4V1Ak 4OHYA 4B9MA 4AL7A 2DGQA 2V8VA 1ZTTA 1IJEB 3HSJA 3ZTRA 5AJ3J 2J5AA 4DR5J 2UU9F 3UDLA 4F26A 3DLEA 2Z2LA 1RI7A 1FRKA 1S1XA 3IBWA 1TKTB 4IG3A 1RHKB 4N47A 4WKRA 3B78A 3R7SB 4F36A 2Z30B 1NZ8A 3PX4A 3M1VB 3D66A 4MFBB 4ZN1A 1ZH5A 1NK6A 2WVBA 3DOKB 4DX5A 3V2UC 3MM7A 3BSAA 4KSEB 1H7WA 3OXFA 4BC9A 6FD1A 2R8JA 1ZOTA 2AIRB 2HLTA 1VRUA 3GLJA 3HKWA 2ZH7A 4UQTA 4I2PA 2B4OA 1V5IB 2DO0A 4BC7A 2R7RA 1C1CA 4ECRA 1R0AB 2MQNA 1N5TA 1HQ2A 4DX7A 3WX8A 2V4RA 2DRAA 4FXVA 2FLOA 3NP5A 1MROA 4C7QA 2FZGB 3TX0A 1J5EJ 2Z2ZA 1VQ5S 2CPHA 2I0XA 5E0OA 4M5MA 4IDKA 2ERRA 2DR5A 2KKHA 2D3OR 4IG0B 3KK3A 3MM5B 1YRUA 4ZVUB 2N3OA 4J37A 3M6WA 3FCHA 3MMAA 4EMDA 2IM2A 4X4RA 4F4XA 3TANA 4NLGA 2BM0A 3LQVA 4DR1F 2DTJA 5IT9Y 7AT1B 3HDSA 1BD6A 3TWZA 3VR1A 2KM8B 4ZLNA 4NE9C 2HNYB 1UPMB 1LW0B 2D9OA 1IKVB 2QA2A 2XI2A 3M2VA 3MWBA 3CCVS 4J9SA 1XMOF 2DY1A 4I2PB 2MSSA 4LSNB 4O3PA 4F4ZA 4ECVA 4UW2A 2KRBA 1VK3A 4IH6A 2I6WA 3RBDA 4OYAA 1WEYA 2F63A 2VFTA 1UVKA 4WFAQ 2NR0A 4URGA 1SL0A 1MN9A 1VOMA 1Y7PA 3OPKA 4WP3A 4L74A 1FWPA 5HJYA 3M05A 4M5HA 3W5YA 4IOAQ 1IR0A 1HIYA 2RT3A 3D54A 1FCAA 4U95A 1SKSA 2C2DA 1OYDA 1SKWA 4FF2A 4DEZA 3DC2A 1CBKA 3C15A 5IQQA 1UP1A 4Q0BB 4HHJA 4FYDA 1ICEB 3KLEA 4FP9A 1RACB 2DNRA 4P7VA 1CJVA 4H4OA 5LSOA 5GAGI 2MKIA 2AYMA 2PA3A 3J7YI 4TQRA 2DNOA 3B54A 2UVVA 3PO5A 2BJ1A 4LF4J 1S77D 1J5OA 3HSGA 4TYBA 1PIEA 2ZVSA 3GIRA 3OR1B 1X5PA 4F25A 4ER8A 4KR0B 2CZVC 4AE5A 4LF5F 3GIJA 4MK7A 4CNZA 2HZAA 2A2DA 2OSQA 3BB5A 1HYSA 1N32J 1JQGA 3W63A 2GJIA 3PW5A 2NXJA 2Q3PA 1JLCA 3H42A 4LBPA 2QEXS 3KHRA 4IO9Q 3BGRA 5KG1A 2OD6A 3D4JA 2RRAA 3D9BA 1S4FA 1OY8A 2MKKA 3CCTA 3QFWA 3S8SA 1S9GB 3CXCR 1S79A 2R7WA 4X62J 1M0SA 3CF5Q 1HR0J 5I3UB 1RGVA 5DG7A 4DQRA 1U6BA 2RE1A 3OTOJ 1JLGA 2A10A 1IKXB 3MM6A 3S6EA 4KYZA 3J80U 4J9VA 4LR8A 2D69A 4Z7YA 3UO0A 4PR6A 4F4WA 1MROB 1Q1KA 5L1JA 1G4CA 1HLWA 4ID5B 1H3DA 3MGJA 2R4FA 3UCZP 3TP2A 4QW8A 2E7XA 5EWGA 2E5LJ 1B7FA 2CAJA 2V5HG 3OTBA 3UE2A 4P2FA 4DPWA 4A46A 3PW2A 1FJEB 1HWIA 1RAAB 2VQFJ 1TKZB 2BOAA 1UA0A 1S9GA 3T1YF 2B4VA 1TMJA 2ZH3A 4WFNQ 4N41A 3G6YA 3F41A 5EHHA 2Y9HA 4B9LA 3UN2A 3HVTB 4IDKB 1YSJA 3LWMA 1UVMA 3FNNA 3OFHA 4M5LA 4WFXA 5U47A 3DLBA 1KQFB 1FX2A 1HPZA 2R2UA 4X66J 3C6UB 2MQ8A 1FT8A 1GTHA 2CDRB 3DRXA 4X65J 3KHLA 2XS7A 3TZXA 3T3FA 2V8DA 4MH8A 1FJGF 1LEOA 4Y2CA 2I5JB 3W1YC 1S5ZA 3THTA 2DNNA 4QQBA 1CJVB 4O4RA 4DSEA 3M1VA 2DNZA 5H9FJ 2H51B 2YX4A 3EX7B 5ETMA 3K5OA 2IFXA 2EK6A 3KK2B 1LXJA 3M7VA 4ZVTB 3TYTA 1CJTA 2M8DB 1KQGB 2CJXB 5GADU 2P6SA 3A1YG 3MAAB 4XTTA 4OI0A 4OYZA 4PRFA 4OV1A 1U48A 2V68A 5BR8J 4JI4J 2JVOA 2XS2A 1HHQA 2YTCA 1KVIA 3SEOA 2BE2B 1WG4A 3EE3A 3CVKA 5KFVA 3DYAB 2J0WA 4HTIA 1VRQC 2O3DA 1EAYC 2YQ3A 3NAIA 4MAKA 3SCLE 2F9JA 1Q8BA 2RQ4A 1ZAWA 4WE1A 1S12A 1ZA2B 2LDIA 4KGXB 5SUHA 1WHYA 2DR6A 4GVLA 5HLFA 1ULRA 3WIVA 1K1SA 2GVZA 4C0OC 4LFAJ 3KKFA 1RTJA 1TL1B 3HPOA 3SI8A 1YTYA 2IM3A 1O0PA 2QFJA 1NJXA 1L3TA 1BC6A 1NU4A 1U0HB 3AODA 3K57A 2JSXA 3G4SS 3OR2B 1NEEA 4DL3A 5L8RC 1HNVB 2H5IB 4IG0A 3KK3B 1SBRA 1VQSA 2HWIA 2WVFA 3H5SA 3MM5A 3ZNUA 4BLGA 3FMWA 5KG7A 1NNDA 1WD6A 3SCIE 1QSLA 3JSRA 5H9FK 4DV0F 3BO4A 1VC5A 3DM2B 5CZVA 2RQMA 4JV0A 4L72B 1T03A 2FZCB 1IWAA 2W4CA 2VB6A 1LW0A 3GR1A 3CJ2A 4F3QA 5EGYA 1FJGJ 2XGQA 2DD8S 4QR0A 1NKEA 4HH0A 2GVZB 3PYFA 4FPIA 2NXUA 2YWEA 3UN5A 3H4BA 1KS2A 3E8OA 4PXBA 5M2UA 5DDQC 4MYUA 1D3WA 2VUGA 3EUNA 4Y00A 4O0IA 4WCEQ 4DV6J 1C1BB 5CHCB 2LMIA 1Z4UA 3MMCB 4J90A 1JX4A 2V9KA 3THPA 1F3VA 2FJAB 4DV7J 2MKSA 2W9CB 2N82B 1N88A 3RR7A 5C42B 1YGYA 3FFIA 1BXNA 4NRTA 4DU8A 3TUZC 1H72C 2HVZA 3TA1A 4C11B 1PKUA 3TZWA 4PG8A 1LWFA 3ZTPA 4DQIA 1T3OA 3M6XA 1XBWA 3PDNA 1U24A 2GVDB 2CQ0A 1MMLA 2AZ3A 2AX1A 2JDJA 1MWYA 2CADA 2W24A 5G0RA 5HANA 4DZ6A 4PQUA 2M2BA 3CEDA 2UUBF 2HQCA 4P2SA 4RBTA 4DV3F 1NK8A 1EB0A 3FMBA 4R0EA 1Y5NB 4FKXA 4BBYA 2KVQE 3FBEA 1T9YA 4YP3A 2IDLA 2UXCF 4C0HA 1VBXA 1JLQB 1FRLA 2D7SA 3LP1B 3NEKA 2XMKA 3DRSA 5FLXU 1SC4B 1IQZA 2HGNA 1MU2B 4ZPBA 4O3RA 4JI3J 4JOUA 1D09B 2BJEA 4WFYA 3IWNC 3DU5A 3JSYA 3BR9A 2VA2A 1ROFA 4YFUA 2JLFA 2EBEA 2H5EA 4TKTA 3OD2A 4KHPJ 4OZ0A 3TAMA 2EC2A 2OPPB 2LLZA 4M5KA 3VVUA 4CO0A 4Y2AA 1FWKA 1RSCA 2YNGA 1I6JA 4C6AA 3HULA 3OVBA 3MPVA 3UCUP 5CYMB 3J81U 1X4CA 4O4GA 2UV8G 5ETTA 4FBUA 4DX8H 4N7TA 1XMQF 1RBLA 4OZ3A 2VFSA 2HK3A 4P72A 4EGLA 3HHLB 2R7UA 1REVA 3GCXP 3E2EA 2DRDA 1N32F 3D1HA 3RW7A 1CC7A 1RWNB 3UVJA 1F5BA 1ZBTA 3O8WA 4ZP6A 2PI5A 1QTNB 5E3QA 4X4NA 4U7UK 2ZBCA 3UDEA 2MQPA 2ZC4A 3W8PA 4HH1A 4LF9J 1XR5A 3PEHA 2OPRA 2JFKA 2R3VA 1CC8A 3R9LA 4N5SA 1L3SA 4KFBA 2R7SA 1UJ6A 1OPIA 4KY3A 2HHXA 2DH8A 3H5YA 1S1UA 3FCVA 1NDKA 5THWA 5I42A 5A76A 2F40A 3QFHA 3DOKA 1QSSA 3UR3C 3W60A 3CCQS 4UY8T 1U2RA 3DLKB 1IM4A 2FC8A 2DGVA 4DQPA 3BF4A 3LP2B 4L6V3 4OFZA 3RRKA 2PMWA 1UL3A 2GAHC 3W64A 2MQLA 1RBOB 1OJ4A 1O51A 2BQ3A 4ENOA 2VPYB 4WYWA 1KTQA 1F2GA 2AYEA 2QX0A 4D3GA 3MEEA 3OW2R 2M70A 4YOEA 4QWAA 4K4XA 3V6HA 5HK4A 3F0NA 1G1XA 2Z2MA 1UWBB 4ZVRB 4LFBJ 2A3JA 3CCLS 2ZZMA 4F2RA 2J0SD 2MKYA 4GO7X 2Y0SD 3TVYA 3AOAA 1S57A 4KGMA 3DI6A 5A6PA 4JP8A 2Y1LB 1OY9A 4TU7A 3MAHA 3VAMA 2RS2A 2HVEA 3HVRA 2MHNA 2UVWA 2PI4A 4LIWA 4RWXA 5IFMA 4LFCJ 5C42A 2ZOGA 3Q83A 4HKQA 1LWXA 1TUWA 1UKUA 2H65B 1WJ9A 1QUPA 2HQFA 1P8GA 2ZBQA 3AXKA 3CGIA 3C66A 2MGZA 4H4KA 4IOCQ 2DIVA 1SKUB 1Z2ZA 1N0UA 2F65A 2Q1LA 3KUGA 3Q2SC 1U0HA 4A8MP 1DFDA 1B0VA 5DGBA 2FB0A 1WACA 4ED7A 3CDAA 1ZETA 4NYOA 2XNRA 1VR6A 3VVTA 4OX7A 4WTOB 3UD4P 3LP0B 2LU2A 1RU1A 3KLFA 1FDBA 1FA0A 1GXUA 3CCZA 3HX9A 3O44A 1RYRA 2D41A 3D7SB 2NZCA 1MLAA 2XSJA 3SZ2A 3ENQA 4CLKA 1YIJS 3N6LA 3ZNJ1 5KFDA 2HS3A 3ITHB 5J2QA 3Q8YA 3G82A 3OR2A 1KR4A 5B0DA 5EDWA 5GAEI 2ZDOA 4TN2A 4HLBA 5KFXA 3X3UA 1YRTA 1FWLA 1YJTA 4U8VA 3SQGB 1KTVA 1ZZFA 1WHVA 3N79A 1REVB 4P6QA 5CAAA 5KFRA 3OLBA 5F8MA 3OBIA 4LF7J 6FDRA 3MEKA 3NCRA 2QE5A 4ILRA 1MNEA 1Q82T 3BBCA 4WFZA 1LQ9A 4UUXA 3QSYB 1BQNA 2VBXA 3OL9A 4RW7A 4I68A 1PGZA 1AROP 2K8GA 1NDLA 2W2PP 4LRCA 4ZVSB 1GT8A 2CNNB 1XMOJ 5E3RA 3CJ0A 5EWFA 2XLIA 1S76D 1NZAA 4KO0A 3HT3A 2BYCA 3GQCA 2IA6A 3EVMA 1LK7A 2AJ1A 2P2CB 3R6GB 3J7ZT 1WC3A 2ZBPA 3D0HE 4LJMA 3MAQA 1FKAF 4K7QA 1YHQS 1S48A 1GMVA 2FHKA 2G1HA 5F9NA 5ETLA 3RZAA 1C0UB 1ZM9A 3L09A 4IUFA 3R1HA 3GYXB 2AKWB 3AJDA 3POTB 1JLFB 2KG0A 1CJTB 4OYMA 1N36F 4B9TA 1TUVA 4LIRA 2C2MB 3I0SB 2HAFA 4QYRA 3M8QA 1UWAA 2BJ9A 1JLAA 2QL9B 4O3OA 4JUZA 3VWSA 4DCOB 1X4FA 2FLPA 3N0VA 3W66A 4OQJA 3Q24A 3MR2A 1PO6A 3LAKA 3GFYA 2KJVA 3DMJB 4YQWA 3GJQB 2R7OA 1N52B 4GMKA 2BKNA 4X65F 5HN0A 3B82A 1RJJA 1J27A 9ATCB 4UZCA 4QIWD 2HS4A 2QLBB 2VPWB 4OLOA 1NAQA 2BX6A 2NSBA 2O67A 2RU3A 3J7AN 1BQMA 2J9DA 2Q66A 2E5IA 3TA2A 4RKUC 1LW2B 1B0TA 4HEA9 4RNOA 4KPYA 2DGTA 3UN3A 4IFYA 2XMMA 5HVHA 3K5NA 2U2FA 3HVTA 4JI1F 2OPQB 3NGRA 1X4GA 3TEGA 3VGUA 3W9HA 2XHWA 4J9MA 3CJQA 2KYXA 3FBCA 5HJXA 5GMDA 2LA6A 4NCAA 4KH0B 2DXFA 2UUAJ 1Z2LA 4O4GB 5IC6B 3GILA 3QWPA 1RTHB 1XNRJ 1R8AA 1WDDA 3QRPA 4IYQA 3MTJA 4DL0C 3GB0A 1FRIA 5KFSA 5JJBA 3VAKA 3Q8SB 1EZZB 3DN9A 1JLCB 4Z37A 3SDEB 1RWWB 3C19A 3EZUA 2YWFA 1N5YA 3QBCA 4A8WA 1A9NB 2OPSB 4JI5J 2GJFA 2CQIA 2F8EX 2KT5A 3TEHB 4K2XA 4GC6A 1UEVA 4CDIA 1TL3B 1RHJB 4ZVQB 1GAOA 1NSAA 3K2YA 3GP9A 2UXDJ 2FQQB 2EKYA 2ZITA 4EO6A 1FRJA 3C6TA 1P9YA 4PXCA 1RT5B 1Q4RA 2VBZA 3PYGA 1H2TZ 4FYVB 3H40A 2HAIA 3A8EA 2P9GA 2AWZA 4YDDB 4CLZA 1VQ7S 4BCAA 1S0OA 3V4IA 3D5MA 1FVSA 3IS9B 2FGOA 4K4WA 5CXTA 4LF5J 1S6OA 2HFSA 3DXSX 3MPWA 1U25A 1U1PA 4LVOP 1FRXA 4OX9F 1EP4B 3MEDB 4NXNJ 1W26A 1EIYB 3GONA 4USVA 4ZKAA 1G6BA 4WXWA 1CJKA 4IFVA 3DGPB 4X4VA 5LT5A 1VMBA 3P4UB 4F0MA 3NCPA 1T9WA 1WF0A 3MR7A 3MFHA 1UWBA 3I0SA 2MLZA 1WKKA 4EYIB 1V6HA 4OZ2A 2YVSA 2KG1A 1SPBP 1NO8A 1RA7A 3AD9C 3ZZOA 3CO0P 1H2VZ 4JI2J 5DDOC 2UZAA 1HPZB 2J0QD 1PC5A 1Y3KA 4GKKF 2MSTA 2FLNA 4PG4A 3BDPA 2B9YA 2ABYA 4FN5A 4LRDA 1IBMJ 2ILZA 4OI2A 1Q5YA 4ZCKA 3SCJE 2CYYA 4DR2J 4DF4A 1HNIB 2QL5B 3SFUA 1RYSA 1AFIA 1URRA 2FIUA 3SSSA 2IDEA 1VBKA 5T7LA 4RUAA 1QM9A 1QE1B 2QMWA 4MIAA 2LU1A 4YB6A 5KT6A 3BKUA 1I3OB 2HQIA 4ZCIA 1TK8A 5BJRA 2VICA 3I5BA 4QU6A 3W62A 3FCWA 3KLFB 1N33F 2YKQA 4LFAF 1QY7A 1UVJA 1GXTA 2OHDA 2J7WA 3KJVB 2W7AA 3G86A 2CNOB 1YG0A 2DEJA 3CD7A 4FKYA 4LMZA 3GWCA 1X7VA 4MK9A 1QTMA 1IM6A 2KFYA 3G82B 4PWUA 4ZPTR 2NUHA 4CO5A 1NPKA 3Q86A 4TLQA 2HHHJ 1X4EA 2DNMA 1NH8A 1M1GA 5KTQA 1RE1B 3NBPA 1N6QA 1SC3B 1SJ4P 3DLHA 2YNFB 3QLHB 1I5OB 1RAGB 5F8LA 3I9V9 4HHUA 4DV7F 1JNZB 1GNKA 3IGNA 3V4MA 2LEAA 5DM6Q 1SV5B 4FPRA 3TA0A 4O44B 3OT9A 5DDRC 2N7CA 5J2PB 2ALZA 3MUVP 2N3LA 1N48A 2HHUA 1N4LA 5IQ6A 4BWJA 2VJUA 2FLLA 1RKIA 3V6KA 2B4PA 4XO0A 1BUXA 3KDNA 4YHHF 2IA0A 5KFKA 2W7PA 4NA3A 1WG1A 1TKTA 3PFEA 4PWDB 1JKHB 2VKRA 3HHEA 3LGHA 3X1LB 2KFZA 2D3UA 3FZBA 1GX6A 2IMWP 1XNQF 4IQMA 3PJ9A 3GMGA 2QLWA 4PUOB 2D1CA 4X66F 2EBGA 4B17A 2B4UA 1AB8A 1R8PA 3QT7A 1RTZA 4J9UE 5IS2A 1NK5A 1D0EA 1UFKA 2VZ9A 2ZH5A 5KFEA 3BGUA 1VQ9S 5CCMA 4CI0B 4CQ1A 3CJTA 4K4TA 3KNAA 4G3IA 1VJQA 2OO4A 1VQMS 2MZRA 2LKZA 3GZ7A 2HNZA 3VAFA 2IYGA 1IBLJ 3C6UA 2HKEA 2HNDA 4FZVA 2W9CA 4GKKJ 4KQZA 4C3LA 3OHAA 3H7HB 4FS1A 4B3SF 5FDLB 2EG2A 4RNHA 4ECTA 1FNMA 4Y2MA 5F41A 5ETQA 4WZQA 3I0RA 4CLUA 5F8GA 4QWDA 4QCLA 3FJ2A 4TLRA 1UPPA 1WNEA 3I6PA 3RRHA 3HD2A 3BGLA 3M2RA 2ZJRQ 4DOZA 5C24B 1VBZA 2XMTA 3NWRA 4F4KA 5L9XA 5JUMA 4RJVA 2ZOMA 2YPZA 1QVGR 4DSLA 1KLNA 3PACA 5ETKA 4IH5A 1NKBA 4ZP8A 2OPQA 1X5TA 5C2GA 2DBBA 2W4PA 4RNMA 3H2VE 2XO6A 2BE2A 1OWXA 5KFCA 4FF3A 3KG4A 3M2UB 4WP8A 3N6NA 4I4BA 2DB1A 3PY8A 3GV8B 1HKAA 2PC6A 4ZCLA 2F4VF 1WF2A 9RUBA 4ED8A 2HHQA 2VPZB 3AQPA 3AD7C 4XDCA 3O6QA 1H98A 4YR0A 2KZMA 3W5XA 2IVYA 4QOTA 3NAHA 2BKPA 1FERA 3IG1B 3GE9A 1LOUA 2GQQA 2ILYA 3JQKA 4HT5A 1RAEB 2VG7B 2P5VA 5J1EA 5B0BA 1VRTA 2HBRB 3TNVA 5A8WA 3PIOQ 1E6YB 1L3VA 4I2QB 4AXIA 2DXEA 3EXYA 2OEJA 2W8LA 4OHVA 2DISA 2GC8A 5B0EA 4L3KA 3AY0A 3S1TA 4HDGA 1N56A 2LDYA 1RWVB 3BN7A 1PAUB 1FHTA 2OTJS 3CJSA 3DLGA 1WOPA 3K8WA 4RL1A 3CDBA 5I4MA 5LSLA 1FJCA 2CPYA 1MG7A 2E5HA 3MOZA 3SBMA 2ZKUA 2XZTB 2AU0A 1P9QC 3RW6A 1UTAA 4IO1A 1HBOA 5L9NA 3QIDA 4DWIA 2XS5A 2V50A 5IXUA 3GSDA 4X4OA 4DV6F 4X64F 3MM9B 5IT9U 4ZPVR 4GKJJ 1NM2A 4HYKA 1XR7A 2MJUA 3VTIA 2XY6A 4ZDNA 3NS7B 3RB0A 2YKNA 1LFPA 2OEMA 5CQGA 2M9KA 1T05B 2IJFA 4RU9A 1NMEB 3EZ5A 4AL5A 2RKIA 4RUBA 2X51A 3KMSA 2KM8C 2YWHA 3N5BA 4NOHA 2W1BA 4AUKA 4TU9A 2CG8A 3M4XA 2I9SA 1UZHA 2DNPA 3ZZTA 2VDHA 2EFNA 2YXLA 4EEYA 1L5UA 4KJIA 2DY9A 2DEIA 4PXDA 4PG6A 2HGLA 2W2NP 4M5JA 4PPZA 5A0YB 2E5JA 3I56S 3HSZA 4UQGA 3M8SA 1Q7LB 2MXYA 3EPGA 1P1TA 2V2QA 1S1TA 3LP2A 2MZ1A 5CD4A 1WKLA 3D0GE 4LSNA 1KFSA 3GSIA 5D15A 3GV7B 3HO1A 2OMOA 2RUSA 5CYMA 1Y5LB 2NXNA 1AT1B 1RT7A 4JI2F 2NYHA 2V34A 3ZXWA 1RXOB 2QYCA 4DXLA 1S6QB 4UOFA 5KOXA 2LQ8A 2YBVA 2M0GB 2QFIA 2QSFA 4YY3J 5DLFA 3TR5A 3I87A 2JEFA 2MGZB 4NPOA 3EDQB 3VHQA 3AB4B 2VQEJ 3EGZA 2V2KA 2QJ3A 2VIHA 2CPJA 2DNQA 1N36J 3I0RB 4AT1B 3LAMA 4XAKA 3RAMA 3TAPA 3DRPB 2YKMB 1U49A 2IAJB 3Q8UA 1AUDA 2XYGB 4O3NA 2W9AA 2IRUA 3QSIA 2B56A 1GXLA 1NSPA 1XC9A 4C8LA 1XNRF 4B3RJ 2DGUA 2QLXA 1F0XA 4WP9A 1RHRB 2AGOA 1BE4A 1ZAVA 3ILJA 2UVUA 4M1KA 2GW8A 2OFGX 2XQCA 3EPIA 1H7XA 2Y1JA 1YRXA 3D68A 4P75A 2IHR1 1NK0A 4DL5A 2G2YA 1K44A 3EGWB 2B5JB 1JJHA 4CM0A 1NH7A 4DSFA 5ETVA 4ZCMA 4Q8EA 2EPIA 2VBYA 3CMQA 2EXUA 3HLUA 4NLUA 4DUYJ 4KKOB 1E6VB 2FDNA 2ZC3A 4NEYA 3ELHA 2UXBJ 4ZP9A 5J1PA 3TQ1A 3BSNA 2J6SA 1I51B 2BACA 1S7HA 3NGUA 2CQGA 2KL8A 3OL8A 3ENAA 3DDNA 3P5TL 3GFHA 3CO9A 1HHSA 1AXQA 1H2UX 1ZAXA 2MEWA 3RRGA 8RUCA 4M63A 1TL3A 1U0SA 3NOCA 2XMUA 3FK4A 5LJ3Y 4LF9F 3IP0A 2J8SA 1SIZA 4PWWA 2G4BA 3I31A 1DQAA 2B0GA 3QIPB 2YQ0A 3SDEA 5GADI 1WC5A 2DJWA 3NOGA 4WTYA 1S59A 1RT1A 1S1WA 4K5SA 2MKCA 2HRUA 4ZJOA 2CKWA 4A8YA 3QO9B 2MLXA 5JVGQ 3RB4A 1G3OA 1ITPA 3UPFA 3KOAA 2ZUGA 4DR7F 5KT3A 2ZE2B 3LP0A 2RKIB 5D0EA 4QZVB 1U47A 4BHQA 1X9WA 2R2RA 2BKOA 4K4VA 3P49B 4E98A 3Q22A 1F9HA 4P7TA 3PXGa 2JC0A 3SFGA 2L08A 3G8SA 2W2MP 2VKZG 1QLNA 1JK9B 5F8JA 1LW2A 2Y1RI 2E5LF 4ZN3A 3T5KA 1DBDA 2RS8A 1QUVA 3NGSA 3EMTA 1REGX 1LKZA 1MMNA 3AD8C 4OYOA 4A48A 1IKXA 3K5MA 4FS2A 2E7VA 4M94A 2X3DA 3MAAA 1V3SA 4RR5A 4YEAA 2ZM6F 1U45A 3S7RA 2E1PA 3QT8A 5DZ6A 4PKDB 2XO7A 4HI1A 3UNYA 4TY9A 1XEZA 5G0RB 2V2ZA 2ZD1B 3EGNA 1IUJA 4LF8F 2WHOA 1SJQA 5D4OA 2AYGA 3DRRA 1PBAA 2L48A 4LRAA 4CO2A 4WFBQ 1RUSA 2QL7B 2VG7A 2ZJPQ 4ID8A 1UVLA 4ZLJA 2ASLA 1NJIT 2PDAA 1TKXB 4DS5A 4C8OA 2DGSA 4PG7A 1RT3B 3PKYA 1F5AA 1RT6B 1F2HA 3PRBA 4UOCA 5IWAF 1FRHA 2OFHX 1HBOB 4CZCA 3VAJA 3D1QA 2ROEA 1VQ4S 4CO4A 3KFWX 1TQLA 1O5JA 3LALA 3G87A 4QWEA 3K0JA 3BYRA 2JLEA 3IXQA 4IRCA 1RAHB 5A2QU 4UZBA 3QJPA 1QJHA 2IRYA 1V5VA 4JV5F 4ED5A 3V4IB 2PO4A 4YY3F 4O3SA 1WEXA 2HHTA 5IM0A 3D3BJ 2PGCA 1SIWB 2L9WA 3OJUA 4OZNA 1RT2B 1CJUA 3NBPB 1N6QB 1QD1A 3IAM9 1S4EA 2XY7A 3QPIA 1RLDA 1HA1A 2Q6BA 4L3NA 4LREA 1NKCA 2ZBRA 1JXLA 4JYAF 3EVWA 3HZEA 1JLBB 1SUQA 1YZ7A 5IOLA 8ATCB 4OYPA 3JS9A 4G6VB 1WSRA 2DNGA 2FVSA 3HI9A 2VG6A 1I94J 3RBXA 2FPHX 5E3AA 4L76A 5D3GB 5BYQA 1BLUA 3WX4A 1HHTP 4DR4F 3QNWB 3GTYX 1RHMB 3C14A 4P2XA 4JV2A 3KJFB 4M5DB 3N9UC 4NLTA 1W25A 3PX6A 4WU3A 1CS4A 1W7WA 2I8EA 4DZDA 1VDHA 5HVFA 4DQSA 5GAGU 2E5GA 3Q0AA 4RW9B 1B3TA 1Q86T 2P8IA 2VF3A 1MWZA 2GIFA 1SB6A 2JWNA 5KFWA 4YR3A 4WE1B 4DDFA 2ZE2A 2NXCA 2R7VA 3JXOA 1IBCB 5FLXY 5CYQB 2PEBA 3PCOB 2XCPA 3G96A 2RIJA 1UVIA 3FSIA 3D6FB 1FDDA 2N7YA 2GA7A 1RT1B 4USHA 1RABB 3TX8A 1FNOA 1TZ0A 3VZHA 2BE9B 1FE0A 4OHWA 1DZ5A 1CPZA 2GMLA 2NYIA 2CNKB 3KG0A 4O0NA 5DQHA 5HLFB 1EX8A 1K47A 3AAWB 2FGCA 1EETA 2GIQA 4M8LA 4AFFA 3J81Y 1KC8T 3NNAA 2QYGA 1S6PA 2L41A 1X4DA 4ZVOB 1UEUA 4X4QA 1CQNA 2WOMB 1O6XA 1Y10A 2M8HA 4K2JA 4G1IA 3R5BA 2YWGA 3GV5B 1KRPA 2CIMA 3BBFA 3JQJA 2ACMA 4Y28C 5L38A 4EBDA 3L7PA 2HPUA 1FD8A 4DR6J 2XZDB 4OIXA 3D67A 1AYEA 2RD5C 4G1PA 4M5IA 5AE3A 4DV1J 3M30B 3NL0A 4Q2MA 2AJ4A 4B3TF 1RT6A 3KLGB 4LSZB 3RU0A 2H3EB 2KXNB 1GTEA 1WORA 2NZ4A 4TY8A 3GFZA 4GO5X 4HHHA 1LNQA 4URSA 3WC2A 3FGVA 2VG5A 3KLHB 2IY5B 4LFBF 4B02A 2VV5A 5DO2A 3EZOA 3F56A 2A6MA 2EI5A 3CPWR 5E41A 5DQGA 3NGTA 4MTPA 5EX0A 1HWLA 2LEBA 2J9DE 1NPRA 4OL8A 1U1LA 3K7RA 3PV8A 4B3MF 3UW1A 4LT6A 2W9BB 2Y8YA 2AP6A 1S49A 2CUYA 3PZPA 1U1NA 4B3SJ 4CH1A 3SQGA 2VOOA 3ICLA 2E7WA 3RG6A 1UAWA 5B7WA 3QZ7A 3DLLQ 4LF7F 4IFYB 1VLYA 1MMDA 2OLWA 5HL7Q 1R8CA 2XC9A 2JRSA 1DJ0A 3ZZ0A 5BR8F 1R0BG 3CCRS 2VODA 1VCTA 2MYFA 4NA1A 2EEYA 5KG4A 1IKYA 1X5OA 2C3UA 3PW0A 1IVZA 3CJ5A 1UJ5A 2RSQA 1FRMA 3M8WA 1A0OB 4NCBA 5K9FA 1CJUB 2W8KA 3N4WA 1CVJA 1J2VA 2B9XA 2FHJD 2DRBA 3GFXA 3M2RB 2WRMA 5A8KB 2DHHA 5HO4A 2B7CB 4X4SA 5IT4A 2XM3A 1MU2A 1P1LA 1QDUB 5CABA 4MFBA 2MHEA 2HIYA 2HWHA 2JFDA 2LQBA 2QRRA 3LP1A 3CSKA 2KTQA 1SJ1A 1HQEB 2HQ3A 2QV6A 3W2VA 1AW0A 4OMFG 3DLEB 2B9WA 1EHWA 1M1HA 2HNDB 1XTZA 2LXIA 1Q7YT 5HMXA 4DV3J 3CJ8A 2B43A 2WVCA 3FQKA 2CPFA 4K4YA 4DSKA 2RJZA 3CD6S 1RCOB 3IC1A 3R2DJ 4DPOA 3CCSS 3DI6B 5B0FA 1NLKL 4Q0BA 2WCXA 2XWXA 3MM8B 3OUYB 1X0FA 3CC7S 4V19X 2MZSA 5LJ5Y 4ZOSA 3ISNC 4P73A 2W25A 5HSPA 4IRDA 5EX3A 4C3KA 2VFRA 3R5GA 4FVCA 1WG5A 5DETA 2K1RA 4TVAB 2NPIA 3DLJA 2AX0A 5C25A 2YNFA 1Q95G 1Q8LA 3AHPA 3CJRA 4XDDA 3NWGA 5JMNA 3Q8RB 1HQEA 1KN6A 4JV1A 4ES3A 4JI1J 2B8PA 4TXSA 2EFVA 3CWJA 3ULHA 4C98A 5KAKA 1Q79A 3BQ1A 3DXBA 3D6HB 2H9ZA 1D8YA 1PYOB 1TK0A 2DYAA 1N33J 1S1UB 3U1NA 1P6TA 2YY3A 3VALA 3BS9A 4CNYA 3LH2S 1YK9A 1NDPA 4OJGA 1HNZJ 4OYBA 4X84A 1FDAA 1WEZA 5KFUA 3ZTSA 4DLGA 2X1FA 1EQ0A 4LF6F 2IIHA 1TFYA 1L3KA 3EGVA 5B09A 2PFDA 4DF8A 3DRYA 2HNYA 4PAAA 4ZJLA 4R8UB 1FKPA 5M2RA 1DAXA 2CVIA 4FYXB 4NLWA 3B4MA 2K2PA 4UT4A 4ITSA 1H0HB 3EYZA 3V81A 3PHTA 1RWUA 2QN6B 1MSWD 4Y34A 3VAIA 4JI3F 1T8EA 3IWLA 1TUGB 1SQFA 1HNVA 3IMQJ 1YLXA 3U1MA 5KFFA 2IVMA 2V8GA 3KTQA 2XMAA 3PNIA 3LANA 2E1MC 5HBMB 3VQSA 1M5HA 2JOQA 3K17A 4YHHJ 4A47A 4Y65A 4WIIA 1KSPA 4H54A 4M5DA 4C8ZA 2MZJA 3BGOP 3DOLA 2YNIA 3L7UA 2YWWA 3OTEA 1X8DA 3R3TA 2V2VA 1KBRA 4NZ0A 5B0AA 1S9EA 4ES2A 4RW8A 1XQIA 1Y00A 2LQ9A 1FTCA 5MAOA 3TI0A 1KD1T 1JJ2R 4NXNF 2EFPA 3D3CJ 3A8JA 1SJRA 4I56A 4P2MA 1KLMA 4C3MA 2KFNA 3J7A1 2HS0A 5C2CA 4KGKA 2MZTA 1IWGA 4DG1B 5B0CA 4LBHA 2BJ7A 3QT5A 1HQUA 1JXVA 2WONB 2GX8A 4H4KC 2OTLS 1RAJA 4OJ1A 2CQDA 4X64J 1R6YA 4ZJQA 1DHMA 4JV5J 1BWEA 4K0KJ 1PCAA 1HWKA 1VQYA 2RDIA 4RNNA 4ZHRB 3MECA 1WKJA 2K06A 1WSVA 2WB4A 5A8WB 1TV6A 2ASYA 1TL4A 1ZM3A 5HATA 4ZITA 4F8RA 3W2VB 1U1KA 1DTQB 2HVDA 3PJXA 1YJ7A 4IR1A 2DR8A 4N8OA 4USUA 4I7FB 3AA9A 2VHGA 1C4CA 2K3KA 2LQ5A 3RR8A 3OVAA 3NRBA 4LSLB 1HBNB 2VQFF 3IGVA 4ZS6A 1OS5A 5IWAJ 4QIGA 4J9PA 1YVFA 3SMZA 4IQXA 4LUBA 4KO0B 3TJ9A 3HD1A 2ROGA 4OI6A 3U7JA 2YH1A 4R5PA 2AEJA 1OO0B 3H90A 5C5JA 3HHNB 3DM2A 3OSPA 4ZP7A 4TQSA 1TKZA 3AA8A 3OTCA 5HQLA 4MKYA 3MD1A 1N5YB 4U96A 4F02A 4K4UA 1IXKA 2XULA 3KHGA 3W9IA 4F3MA 3GJRB 1ZTWA 3J7YU 1U1MA 4EBCA 1NHUA 5K14A 5FJ4A 2C42A 3OL7A 2FJVA 3Q8PB 2GMHA 3V81B 4P71A 3DDKA 3MTKA 2CJKA 2P9CA 4Q45A 4USWA 1WOSA 5A0YA 1HW9A 1RA6A 3MURP 4CLYA 2DH7A 3T19A 3BSCA 3Q23A 4E2FB 5L46A 1T02A 3MPUB 2BANB 1XIQA 2H5JB 3LGNA 5AXKA 3SXLA 4D3HA 1WC6A 3IBCB 5GMKa 4B3MJ 2AHOB 2FVQA 3ONQA 3L9ZA 2DK2A 1LWCB 1F9FA 2GVDA 2E9RX 2GNKA 5T14A 5KFIA 4NMXA 1CJKB 1U8SA 1TP7A 1QSYA 3DOMB 1R8HA 2H1YA 2PA8D 1TU0B 5I3PA 4ZIWA 1NCLA 5GAEU 1YJUA 2XNQA 3MR3A 4WBFA 4X62F 2QGFB 3QGHA 4JI8F 4DR3F 3ENVA 3P96A 2WVDA 1Q78A 3FDSA 2K1RB 3TJ8A 2MZQA 2G13A 2O66A 3ZZUA 5M2PA 1PILA 3PO4A 3OUYA 1FJ7A 2DNHA 1HQUB 2YNIB 2GV1A 3CIZA 3NS5A 1APSA 4DL6A 5EN1A 2N4DA 4EFAC 2DNKA 1U1OA 3E01A 4HTJA 5F8NA 3H0PA 1FFGB 3QRQA 2K7JA 2ATLA 3D28A 3CMES 5B0GA 5EUHA 4KRWA 4RUCA 1B0PA 2V6AA 3DDIA 3EJMA 1R0CB 2OPSA 1YX2A 3FRZA 2G0CA 1NRKA 1Y3JA 3LW5C 4CTAA 3TUPA 4NI2B 4J91A 2QSWA 4C8MA 3WIUA 1SL2A 2DVIA 1KNZA 1TMMA 3NXZA 1X0PA 3PR5B 1UEKA 3W8GA 4DJBA 2LXUA 3F73A 5D4NA 4DLEA 1CSJA 4P10A 4F7VA 4J5OA 4CYUB 4DV4F 2BEFA 2MY8A 1ZM2A 5CYJA 1SV5A 1PYSB 1V3ZA 2AGQA 1TVRA 2VQEF 2A2CA 2EKNA 3L7OA 3WDOA 4IKAA 5KT2A 3ISZA 2CQCA 2MJNA 4DR2F 3MCSA 1T7PA 4ZPDA 1X9SA 1N54B 4WXOA 1Q53A 4ES1A 3DHXA 4RW6A 2J7UA 1S1WB 4I7FA 2APOA 2F8HA 3EICA 4NMLA 1FKPB 1U6ZA 1N5VA 5FIIA 4F50A 3T1HJ 2AD9A 2H54B 1I94F 5K14B 1VC6A 2E9ZA 2ZZTA 5MLCV 5HQMA 4Q5VA 2HHWA 5J2NB 3HJVA 3TUIC 3QZ8A 2MY7A 2H4WB 3NS6A 1JLGB 3KK2A 3MM6B 3G6VA 1WUUA 4I0WA 4ED3A 4KB7A 3ET6A 2B9EA 5F0WA 1R7IA 4KIAA 3HMJG 2QLJB 1AZSB 4QIVA 5F9LA 2ADBA 3PYEA 4ETXA 2DXDA 4KC5A 3RYLA 4N76A 2G0JA 4NA2A 1YWXA 1FESA 3SV4A 3KLHA 1RTIB 2U1AA 2Z0GA 5LM7E 4DFMA 3ZFVA 2HZVA 4PUOA 1GEHA 4M5NA 2F7VA 4KBIA 4A8OA 5H9EJ 2HYIB 3P8BB 2L3MA 5AXLA 1JLQA 2M88A 2IMOA 4IRKA 2ZZNA 3IWXA 3NKYA 4BWMA 4DL7A 2GIRA 1SC6A 3ZTQA 5DGAA 3CC4S 4USMA 3TO8A 4F67A 3PHEA 3DRRB 1T9XA 1J5OB 2VDIA 5GAHI 3KK1A 1FXDA 4NYZA 1AZSA 2MQQA 1DLOA 4Y2IA 4LF8J 4GVBB 4NLPA 3PTWA 1T9TA 4WK3A 5BYSA 2DIUA 2CQBA 4ZMMA 3C15B 3G8QA 5ETSA 5KFNA 4UTGA 1Y0HA 4OHZA 1H38A 2DPJA 2CJYB 2ZNYA 3O1LA 4KFBB 3HFZB 4PYDA 1HBMB 4ECUA 1KHVA 1X4HA 4O3QA 4EK2A 1L3UA 3I82A 3HF5A 2XEXA 5CYQA 3HHLD 3O3LA 5ADZA 5KFJA 2HLUA 4ED0A 4ZIVA 2F4VJ 1IBLF 2BV3A 2CVEA 2QC3A 3AOBA 4C97A 1S0NA 1RADB 1VHFA 4ICLB 3LUYA 2KHDA 4PQAA 4DPTA 3JYTA 3PKMA 2RUGA 5JVHQ 4CLTA 4K59A 5LSRA 2DCUB 2GO8A 2I38A 1IKWA 3BKTA 3R5DA 4FYWB 2ZHBA 2Y3YA 2KJWA 3BQ2A 4C8YA 4AQYJ 4W90B 1TVRB 1CQMA 4CYUA 5CH7B 2R7XA 2MQOA 4RW7B 2RH3A 1O8BA 1U1QA 5KG0A 2YX7A 1TAUA 2QZ8A 3DHWC 4QIFA 2DHGA 2ZNZA 1GMWA 4ATNA 2VG6B 4NI2A 4LQ3A 1HBMA 4GC7A 3BPDA 1U1RA 4C8KA 4E0DA 5D3GA 2HHPA 4DX6A 2ZDPA 4ID5A 3M9NB 4LR9A 2R9LA 1N34F 1D1UA 1AUSL 1UFLA 2PMHA 2KXHA 1QVFR 4ED4A 2OI2A 4F2SA 1FO1A 4J9RA 3OTDA 3OSNA 1JLBA 1SUQB 1WC1A 1B7YB 3JSMB 2HMIA 2EC0A 1SCJB 4MT1A 3CD5A 3N01A 2CPXA 3T9ZA 1S0MA 4ERDA 1M5OC 2CRLA 4AQYF 1HI1A 2D74B 2ZH6A 2YH0A 2HG4A 5KFGA 5DM7Q 2R7QA 3PM9A 5D4LA 5E2QA 2YNHB 2COLA 2XG8A 1TL7B 3PEJA 3R7NB 2HFVA 2OP5A 3HK2A 4KHPF 1WTFA 1HARA 2HURA 2BJ3A 4IH7A 1UA1A 4USJC 3NGDA 1KOOA 2YPYA 3DOMA 3WHIA 4USTA 3TZZA 3EM1A 2KXFA 4CWBA 3Q2TC 3IA0A 4DV5J 1C0UA 2J9EA 2Y0BB 3MUTP 2CZ4A 5A8KA 2NLWA 3CCJS 3I4PA 2QIFA 4EYHB 2XYPB 1X31C 3QRRA 3R5AA 3SSRA 5C7PA 2XB2D 3GU0A 4FYYB 3R6LB 3RB3A 3M8PA 2PSZA 1OSDA 2J9CA 1OYEA 3DU6A 4I2QA 3FFIB 3RUBL 5LOQA 3BKFA 2DGXA 2O01C 2AGPA 4JI0J 3QJJA 2QA4S 3SQOP 2YKMA 4F0KA 3OHBA 2ADCA 2X1AA 1HMVB 3WBZA 2O1PA 3MMAB 4IR9A 2CZ9A 1FF2A 2JJ4D 2WW8A 2Y8WA 4C4WA 2IAJA 3R1LA 2HHHF 2J7KA 4FVMA 5KFHA 2UXCJ 2NPFA 3F44A 3IM8A 3RGIA 3UQSA 1TL1A 4JYAJ 3NMRA 4NL5A 2H4YB 2Z8QA 1IKWB 3IRWP 2VG5B 2QT7A 3J80Y 2WSEC 2G2ZA 3CJ4A 2XTJP 3HHKA 1KWMA 2EWHA 4Q7AA 3WC0A 1ZS6A 5LMNF 2VFUA 5ETNA 5CZXA 4OX9J 4PXEA 2DH9A 3LGMA 3LPYA 4RBUA 3W7BA 4ECYA 2OIHA 1PJ6A 2ATCB 4HR2A 2H48B 1LK5A 4ETZA 4DR1J 4ED6A 3HZGA 4OZJA 5RUBA 4QR2A 2OUGA 2QA1A 2F9DA 2BQUA 1WOOA 1GMUA 3KYLA 1KVKA 1F1BB 1WDTA 4KHMA 5D77A 4A8QA 1KOHA 2W9BA 4H4OB 1RAIB 3BBBA 5DQIA 1RT4A 4DI6A 2CQPA 3VAHA 3M8QB 4S0MA 4ECSA 1VBYA 1X5SA 2FJEB 4ZPCA 1U09A 4F4AA 1TFWA 2BJ8A 4I1TA 5HROB 3ZZRA 1SH0A 3JSMA 2HMIB 2HEKA 3CDUA 3MUMP 3WZ0A 5B08A 1RP5A 3OLAA 2A0FB 4J9NA 2C28A 4NWBA 4X2BA 1WC4A 2SXLA 1DY3A 3OFGA 3RAXA 1S10A 1GH8A 2M5YA 4DFPA 1EP4A 3MEDA 1T11A 4XIUA 3OFEA 1NHVA 1YITS 1YI2S 2MKJA 3N5FA 4LQ9A 1JB0C 1Z1ZA 2CFXA 4HT7A 4RW8B 2OEKA 2UP1A 2UUAF 4BDPA 1T9UA 2FUG9 4A4JA 1M5SA 4QR1A 5HMWA 2B3TB 1SC1B 3TJAA 4ELVA 1VRTB 3CE8A 1JJCB 5BXIA 4DUZJ 2KDOA 1M1KT 3CTRA 4YMEA 2AEFA 2DGWA 3H98A 3SIPB 1NB7A 3HCXA 2DHXA 2ZVIA 1RHUB 2EVZA 2F3JA 2ZWPA 2YKAA 4QPXA 3KXDA 3MF5A 1RHQB 1UCNA 1UJ4A 4IOBA 5GVQA 5HMYA 1UW4A 2GJ2A 1FI4A 1N34J 2UUCF 4FXDA 4JI5F 3DRPA 1A7GE 3W9JA 3TRGA 4X4PA 1XN9A 4KAIA 4CLPA 1U02A 5DLGA 4GKJF 1ZYQA 3VCDA 3KJVA 3IO1A 1RT5A 2DHAA 3R5JB 5EWEA 2DITA 1EJ7L 4JI0F 4L75A 3HHLA 4QJVA 2FHMA 5AE2A 4YB7A 2BUNA 1NPPA 4ICLA 4B08A 4Q43A 2FC9A 2XWYA 2PMZD 3P45B 4MYTA 2DNYA 2ZKTA 2GO9A 2KN4A 2HGMA 2HZCA 3B8HA 3BPSP 1T94A 1TL5A 2CQ4A 2KHCA 3D6TB 3HHLC 5K20B 1OMSA 2AJ2A 1VQPS 1HNXF 2UUCJ 3FC9A 1HNWJ 4QYZK 4DS4A 2HFUA 5AT1B 1ZPVA 2V69A 1TV6B 2K3IA 4KKOA 2Q6CA 4MMOA 4OJHA 2D9PA 4UOHA 5KFZA 1YJNS 2J6UA 1GMWD 5L1LA 2VFVA 3C16B 3GIKA 1N0VC 1RWMB 1DTQA 4DN0A 5HMZA 1VISA 1YBTA 2FVCA 1JKHA 1TKXA 3IAS9 2I5JA 2LFVA 1X4AA 2CWXA 3RB6A 4RX6A 1R0AA 5KG3A 5KT4A 2XGPA 1HBUB 5KFBA 1HI0P 3T1YJ 2OMLA 2UXBF 1SI9A 1RAOA 2BZ2A 1CULB 4CP5A 3IRXB 4CRJA 2JHEA 3RBEA 3KK1B 4QBUA 1VK8A 2V9WA 2R2TA 2WTFA 5ETRA 3MEEB 3FUYA 4I6YA 1BQXA 5KFYA 4FDFA 4CO3A 5D0GA 2BBEA 1T95A 1YJVA 5IV4A 1S9EB 2C3MA 2DR7A 1FTRA 2GMJA 2VC1A 4NZ7A 4OI4A 3QT6A 3GIIA 5F8IA 2AYBA 3DLKA 2XI3A 1DTTA 2NXEA 3MXHP 3MMBB 4PQUB 3PJWA 2MLYA 3KJNB 3QJLA 2HVHA 5CD4H 3A3NB 1LWCA 1Y11A 2M3DA 3GJTB 3HVAA 3AB2B 1HFEL 5E5NA 3M8ZA 2Z56B 1XERA 2DHSA 3SCKE 1HW8A 5D4PA 3K58A 2FJWA 2IM1A 2ZD1A 4K0KF 5J2NA 4PZVA 3CUNA 3QQCD 2E1AA 1KLMB 5GMEA 2P9EA 4UUWA 1YZ6A 3M6UA 4F04B 3MOJB 3C14B 4HVZA 4Y6IA 4DFKA 1MW7A 2AV5A 2Q79A 1P27B 3IN5A 4F4YA 1LXNA 1LWEA 1X9MA 1IR2A 4DSJA 4DQQA 4LF4F 3FVYA 4B9UA 3CULA 3M2UA 3PVXA 2QO3A 3PRDA 4PPDA 5LMUF 1FFSB 4LF6J 2E9TA 4R5PB 3JSBA 4WYLA 1Q81T 3UDVA 4N56A 4MIBA 1NDCA 2E1RA 2B6AB 2FZKB 3T6BA 4Y2KA 4DHVA 3PW4A 4NRUA 2DO4A 2FJBB 4WJBA 2MB0B 4LF2A 1VRUB 4R0JA 4LSLA 1HBNA 3OL6A 2BW7A 2VBWA 4H4MB 2QMXA 5HQ8A 1NK7A 1DARA 2RF2A 3R5CA 1RZMA 4ZLLA 2JEJA 3C46A 3KLGA 4OV6A 4JI6J 3ENWA 4ILLA 2LA4A 1OQ3A 1JLEA 5AJ3F 3PR4A 1UVNA 1VC0A 2FYXA 5KG2A 3T1HF 3QIPA 2MKHA 3EVOA 3FEZA 1WF1A 2PFFB 5HROA 3ILOA 4FF4A 3V6JA 3H20A 5A2QY 1RT2A 2BE7D 2X7IA 3NY0A 4HACB 4E8UA 4Z2XA 2N4CA 1W2IA 3KLIB 2QTWA 2E66A 2EW9A 3LA0A 5I3UA 1D9AA 1RT4B 1GK8A 3BN4A 3R97A 3GR0A 2R8IA 2YKNB 5KG6A 2VC0A 1RB0A 1H73A 4ZA1A 1B70B 1F6TA 3SSQA 4DV2J 5F0UA 1FKOA 2IC3A 2CA9A 1FK9A 4QU7A 2AJQA 4JBCA 2BANA 1XK8A 2CJ9A 2CPZA 2HQDA 4G65A 4URQU 3T5JA 4JI7J 2EK1A 1JLFA 3I5AA 4YN3B 4KV8B 2KYZA 4U6PA 2ASDA 5ITHA 2UUWA 4QWCA 3OV7A 1LV5A 1T3NA 2UUBJ 2BQRA 3OQ2A 1GX5A 2JL9A 1GFWB 1HBUA 1RTIA 3OFFA 3M9OB 1CS4B 1PSDA 2FTRA 3K59A 3UFCX 1WI8A 3UD5A 2XHCA 4RW9A 2L9DA 1IN0A 3E51A 2Y1IA 3BZQA 4ECQA 1NK4A 1GQEA 2F4FA 3U27A 1DRZA 3UDCA 3ETOA 4WZMA 2BOPA 2RAQA 1QAIA 3G9CA 2HWTA 2AZ1A 3BM7A 2DGOA 1IKYB 2F8MA 4EUVA 1BHNA 1S9FA 4NASA 1WTBA 3BQ0A 3GG0A 3THVA 1B4SA 3JB9k 4CM2A 3I5CA 1HR0F 1IQTA 1WHXA 4Q8FA 1S0VA 2GQ2A 5CA5A 2XCAA 8AT1B 2WBRA 2XMWA 2XSJB 3PRVA 4OX6A 5IZHA 3VGVA 1I1GA 4DR7J 4I69A 3DYAA 4A8FA 2B6AA 1UW9A 3P6YC 5L39A 1IKVA 1WI6A 2EFQA 5L1IA 4J9KA 4I6WA 5BYRA 5T7LB 1UFWA 5LL6d 3GIMA 3DRSB 3US5A 1C4AA 2NREA 3H2UB 5D8HB 1IJFB 2PD1A 3KG1A 4RBVA 2C2KB 2AJFE 2ZFHA 1UZDA 3RAQA 2IYIA 2Q43A 4QIEA 2CPDA 3IRXA 2BRLA 3A12A 3BR8A 1VHIA 2W01A 4J9LA 3A13A 3E3XA 3W61A 4DR6F 4AD6A 4M5GA 2CPIA 1RAFB 2V8PA 3PW7A 2DPIA 1RQ0A 3G2XA 1T05A 3M32A 1SL1A 2RRBA 3JTPA 3HKZD 1OIAA 1JNRB 2AW0A 3TUJC 3CNQP 4ZVPB 3LTOA 3KLEB 2ZBIA 4DV0J 4DMZA 3QGPA 4P9SA 4DUZF 3ET6B 2OAUA 4NLYA 4OYXA 1JLEB 4IFVB 1H6KX 3DGPA 4TYAA 1NBEB 2M4MA 2MTLA 3POTA 4GRSA 4LRFA 1ACMB 2G0IA 2OSRA 4RPFA 1NSQA 4YUDA 4RW4A 4DPXA 2IBKA 2YKPA 2E1CA 3LF0A 3W65A 3L3CA 2VJVA 3V5RA 3T41A 5HVGA 5K8MA 2QA4G 3M8YA 4R8UA 2KVIA 4NLRA 3ZZPA 3C2PA 2VOPA 4QWBA 1S97A 1EETB 3ISND 2RU9A 4ZPAA 3L4BC 4AXJA 1C0TA 1VQKS 4UOGA 2YQ1A 5GAHU 3GYGA 5DS7A 2MPUA 3MI7X 2BA9A 3EWGA 3T5LA 2OKQA 2DR9A 1Y9OA 2JC1A 2ZH8A 3P5BP 4OZ5A 4EWTA 2B8QA 3H8YA 1Q0NA 5DG8A 2HFOA 4CLSA 4KGZB 3H2LA 2A6OA 4ANEA 1U2CA 2GAGC 2HFNA 2NSCA 4Q44A 3VZIA 2NCKL 1U8WA 2WVEA 4M95A 3D0IE 1LWEB 1NSKL 4TNOA 4XPCA 1H74A 2CQ1A 2RNEA 2V63A 1WHWA 3DNCA 4DBQA 4DL2A 2JX2A 1BWVA 4NEZA 1IBMF 2BRKA 1CLFA 3H4DA 1AA1B 3CW2C 2XLKA 2PE8A 2RVJA 1JIHA 4YB5A 2V4JA 1OQ6A 2CDQA 2IM0A 3FQLA 5D0RA 4F0HA 3CMAS 3D2WA 2HK2A 1HWUA 1SQGA 2YNGB 5KFPA 1Q8IA 1YBUA 1RTJB 1PBUA 1YDLA 2CQ2A 5D78A 3GG1A 1IBKJ 3FSYA 3LOUA 2WZ1A 1RWKB 3MCOA 2B7BB 2EFGA 3IM9A 3MM7B 2OGUA 4K4SA 4USKA 4ANDA 4I6AA 1VQOS 2DT9A 2ZH2A 3PFOA 4C9DA 1K1QA 2ALYB 1UETA 1RT3A 4MJKA 1CG2A 5AXMA 3OR1A 2ZJQQ 5JXSA 4BS2A 1U2FA 1K9MT 1FK9B 1S1VB 1XR6A 2J8AA 1C1CB 5LXRA 4ZHRA 3MD3A 2V0NA 3BH6B 1FE4A 1X60A 3IS9A 3FKBA 3Q89A 2VD3A 4FNHA 3R27A 1D8ZA 2GGPB 1R3NA 2FVPA 2HRTA 3IFEA 5KFMA 2FY1A 4HACA 2C3OA 2AF6A 2IBOA 1S6PB 3LO3A 2C1EB 3BEGB 4MKVA 3IR7B 4J9OA 1F60B 1HL6A 4EZ9A 2ZWOA 4YDXA 5J1NA 2R42A 1FD2A 4NLDA 2OPRB 3MMCA 2A18A 2IRXA 2V8HA 2XYHB 1FEHA 3NGKA 4UF4A 3MPYA 3QMQA 4DPYA 4DPUA 1TL7A 1ZZNA 4JI7F 2J0XA 3ADAC 1TTHB 4CH7A 4NCGB 2CXEA 2JNJA 2ROPA 3CB4A 4UY85 2OD4A 2X1BA 5HP1B 4CCHA 1YBAA 1BGXT 3KWMA 1ZM4A 2E29A 5I42B 1F3FA 4X4TA 3MFIA 1RTHA 4C48A 4KGVB 4ELUA 1NUEA 1U4BA 3I55S 2HW3A 1ZA1B 3BYPA 4C0BA 3RBZA 5K8OA 2PT0A 1RDRA 2BXJA 1RWXB 3GJSB 4WIQA 4OX8A 3KMQA 3W2WA 4I67A 2LEPA 2K7KA 1YJWS 5J2MB 1SH3A 4KHRA 1HD0A 1HNIA 4U8YA 1WWHA 5K8NA 2RRNA 1K8AT 4OHXA 3MCMA 4YS2A 5KFAA 3K5PA 3HJFA 1FX4A 1DURA 1RISA 2PIIA 4LR7A 2OH2A 3VQTA 4ZVGA 1TK5A 1KDNA 3DFEA 3TARA 2ZH9A 2KH9A 2ZUAA 3GYNA 4ANCA 4C8NA 4KT0C 3R8YA 3QGGA 1U26A 3HFKA 5C24A 1DTTB 5G4DA 3GCWP 4L73A 3CJKB 5AE1A 2NQPA 4B3TJ 4W98A 3FBFA 1NB2A 1YJRA 1BQMB 5IV3A 2C2OB 2BJDA 5A8RA 3CCES 5LMNJ 1VS3A 1K73T 3UD3P 3NMAA 3TVKA 3CD0A 5I3QA 1VQLS 4F3OA 1D9FA 4LBIA 4B3OA 1OY6A 3M30A 4LRBA 5E7OB 4KV8A 3E01B 1DLOB 4W92B 2HHSA 4PWDA 2YX1A 4KH1B 1HI8A 3C8YA 2YNHA 2JEIA 3JAMY 1HNZF 2XMJA 2AT1B 3CCUS 4J9QA 4PABA 1LWFB 4P74A 3M32B 1RK8A 2C2RA 2WOMA 1RKJA 2RHQB 2GHVC 3ZO7A 3IG1A 4NZ6A 5T41A 1VFJA 3IBFB 1VGYA 5J1EB 1A6LA 1RTDB 2WAQD 2XMVA 3O2IA 3W5ZA 2KI2A 3TQEA 4EBEA 5LXYA 4ECZA 4A8SA 2ASJA 5LMUJ 4FBTA 3BO3A 3C16A 5KFQA 3OJSA 1KHWA 2WK4A 4EZ6A 1N5SA 2KZZA 1YKWA 2BR0A 2W4DA 4CLWA 4DV2F 3HFVA 2AQ4A 1ELOA 4YR2A 3BDEA 4MK8A 2GHPA 4NLXA 3RTVA 3HVWA 1LFWA 1M5KC 2AJ0A 1ZPWX 2GS8A 3HM9A 3EDRB 3OVSA 4OI1A 3M9MB 4EI2A 4Y3CA 2IJRA 3TOQA 3NCQA 3DGVA 3G6XA 2RILA 1FVQA 2ZHOA 4OYIA 3U1LA 5E3CA 2V4JB 3MEGB 1UMJA 2HBQB 2PEHA 2VH7A 3LPEA 1R31A 3K8VA 2W7OA 5KOWA 3G6ES 3G71S 1FXRA 2V67A 5DZ7A 1NJWA 1TELA 3UWTA 4DFJA 4I64A 2IVFB 2QG9B 4K8RA 2E44A 2JH3A 2XBPA 4OZ1A 3J7Z5 4QYZJ 4RU2A 5J2MA 5AXNA 4KPCA 3IR6B 2WSCC 1FDNA 1VI7A 2WW4A 2ZHAA 4RZRA 3KDOA 3MMBA 4DUYF 4ED1A 2VL1A 2YKOA 1V3RA 4CT8A 3LWLA 3MDFA 4DL4A 1XNQJ 1S1VA 1RWPB 2DNLA 3MM8A 4CLLA 2G9OA 2AMCB 3HT0A 4TY8B 3BGRB 3K89A 1FFWB 2LP4A 2Z2YB 1HWJA 4OYWA 3WQPA 4ZVEA 1VIOA 3TZYA 4RO0A 1C2PA 3MM9A 2PN6A 1KKHA 2XSFA 4RLEA 3DKDA 3T5HA 5CCLA 4KE5A 3O5TB 1TAQA 3I4HX 4DN9A 3VV2B 5KT7A 2R2SA 6AT1B 3ILIA 3M8RA 3EXCX 2RDJA 1URNA 2XY5A 4W4MA 2BW2A 3DLGB 1SVDA 2GGPA 4X4UA 1BQNB 1CULA 1DQ9A 2WONA 1R27B 2WB1D 3CDEA 3I96A 5HI7A 4EU0A 3JAMU 3QAUA 2KRRA 4CT9A 2XLJA 2ZM6J 3JTNA 3AJ1A 1N5QA 3I9ZA 7FDRA 2X1GA 2XZWA 4K5RA 3ZZZA 2R7TA 4NXMF 4RW6B 2BM1A 2ZH1A 5ETOA 2V4QA 3CC2S 3W3SA 3BREA 2RF2B 2C2ZB 4ILMA 4K50A 1X4BA 3TAQA 4JI4F 4AL6A 1MWQA 1NJZA 1C1BA 2JEGA 4OJ3A 2CJQA 4B9NA 1M90T 2M52A 3P3DA 4OLPA 3VGTA 4O23A 1FNXH 2VA3A 2HFZA 1T0TV 1RT7B 1MN7A 2FY8A 2HBZB 3FRYA 1T03B 1S6QA 3PIPQ 2R8KA 4DSIA 5IC4B 4DUTA 3L95X 3B6BA 2CG4A 5D6GA 4CIOA 1VQ6S 1AFJA 2G2OA 1YJ9S 7FD1A 3HSDA 2MMYA 1RWOB 2EFOA 5DG9A 1JWWA 4OZLA 5F3ZA 4NXMJ 1PG5B 2DKOB 2BVZA 3H59A 2FJDB 3HXMA 1S6UA 1XJWB 3ZTOA 2CJAA 5ETPA 1U6FA 2AEMA 3JQMA 3VF0B 3W2WB 4A8XA 4CTAB 4WPAA 2D3ZA 2VPXB 1IR1A 1DQ8A 4DCPB 1TKDA 1T9VA 3NG8A 3KUEA 2LXFA 2WBMA 4LF1A 1HD1A 5KFOA 1VJWA 4CLFA 4JB8B 4QPTA 4WKYA 2HRYA 4DCJB 2IPOB 4AYBD 4U7UD 3AT1B 1KP6A 2Z58B 4RWWA 3NNCA 4ZVFA 4WF9Q 3FBBA 1PJ7A 2GCFA 4GVBA 2RQCA 2WSFC 1Q8KA 3M6VA 4DR4J 3AJ2A 4B3OB 2M7SA 3A3OB 1S7IA 3MZIA 4CO1A 3KHHA 2QLFB 4NLSA 1QAXA 4QW9A 2C3PA 5L1KA 4G1QA 3ZC4A 3B4DA 2KT2A 2UV8A 1S1XB 4JI6F 5A8RB 3UNGC 3KJQB 1WELA 3AQOA 2C22A 1KQSR 4IG3B 4U9RA 3H25A 1E6VA 1QAYA 3PYDA 1IBKF 5F3TA 1RCXB 5C25B 5DJBA 1G7CB 3QYYA 3Q8QB 2CQHA 3MPDA 5A6WA 1KFDA 1OPZA 4H4MA 1PC4A 4YB1P 1F5CA 2B5JA 1XMQJ 4DV4J 3UI3A 3C6TB 2CPEA 2GZOA 1RU2A 3OTOF 3QLHA 2VONA 2W2QP 1OSCA 2F5GA 5E3PA 5SZTA 2C2EA 3U02A 5HAOA 4K4ZA 3BJYA 4J7CA 4RUHA 3S01A 5DDPC 3KLIA 3VGSA 3QGIA 2JLGA 2LYVA 2DCLA 5HBMA 3J81j 2EG1A 4WU2A 1VIXA 1R43A 1S1TB 3UVJB 4ELTA 3FEYB 3AFGA 1R8BA 1NJYA 4HDHA 4HI2A 4WWSA 2GHWA 3MMJA 3BO2A 3DOLB 1PJ5A 3A3PB 4PG5A 4FXWA 2FJXA 5J2PA 3MEGA 3KLVA 5IT0A 2Z57B 3C3LA 3M2VB 4Z7CA 2CWKA 2UVRA 1TR0A 2KU7A 3TW0A 4DU7A 1B64A 4NLVA 3PX0A 1W2BR 2LECA 1S72S 4HL9A 3VAGA 4A8KA 1KONA 2YWKA 4PEOA 2HQGA 1N8RT 5IM0B 2D3O1 4B3RF 3SV3A 3PG9A 1KEKA 3CCWA 3QO9A 3D1OA 5KG5A 3UR0A 2CJBA 2OELA 4CH0S 2RMLA 4Y0FA 1K0TA 4WK1A 4DR5F 2UU9J 1RBAA 1JXEA 3T6JA 5FDLA 4PCQA 1D9DA 2CNLB 1HMVA 2X3GA 2R8GA 1G2EA 4OI3A 3MECB 1C0TB 3M8PB 4XPEA 2LVWA 3A4TA 1VQ8S 3I32A 2CQ3A 2HNZB 4ZK7M
chains in the Genus database with same CATH topology
2NS1B 3CDWA 4ECXA 3V6DB 2BDPA 3ZZYA 2LQJA 3N6MA 2OPPA 4MIWA 4EO8A 4DG1A 1R89A 1JLAB 4MKBA 2V94A 3FZ2A 2KB2A 4LFCF 3TAMB 2FD2A 4R25A 1HYSB 1U7LA 2FHOB 1NK9A 2Z4PA 1Q16B 4XK8C 3FSXA 4G1QB 2UUTA 4N8NA 2JZ5A 4ZPWR 5E33A 1SJFA 5FD1A 2KT3A 4LVNP 1SH2A 1J5EF 1S99A 2HVIA 4ZVHA 4Q2LA 4KTQA 1YQHA 4O44A 2C3YA 1FKOB 2IC3B 1E6YA 2L9NA 1XMBA 1XWLA 4MKAA 3HP6A 1SJ3P 1M5PC 1JMTA 3V6DA 2NUUG 3CIMA 5DRKA 3MR5A 1V9OA 4ALZA 4FF1A 4ECWA 3CCMS 4U7CA 2ACYA 2F1FA 2B51A 3IR5B 4NX9A 5KFLA 3TVZA 4C11A 4U67Q 1M5VC 2R8HA 4DV1F 4FNIA 2I1RA 3N28A 2VASA 4C2MA 5JJBA 3ITHA 5J2QB 3DCAA 3QWUA 3KNGA 1Y4ZB 2FVRA 4N77A 5KFTA 5K5MA 2RB7A 3NLCA 3CJKA 1BY9A 4B9VA 5K8PA 1FEEA 2MQMA 3OXLA 3T9NA 2ZH4A 4NLOA 5F8HA 4V19J 1HNWF 2I2YA 4TU8A 3HHDA 2HHVA 3BGFA 3JYTB 4ZLPA 3H5XA 1K0VA 2POKA 1FXLA 1QE1A 2KO1A 3G8TA 1CEZA 2O5DA 1KQKA 2UXDF 4RW4B 2BABA 3MR6A 1SKRA 2OJ3A 2IJNA 3NNHA 1VQNS 4NLQA 3AH6A 2FHJA 2ZOFA 4NCGA 2HIQA 3T1AA 1Y5IB 3MHYA 1JJ4A 3SYZA 5H1SV 4DV5F 4B9SA 3H5UA 3JTOA 1RTDA 1SXLA 3K5LA 1KVJA 4ED2A 2P6TA 3DMJA 2A1BA 1SQEA 3OXGA 3CJ3A 2LCWA 4USIA 2JVRA 3UCGA 3QAEA 3FEXB 2GFFA 4RNFA 2RQKA 2G1DA 4NYPA 2J6TA 2MDAA 5HP1A 2J76E 3BSOA 3CT9A 2GQCA 1QAJA 4B9MA 4AL7A 2DGQA 2V8VA 1ZTTA 1IJEB 2J5AA 2UU9F 3UDLA 4F26A 3DLEA 2Z2LA 1RI7A 1FRKA 1S1XA 3IBWA 1TKTB 4IG3A 4N47A 4WKRA 3B78A 3PX4A 3M1VB 4MFBB 1ZH5A 1NK6A 3DOKB 3V2UC 3MM7A 3BSAA 4KSEB 1H7WA 3OXFA 4BC9A 6FD1A 2R8JA 1ZOTA 2HLTA 1VRUA 3HKWA 2ZH7A 4GC7A 4UQTA 4I2PA 2B4OA 2DO0A 4BC7A 2R7RA 1C1CA 4ECRA 1R0AB 2MQNA 1N5TA 2V4RA 2DRAA 4FXVA 2FLOA 3NP5A 1MROA 4C7QA 1VQ5S 2CPHA 2I0XA 5E0OA 4IDKA 2ERRA 2DR5A 2KKHA 2D3OR 4IG0B 3KK3A 3MM5B 1YRUA 2N3OA 4J37A 3M6WA 3FCHA 3MMAA 4X4RA 2IM2A 4F4XA 3TANA 4NLGA 2BM0A 3LQVA 4DR1F 2DTJA 5IT9Y 3HDSA 1BD6A 3VR1A 2KM8B 2HNYB 2D9OA 1LW0B 2QA2A 1IKVB 2XI2A 3M2VA 3MWBA 3CCVS 4J9SA 1XMOF 4O3PA 4I2PB 2MSSA 4LSNB 4F4ZA 4ECVA <