2IAJB

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with atp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
427
structure length
415
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 103
structure length 415
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2iajB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajB03
2W9BA 1C2PA 1HNIB 3BQ2A 1S0NA 3DLKB 1RT6B 3IS9B 4K4ZA 4O4GB 1FKOA 2QV6A 3QYYA 4ED6A 1S9FA 4ZVFA 1TL3A 3LALA 5JXSA 4M94A 1JLGB 4B3OA 5KG2A 4EO8A 1S1VB 5K14B 1HNIA 3I0RB 1JIHA 3MR5A 1QAIA 4ED3A 3DLKA 4IH7A 1MU2B 3IS9A 1ZTTA 3JYTB 4MK8A 5KFVA 3TVKA 4K4XA 4KHMA 5KFCA 2D3UA 3GYNA 4F4XA 4EYIB 1JLGA 1K1QA 5K14A 4DL4A 3I0RA 3MEDB 3CDUA 3KMQA 1MU2A 3NAHA 3JYTA 4NLRA 2J6SA 5KFWA 3FDSA 1UWBB 4RW7A 4QWBA 3LP1B 3KK1B 2CKWA 1S6PB 4YR3A 2WTFA 2V4RA 5KG7A 3MEDA 2ASLA 4I2PB 4Y34A 1KHVA 1HARA 4J9PA 3KK3B 4ECSA 1UWBA 1RT2B 4U6PA 4ED1A 3H4DA 4NLWA 4DG1A 2IM3A 5HROB 3DLEB 2IM0A 1TVRA 4WFYA 4Y2AA 4NLPA 5CYMB 1DTTB 4K4WA 5C5JA 2BQ3A 3QLHB 4WXWA 3KHLA 3DI6A 3HVTB 3DLEA 4O44B 5C24B 1RT7B 4ECZA 3BR9A 5DLGA 5CYMA 3T19A 1JLBB 1S49A 2IJFA 1NNDA 3KHGA 4J9MA 2FVQA 3RB4A 5KFTA 4ED2A 3GILA 3HVTA 5J1EB 1XR5A 1RT7A 2WONB 5F9NA 1HNVA 4IQXA 3OL6A 2D3ZA 4I7FA 3H59A 4H4MB 2YKNB 2OPRA 4O4RA 2YNGB 4J9KA 2ILYA 4RW8B 3QIDA 3MR2A 3Q8SB 1SV5B 4WXOA 4YP3A 4WFXA 4EO6A 5EWGA 5L1IA 3HKWA 5J2MB 2YNGA 4NRTA 3OL9A 1S9GB 1RT5B 4RW8A 3G6VA 5J2NB 1SV5A 1S0MA 4X2BA 2FVCA 4ZHRB 3BSCA 4MK9A 1VRUB 1N5YB 4NLXA 2C2RA 3QGGA 2ZD1B 2AU0A 5J2MA 4WZQA 1J5OA 4PQUB 2UVVA 1Z4UA 3V6DB 2I1RA 2R8GA 5F8JA 2QE5A 1S4FA 1TKTA 2OPPA 2B6AB 1HMVA 1N5YA 3PJXA 2ZD1A 2YNFB 3PJWA 1VRTA 4URQU 4PQUA 5KG4A 2RKIB 1TP7A 5J2QB 3NBPB 4F4ZA 4I2QB 3KMSA 2B6AA 1U09A 1FK9B 1RTHB 1RTJB 4KO0A 2YNFA 2HWHA 4TYAA 2JEFA 3OHAA 2ASDA 4IR9A 4ZMMA 4FS2A 2RKIA 3LP0A 5EWFA 5J2QA 4I2QA 4J9OA 4TLRA 4ZP6A 2B5JB 2V0NA 1FK9A 1RTJA 2XGQA 3KJVB 3BREA 2OPSA 1BQNA 3BSAA 3BSNA 1QE1B 3ISND 1NHUA 1C0UB 4RW6B 5L1LA 2HMIB 4ZVHA 2I5JB 3PZPA 5F8GA 2E9ZA 3DOKB 3CJ4A 1KLMB 4MFBB 3CJ2A 4MK7A 3KJVA 4TY8B 5I42B 5KFRA 5KG5A 1TL1A 1D0EA 2XGPA 3RBEA 2R8HA 3LAKA 3KLHB 2R2UA 4ECQA 1QE1A 1C0UA 4RW6A 2BQRA 1SH2A 5DQHA 2HMIA 1TV6B 2I5JA 1IKYB 1DLOB 3DOKA 4TY8A 1EP4B 5I42A 5L1KA 3KLFB 3KHRA 3PW5A 4NLQA 4GC7A 4KFBA 3G86A 3IN5A 4MH8A 3HVWA 1GX5A 5L9XA 1JX4A 3N6LA 1EP4A 2XI3A 4ECTA 5DG8A 2R8IA 1BQMA 4J9LA 4O3PA 4O3SA 1TL3B 3PVXA 3UR0A 3H5YA 4FS1A 2WRMA 3C6TA 5DQIA 3PW4A 3C6UB 2FVRA 4IFYA 3BQ0A 3IG1B 2GC8A 3M8PA 2XWYA 4QWAA 3H5SA 3V4IB 5KFSA 3H40A 4ID5A 2WHOA 5F8MA 3GQCA 4H4OA 1JLAA 3RBDA 3OSPA 3M9OB 2C2DA 1WNEA 4WFZA 4ZPBA 4M95A 3D5MA 3C6UA 3FFIB 4J9RA 4TY9A 1JKHA 3IG1A 2OPQB 4RW7B 3V4IA 5KG6A 2FVPA 2UVWA 1I6JA 2HNZA 3KLGA 2AX1A 4R0EA 4TN2A 3FFIA 4YR2A 2EC0A 3PW2A 5D3GB 3DMJB 1FKPB 2OPQA 5KT2A 1HPZA 3CWJA 2VG7A 5F8LA 4DG1B 3DDKA 2JC1A 1S10A 3OL8A 1TVRB 4IFVA 4KV8B 3Q8RB 3IRXB 5KFAA 5DG7A 4KE5A 5D3GA 3DMJA 1FKPA 1LWCB 1N6QA 4LQ9A 4K4YA 3T1AA 3CJ0A 4ED7A 3H98A 4LSLA 1RTIB 3DI6B 4ED0A 4KV8A 3IRXA 4RNOA 3OLAA 1LWCA 5KFEA 1QAJA 3MEGB 4R5PA 3MF5A 1JLCB 4LQ3A 1RTIA 3H4BA 1HNVB 3DRPB 2B43A 3ICLA 4I7FB 1RA6A 4NLVA 2AGPA 2OPRB 3MEGA 3MR6A 1JLCA 4KHRA 4ZP7A 4ECVA 1S0OA 2RF2B 5KFDA 1RT1A 3GIKA 4Q8EA 1SH0A 2R8KA 4EBEA 3DRPA 1T05B 4F4WA 1TKXB 3QZ8A 2R2RA 4R8UB 4K4UA 4EBCA 1JLQB 4ECWA 2RF2A 2DPIA 4JV0A 2IC3A 3DYAB 3CIZA 1T05A 1TKXA 4DL6A 1LWEB 1YVFA 4MKAA 4R8UA 2W8LA 3IGVA 1JLQA 1QUVA 1J5OB 5DGAA 3SI8A 2E9RX 3BJYA 4IH5A 2D7SA 3DYAA 3FQLA 3M8QA 3NMAA 1TKTB 2OPPB 1LWEA 1HMVB 4O3QA 3OSNA 4EEYA 2BE2A 1VRTB 1RT3B 3GV5B 3PR5B 4JV2A 1LWFA 2JEJA 4XPEA 1JXLA 1IKVB 4WZMA 1S48A 3NL0A 1S1WA 4NRUA 4KO0B 3BSOA 3RB6A 2FLPA 1RT3A 3LP2B 4PWDB 2AQ4A 3BQ1A 3DM2A 3LP0B 1N4LA 2IM1A 1IKVA 4Y2CA 4WE1B 1JLEB 5I3UB 5KFKA 4QW8A 2C28A 2ZE2A 3JSMB 2HNDA 3VQSA 3ISNC 1T94A 3LP2A 3RAQA 2R2SA 4PWDA 3GV8B 3G6YA 4NLOA 2OPSB 1BQNB 1SH3A 2AX0A 2BANA 4QPXA 2VG6A 4WE1A 1JLEA 5I3UA 2O5DA 3NKYA 4F4YA 2W7OA 5KFOA 3JSMA 1K1SA 3DOLB 2GIQA 1N56A 1TL1B 4NLTA 4TXSA 3NAIA 4J9SA 4DL3A 4G3IA 4QWDA 3CVKA 1S1TB 5HP1B 4KAIA 5KFGA 1GX6A 4ZPAA 3KHHA 4K50A 1IKXB 3CDWA 3N6NA 1REVA 3DOLA 3UQSA 3KLEA 4RW4B 2IA6A 2JEGA 1DTQA 2VA2A 3H5XA 2YKMB 3CDEA 3FQKA 4FBUA 2HNYB 4WYWA 4KFBB 1S1TA 5HP1A 2W9AA 1IKXA 2W8KA 4JV1A 4RW4A 5FDLB 1HYSA 3PR4A 3RAXA 2V9WA 2YKMA 1BQMB 2HNYA 1MMLA 5KFPA 3MFHA 2W9CA 1T3NA 4YQWA 5C42B 4NLSA 3C6TB 4ZP8A 1N48A 1SUQA 1D1UA 5FDLA 1OS5A 4NCGB 4IR1A 4K4SA 4IFYB 4YMEA 1RTDA 3QO9B 3M8PB 2ALZA 2IBKA 5JUMA 4ID5B 1RYRA 5C42A 3I5AA 4H4OB 1JLAB 1IM4A 5CYQA 1IKWB 5KT5A 4KBIA 2ASJA 4NCGA 3FSIA 4RNMA 5KT4A 1JKHB 5DGBA 4Q8FA 3QO9A 3EZUA 5KG3A 2WOMA 3MECB 1EETB 1S1UB 4NLYA 2YNHB 4WYLA 5DLFA 4ZVEA 5KFIA 2HNZB 3KLGB 5KFXA 4QWCA 1IKWA 1C1CB 3M9MB 3QGHA 1HPZB 2VG7B 3MECA 1EETA 1S1UA 3PW0A 3EPGA 2YNHA 3BGRA 5DG9A 4IFVB 4OL8A 1C1CA 3H2LA 3D28A 5KT3A 4MKBA 1NHVA 3UPFA 5KT6A 4XPCA 2ZKUA 1N6QB 3V6JA 3DRSB 4GC6A 4LSLB 2BRLA 2FJXA 2FLLA 3ITHB 4RW9B 4DL7A 3TAMB 4IRDA 3QIPB 1TKZB 3DLGA 2UUTA 3HVAA 2DPJA 2J6TA 5F8NA 3QZ7A 5KFLA 4Y3CA 4R5PB 1RT6A 3DRSA 4ED8A 1HQUB 4O4GA 4Q45A 3ITHA 4RW9A 3TAMA 4O3OA 3QIPA 4Q44A 2VA3A 5F8HA 1TKZA 5KG0A 4RNFA 5KT7A 1S1XB 1S1VA 4LSNB 2HAIA 3E51A 1RYSA 2FJWA 2UVUA 1XR7A 4ICLB 2VG5B 1HQUA 2JEIA 3QGIA 4K4VA 1RT1B 2UUWA 4O3RA 4TYBA 4ECUA 2ILZA 1S1XA 4JUZA 4LSNA 1RDRA 1JLFB 4ICLA 2VG5A 3MTKA 4RNNA 2IC3B 5DQGA 5KFHA 2XCAA 1RAJA 2AWZA 3LP1A 3KK1A 2BR0A 1S6PA 2D41A 2WB4A 3EPIA 4J9NA 3M9NB 1JLFA 4TQSA 2AGOA 4I2PA 5KFYA 3SFUA 2R8JA 4U7CA 3I5CA 3KK2B 4IDKB 3KK3A 3RB0A 1RT2A 4XO0A 2FVSA 2IJNA 3IGNA 5KFJA 3M8QB 4G1QB 5HROA 4PUOB 3T5JA 5J2PB 2C22A 2BE2B 5C25B 3MFIA 3G6XA 4HYKA 4NYZA 3N6MA 2YNIB 1ZTWA 3MR3A 1DTTA 1LWFB 4IDKA 3KK2A 2HWIA 3Q8QB 1ZETA 2CJQA 3SFGA 4ECRA 4RU9A 4G1QA 3QLHA 4PUOA 4IOBA 1S1WB 3PHEA 4NLUA 5C24A 4O44A 5J2PA 5C25A 2XCPA 4NLGA 3T5LA 4QW9A 3T5KA 5HBMB 5HLFB 2YNIA 4RNHA 2WK4A 1JLBA 3DM2B 2BQUA 3CJ3A 4F50A 3NGDA 1HQEB 3LANA 4IG3B 3T5HA 5J1EA 4ZPDA 2ZE2B 1R0AB 2HNDB 2IAJB 2WONA 4IKAA 2RDJA 3V6HA 1LW2B 5HBMA 5HLFA 2BANB 4MIBA 3KLIB 2OH2A 4H4MA 2YKNA 3RB3A 2VG6B 3I0SB 4IG0B 3HHKA 4KSEB 3KLVA 1HQEA 3GIMA 4ZVGA 4IG3A 4FBTA 1T03B 1R0AA 2IAJA 2BRKA 3GV7B 1LW2A 4MIAA 1W25A 4URSA 3KLIA 3V81B 1XR6A 1C0TB 3PW7A 3I0SA 4IG0A 1S9GA 1RT5A 4QWEA 3CJ5A 5J2NA 1T03A 1KHWA 2F8EX 1REVB 5F8IA 2JLEA 3KLEB 4H54A 4NZ0A 1DTQB 4ZHRA 2WCXA 2XI2A 1VRUA 3UDLA 3V81A 1RT4B 2FLNA 1C0TA 1TQLA 5F9LA 5EDWA 3OHBA 3TQ1A 2UVRA 4DEZA 3H5UA 1RA7A 3V6DA 1S6QB 1HYSB 5EUHA 4DL5A 4RUCA 4ECYA 4J9QA 2AGQA 1RT4A 5KFMA 2W9CB 2V4QA 4Q43A 4KKOB 4RZRA 3E01B 2J6UA 4ECXA 1S97A 1S6QA 1SUQB 3NBPA 3OL7A 3GIJA 2XC9A 2GIRA 1RTHA 1RTDB 1LW0B 4Q0BB 3Q8PB 3KNAA 4KKOA 5EWEA 5KFFA 3E01A 5KFBA 5CYQB 1CSJA 2C2EA 2IMWP 4IRCA 2B5JA 2JC0A 4IH6A 4RUAA 2WOMB 1LW0A 4HKQA 4Q0BA 5KG1A 3FRZA 2R2TA 4K4TA 3DRRB 5KFNA 2W7PA 2RDIA 5KFUA 5T14A 4ZPCA 3GIIA 4KB7A 3V6KA 4TQRA 1KLMA 4MFBA 4YR0A 2E9TA 3DRRA 3BGRB 3KLHA 2ATLA 3CO9A 3I5BA 1S9EB 4URGA 3MEEB 4ZP9A 1TV6A 4EBDA 1C1BB 1IKYA 1DLOA 3OLBA 2W9BB 5L1JA 4DL2A 4IRKA 3KOAA 3LAMA 5KFQA 3KLFA 5KFZA 2FJVA 1FKOB 4NLDA 1S9EA 3MEEA 4O3NA 4B3OB 3DLGB 2IM2A 4EYHB 1C1BA
chains in the Genus database with same CATH superfamily
2RU3A 1RHJB 2CVEA 4ED6A 1GH8A 5KG2A 1HNIA 1JIHA 1HBOA 3JYTB 3GYNA 1AT1B 2QLBB 3SQGA 1MU2A 1MSWD 1UWBB 3R5AA 2MZJA 5D6GA 2JVOA 5K8MA 2IM0A 4WFYA 1SI9A 3UN3A 3VTIA 2NREA 2Z2LA 5C24B 1RT7B 3BGOP 4FYDA 3M7VA 1HHSA 1OQ6A 1FDBA 3Q8VA 4RW8B 2HIQA 2NPFA 1T9UA 2CJKA 2PA8D 1IUJA 1HD1A 4UOHA 3BSCA 5LMNJ 3QGGA 2XLKA 1FXLA 3US5A 2B6AB 3M4XA 3O5TB 1RAHB 2HS4A 3C66A 4I6YA 4ZMMA 3K59A 2Q1LA 4ZP6A 2B5JB 3NOGA 4BC7A 1FK9A 3TX0A 2XNRA 1NHUA 2YKAA 4F25A 1RQ0A 2XGPA 3RBEA 2WW4A 3PXGa 1WHVA 3OR1A 1VOMA 4TY8A 1EP4B 1K47A 2ERRA 1GX5A 5DG8A 2M52A 2LLZA 4HHHA 4O3SA 2V2QA 3OTEA 1X31C 4RKUC 3RRGA 1NDKA 3H5SA 1K0VA 4AE5A 3MUVP 2FVPA 3U1LA 2DTJA 4R0EA 1AFJA 2W1BA 4UY8T 3OL8A 2UXBF 2BV3A 1HNWF 2D69A 5ETTA 5CQGA 4NWBA 1RBLA 2DR5A 1UEVA 5KFDA 1VYAA 1WI6A 2MQOA 2WVBA 3PHTA 2HHUA 4OYOA 4UOFA 1JLQA 1F6TA 3R5CA 1VCTA 4J91A 4NXNF 3GV5B 4WF9Q 3ULHA 3SEOA 2JJ4D 2N4DA 4J7CA 2RJZA 2XTJP 3SCKE 3I6PA 4M5MA 1WKJA 3Q22A 1Z2LA 5I3UA 3T6BA 2AEMA 2WW8A 1TZ0A 1MLAA 5KFGA 4DV5F 3UQSA 3N6NA 1REVA 4RW4B 1QAYA 3H5XA 4IYQA 2QLJB 3AH6A 1YJ9S 1JXVA 2MKHA 1VK8A 2VKRA 4H4OB 4B9LA 1UA0A 3VHQA 3FSIA 2WOMA 2IPOB 3OBIA 2HWTA 2M88A 4PYDA 1DQ9A 5K20B 3QGPA 1QTNB 4USUA 2FLLA 3QFWA 4YY3F 3OD2A 1TELA 1A0OB 3K89A 4Y3CA 4KRWA 2F9DA 5IQQA 4K4VA 4O3RA 2MKYA 4ECUA 4ELUA 2ILZA 4JUZA 2UZAA 2MGZB 1X0PA 1GK8A 4TVAB 5KFYA 3SFUA 3HX9A 5T41A 3BF4A 4OZNA 4IDKA 2BJ7A 4Y6IA 2V94A 2XCPA 1L3UA 3PHEA 5C24A 1OPIA 2HLTA 3T5KA 3I9V9 1XBWA 2IVMA 4F50A 3OV7A 4IG3B 2P6SA 2HNDB 3W5XA 2G2YA 4KC5A 4RBTA 1HQEA 2RVJA 4P7TA 2EPIA 1B4SA 4L6V3 2VBZA 3MM6A 4PG5A 1LWXA 1RISA 4H54A 1VHFA 1LNQA 3LF0A 2XY5A 1RT4B 3BYRA 5IOLA 4DU7A 1NXIA 3JSBA 1AYEA 1HBMB 3PFEA 5KFFA 1FEEA 4IRCA 2B5JA 4OQJA 2FC8A 1MN7A 1Q8KA 3FRZA 1N0VC 3T41A 3W63A 2ATLA 2IYGA 2LMIA 2Y0SD 3KDOA 4DL2A 2P8IA 5G4DA 2H48B 4F02A 3X1LB 4BWMA 3TVYA 6AT1B 1S0NA 1YJTA 1S1VB 3X3UA 3IS9A 4KHMA 4EYIB 2YX7A 2XY6A 5IC4B 2GGPB 4F26A 2GMHA 3RU0A 3W61A 2WTFA 2V4RA 2XULA 1P9QC 2A0FB 4Y34A 5LSLA 4IOCQ 3KK3B 3DLEB 1M5SA 4K4WA 1H73A 2D9OA 1ZZNA 3OFEA 5F9NA 2B0GA 3HI9A 3AOAA 1N32J 1N34F 4NMXA 2ILYA 4CH7A 2GZOA 5J2MB 2LA4A 2ZD1B 1TUVA 1U2CA 4KGZB 2YWHA 1N5YA 3N28A 3PJWA 1Q78A 2HFVA 5IM0B 3J7A1 6FD1A 2JEFA 1S12A 1F9FA 1EKSA 1XNRJ 4AL5A 1HIYA 4U67Q 2X1BA 5SUHA 1Q7LB 3PY8A 3BREA 3BSNA 3TUIC 3PM9A 3BV8A 3W66A 4DV6J 1RLCL 4NXMF 4CWBA 1S59A 3TEHB 2UUCF 4O0NA 1PGZA 2PEHA 2HURA 3M8WA 1HWLA 4H4KC 2MYFA 2KFNA 4H4OA 4CO3A 3J7Z5 2C2DA 3FFIB 2MQPA 1Y0HA 2I9SA 3J81j 2XSFA 2ZHAA 4DR5J 4B9VA 1EARA 1WACA 1TVRB 3ISZA 3RZAA 1XIQA 1TTHB 3CJ0A 3B54A 3IRXA 2LQ5A 3C3LA 4ELTA 2ZH2A 2B43A 3GJSB 4NLVA 2RF2B 3EE3A 2V5HG 3QZ8A 2QA4G 2EI5A 4JI1J 2DHGA 1TMMA 2OFHX 4HVZA 1FX4A 2VFSA 3DYAA 3FQLA 3NMAA 2OPPB 1LWEA 3DKDA 4HDHA 4ZLLA 4KQZA 1FRXA 1T9VA 2XSJB 1IKVB 4KYZA 4LSZB 5GVQA 2HNDA 3LP2A 1BMQB 5IT0A 2W7OA 2GS8A 2E1RA 1IQZA 2CNLB 2QA1A 2J0SD 4KAIA 4ZPAA 2NQPA 1NZ8A 4YDDB 5L9NA 1IKXA 2MZTA 3RAXA 2UV8G 1RAGB 4A8WA 3KWMA 1Q53A 5B0AA 3W65A 3E2EA 5KTQA 2OIHA 4JI3J 1IM4A 1HWJA 1N0UA 1P1LA 4B3SJ 4ZVEA 3KLGB 3R5BA 4QR1A 3LWLA 3TRGA 3QRQA 1HPZB 3D28A 2ZKUA 4FNIA 3DRSB 3HJFA 4G6VB 4AXJA 1HI1A 4DR4J 3UE2A 1S1VA 1HQUA 1RAOA 3OTOJ 1JLFB 1VDHA 4DDFA 1N8RT 2XCAA 1MWZA 2VBXA 3MAAA 3EPIA 4TQSA 2ASYA 4ETZA 3KK3A 3R97A 4DPTA 4WTOB 1XMBA 1VMBA 4JBCA 3G8SA 1S6OA 3SFGA 4MAKA 5J2PA 2DR6A 1U47A 5HLFB 1X4GA 5DZ6A 2DKOB 4CO1A 5LT5A 5IFMA 2PGCA 3QWUA 1HBUB 1RBAA 3KLIB 2VG6B 4X65J 1TFWA 2K7KA 2NXNA 4JI0J 2VJVA 3Q86A 4URSA 3V81B 3PIPQ 3I0SA 1RBOB 3KG0A 3U1NA 1KFSA 2DCUB 1UW4A 1KSPA 5D4NA 3TQ1A 3M6VA 5KFMA 4OYIA 2HIYA 2KZMA 2MQNA 7FD1A 3LWMA 3KNGA 1MWYA 4JI4F 1V5VA 3HSZA 1QY7A 5KFNA 4JI5F 3UD4P 2OD4A 1E6VB 4NZ6A 4JOUA 5LOQA 2B56A 2UXDJ 1OY6A 3JTPA 1C2PA 3K8WA 4O4GB 2WZ1A 4KHPJ 4DSIA 4P2XA 3MR5A 1QAIA 1GMUA 4IUFA 2HFOA 4FF3A 1SC4B 4LF6F 2POKA 2X7IA 2DHAA 3A8KA 2HHTA 2V9KA 4USTA 1P1TA 1TVRA 1QUPA 2FGCA 3CCSS 5C2GA 1WTFA 4A8FA 2OTLS 3RGIA 1V3SA 3DFEA 1XR5A 3JSYA 4DFJA 1ZAWA 1B70B 4DR6J 1T3OA 3GP9A 3GR0A 2R42A 2AIRB 3WIUA 1ZBTA 2YNGA 1F60B 3ZXWA 1CC8A 3T6JA 2LDYA 1RHMB 2DXDA 3BPSP 3V6DB 2R8GA 1UVMA 2OPPA 2RU9A 1UETA 1SKSA 2XSJA 3NBPB 1MMDA 2HWHA 2CJXB 3W2WB 2Y1RI 4I2QA 3BS9A 4P74A 3J80U 3SCLE 3CJSA 4ECQA 2KJWA 1C0UA 4JI8F 1FD2A 5ETSA 2BQRA 2DH7A 2KVIA 1IKYB 4OI3A 3PW5A 3AJ1A 4MH8A 2AJ0A 1PAUB 3G82A 3N6LA 4PWUA 2QFJA 4Y0FA 5ETKA 2JFDA 1R8AA 2RNEA 4JV5J 3UO0A 4ZCKA 3THTA 3I56S 1N5QA 2KO1A 3VF0B 3WDOA 2K06A 1EJ7L 4TNOA 2KB2A 3KLGA 2B4UA 5LJ5Y 3AD8C 1F5CA 3UW1A 3PYDA 2OPQA 4E98A 1HPZA 4ZJQA 3DDKA 2KFZA 1VLOA 5BYSA 1PYSB 2CPZA 1CULB 1DHMA 3KJQB 5J1PA 4V1Ak 2HQFA 5ETQA 1LEOA 3SCIE 3AQPA 3P4UB 2DGXA 1HI8A 2AGPA 3TQEA 3CD0A 2GFFA 2VOOA 4Q8EA 1SH0A 1HKAA 4D3GA 4C3LA 1YVFA 3R6LB 2B7BB 2V8DA 3SI8A 3AB2B 4DOZA 2VPZB 1OQ3A 1NKBA 1RT3B 2CPHA 2IA0A 2JEJA 4P2MA 4Y2MA 1S48A 2AQ4A 1RK8A 4CLPA 3ISNC 1FI4A 3RAQA 3EMTA 4HTIA 4LF5J 2XO6A 3RRKA 1HBUA 4UOCA 2VG6A 4AL6A 2QG9B 1FTCA 4F3MA 2ATCB 2JEGA 1NSAA 3CDEA 3HO1A 2NYHA 1S1TA 5HP1A 2RUGA 3FSXA 3I32A 2OI2A 1K9MT 3T1YF 2V34A 4FF2A 5C42B 4OZJA 4X4VA 5K8PA 3A12A 3I5AA 3VGTA 1RWKB 4QWCA 2VDHA 1Q8BA 3MMJA 3F41A 1S1UA 5HMYA 2R7SA 4FXWA 1E6VA 5FLXY 4MKBA 3S8SA 2FJXA 1NB7A 3PO5A 2PMHA 3HVAA 2UU9J 4R5PB 1N33F 4O4GA 4DV7J 3TAMA 1UJ4A 1XMOJ 4PG7A 1V3ZA 5FJ4A 3Q89A 1ICEB 1SJ4P 4DSJA 1VR6A 2WB4A 4YB5A 4J9NA 1CJTA 4DMZA 4X66J 4U7CA 4QIGA 1AUDA 4PUOB 4RX6A 2V50A 2Y9HA 3KK2A 5ADZA 2AJFE 3MPDA 4NLUA 2HHXA 5E3RA 4DF4A 1PYTA 2FDNA 2AJ1A 4C3KA 2WVFA 3HHKA 1FRHA 4I6WA 1LW2A 2N4CA 1PCAA 4PQAA 3ZZYA 4ZITA 2XYGB 1T0TV 3KLEB 4HH1A 1SIZA 4OHZA 1C0TA 2KRBA 4C11B 3OHBA 5I3QA 2XMUA 3V6DA 2CNNB 4ZK7M 1L3TA 3Q2SC 4U9RA 4YN3B 3E01B 4I6AA 2J6UA 2XS5A 2X1FA 3NBPA 1CJKB 3V2UC 2RH3A 1HWIA 3IBFB 1XQIA 3PX0A 4LFAJ 2VHGA 4KH1B 5DJBA 1KVIA 2LU1A 4KB7A 4PXBA 3DRRA 1GFWB 3MPUB 5HO4A 2EBGA 3MEEB 1C1BB 1IKYA 2QSWA 2C3UA 5KFZA 3PIOQ 4DV0J 4NLDA 2GQQA 2Y0BB 2QA4S 1PC5A 3QAUA 2LQJA 3K0JA 4K4ZA 1FKOA 1ACMB 4OFZA 4M94A 1GTHA 2GJFA 2QL9B 2D3UA 3DGPA 8ATCB 3DLBA 5K14A 3MEDB 4X4QA 4PPDA 3DRYA 4NLRA 5ITHA 3MTJA 3WBZA 4I2PB 2XMJA 4DSEA 4CLLA 2GMJA 3GSIA 3IR7B 1KTQA 5CYMB 1CULA 2DO0A 2X1GA 2BM1A 1YWXA 3PYEA 4FYXB 2FJAB 4DR2J 2VODA 3H59A 4NYPA 5DM7Q 2P9CA 2ZBCA 1SV5B 4ILLA 3PNIA 3EZOA 5J2NB 2FVCA 4NLXA 5T7LB 3IAM9 2FHKA 2YWGA 4DV3F 1AA1B 1TR0A 3BGLA 1U09A 1KQSR 2HZAA 2Z4PA 2MHNA 1M5OC 4CO4A 3SZ2A 3F0NA 5LL6d 5L1LA 4RW6B 5DETA 2HMIB 4A8SA 1U1KA 3NMRA 1TU0B 4LFBJ 2COLA 2PFFB 1I94F 1YITS 1VQMS 3IN5A 4CT9A 4NI2B 2JVRA 1IBKJ 3IWXA 4RO0A 1RU2A 3VAKA 3OJSA 4USIA 1RWNB 4FN5A 2N3LA 1LK5A 2XMTA 2FYXA 3RBDA 5GAGI 2UUBJ 1M1KT 4N8NA 4DUZJ 3R1HA 3UR3C 2EC0A 3PW2A 1H2VZ 1U1MA 2BVZA 1N54B 3MURP 1QSLA 3T1AA 1D9DA 2EFVA 1RJJA 4LF8F 3OLAA 4ED4A 4R5PA 5D4OA 1YLXA 3ICLA 3OXFA 1RHRB 1ZYQA 4HH0A 3DRPA 1T05B 4WP9A 4ES2A 4B3MJ 1UZHA 2QA2A 2I38A 1X4BA 2CFXA 1HMVB 4EEYA 1RWMB 4PYAA 4XPEA 3IR6B 3MMCB 4K5SA 4O0IA 4DZ6A 2CQDA 3OUYA 3PRDA 1OIAA 3GCWP 2RAQA 1JLEB 3GZ7A 1VQOS 4ZDNA 3IBWA 2DGOA 3BO2A 3HLUA 4QPXA 5IQ6A 3CCQS 1H6KX 4RBVA 1W7WA 2ZH8A 5K9FA 5MLCV 3KHHA 1GX6A 4CLUA 2XNQA 3KLEA 1X5SA 1UJ6A 3WX4A 4C11A 2WVEA 2W9AA 1T02A 2DHXA 3CTRA 2DNMA 1BQMB 4FYVB 2LECA 4YQWA 3GPAA 3UVJB 1M5HA 4OI0A 2ZKTA 4DFPA 3QWPA 2A10A 1FVSA 4NCGA 1WSVA 1SC1B 5KFIA 5KFXA 1IKWA 4J37A 4OL8A 4WFBQ 2VJUA 2M3DA 1RACB 2DR8A 1UVJA 4IRDA 2IVFB 4Q44A 3QRPA 1NK6A 1TKZA 3SXLA 2HAIA 3E51A 2UVUA 3DLHA 7AT1B 3B4DA 2HSEB 4CLYA 4OIXA 4OZ0A 2A2CA 5AE2A 2ZEJA 2DITA 1U26A 2LA6A 2J8AA 4I2PA 2XZTB 2BBEA 1IVZA 3S7RA 1WG1A 1QM9A 3QPIA 3RW7A 2HWIA 1S1WB 5C25A 5HBMB 4GKJJ 2L9WA 3CPWR 2EG1A 2IAJB 5F3TA 1T9XA 3NLCA 4OYAA 1R0AA 2DR7A 3MD3A 3CJ5A 5J2NA 4YR0A 4AQYJ 4C8KA 3LGHA 5T7LA 2V4QA 4Q43A 3TI0A 2DNZA 2HG4A 1PILA 3H0PA 5EWEA 3PEHA 2W4CA 2W7AA 1Z1ZA 1R8HA 4IH6A 2V6AA 4WP8A 2BJ1A 4EFAC 2CZVC 4L76A 5HMZA 1NU4A 1PJ7A 5IWAJ 1S9EB 2E7XA 4DUYJ 1RWPB 1U2FA 3MD1A 1CEZA 2AZ3A 2PMWA 2AW0A 3NGSA 4TLQA 1GMWA 2DNOA 2KXNB 3OTCA 4CO0A 3DLKA 4XIUA 2ZJPQ 4A47A 3CDUA 2J6SA 9ATCB 3FCHA 4EWTA 1B3TA 4RL1A 3AB4B 3DNCA 3JXOA 4OJHA 1ZZFA 4NLWA 3A1YG 2KT2A 1NJYA 4UW2A 5B0GA 3R5GA 3MM7A 2G13A 1XWLA 4EGLA 4PKDB 3HSJA 4ED2A 5J1EB 2KXFA 4X4UA 1C4CA 1WC0A 2D3ZA 1NK7A 3MR2A 1URRA 4YP3A 1NUEA 2DHSA 2YQ1A 3Q0AA 1S9GB 2ZOMA 2BKNA 4UTGA 2AU0A 2D1CA 2RDDA 3QJJA 3U27A 1HMVA 3QNWB 2RKIB 3ILJA 3A3NB 2MEWA 6FDRA 1RTJB 1X0FA 3NG8A 2ASDA 4HHUA 4F8RA 4DV4F 1U8SA 4TU8A 2V0NA 3C2PA 2CIMA 1QE1B 5I3PA 4B9SA 3ONQA 3D6FB 4A8OA 1GXTA 1JXEA 5GAEU 3D6HB 4ZCMA 2I0XA 4DSKA 2I5JA 1X4HA 3IFEA 1DLOB 2VBYA 3HKZD 4KGXB 3KLFB 2RD5C 1JX4A 1AROP 1BQMA 1N5TA 2M4MA 3R1LA 3PW4A 2KU7A 2KRRA 2BUNA 1KONA 1V3RA 5F8MA 1WNEA 2PI4A 2V8PA 3R5DA 1NH8A 3D5MA 3C6UA 1TUGB 3I4HX 4QZVB 1I6JA 1S7HA 1RCXB 2ZH9A 1DARA 2RUSA 2XEXA 1LWCB 2UXCJ 4ED0A 4F36A 1D09B 3GIRA 4MMOA 5A76A 2ADCA 1RKJA 2DNHA 1RTIA 1GMWD 3NEKA 3EX7B 4ZP7A 1N32F 4EBEA 5GADI 2NCKL 1NHKL 1NB2A 2GHPA 4JV0A 4JYAF 4FVMA 2DGWA 2K8GA 2L9DA 1SKUB 1RSCA 4P75A 1S1WA 2IHR1 4I67A 1Q16B 2ZDOA 3VQSA 2OPSB 2ABYA 1VQ4S 1N88A 3JSMA 5CABA 1CJUA 4W98A 4DL3A 3L7UA 3K57A 4QU7A 1UPPA 3CDWA 4LF9J 3MMAB 2M8DB 2HNYB 2YKMA 1SJRA 3DRXA 1MMLA 2NSBA 3DCAA 3M6WA 4NA2A 4KBIA 1JJCB 2C2KB 1JKHB 3MI7X 1SXLA 1WWHA 4LF1A 1YX2A 2HQ3A 3PW0A 2IFXA 4NCBA 4DR5F 4DR7F 1NJWA 2RILA 3ET6A 1M5PC 2G0JA 3R2DJ 2F8HA 3T1HF 2B9WA 1VFJA 1U25A 2DNYA 3CF5Q 3K58A 2FJWA 1VBXA 1RDRA 4ENOA 1CJVB 1I51B 4JI1F 1EHWA 1ZETA 2BEFA 1KR4A 2WK4A 3DM2B 4Z2XA 1DRZA 4FPRA 4MJKA 5J1EA 4UQTA 2BW7A 2OH2A 3BM7A 4EUVA 4MYUA 4L72B 1XR6A 3W60A 3GWCA 3PW7A 1S9GA 4P2FA 2GQ2A 2F8EX 4LT6A 3VWSA 2XI2A 3NGUA 1FDAA 3F56A 3L09A 2LEPA 2GJIA 5EUHA 1X5TA 2W01A 5CZXA 4YB6A 3VCDA 1S6QA 4KGVB 4DQRA 1H74A 4X64J 2KT5A 5C2CA 4HT7A 2G1DA 4C8MA 4HR2A 4KIAA 4JI3F 3LO3A 1LKZA 4B3SF 2DIUA 2EFOA 3O6QA 3EGWB 3TO8A 2HFUA 4RUBA 2XM3A 4EBDA 1DLOA 3KLFA 4U7UD 4NA3A 3LALA 2ZDPA 2EFGA 2YH0A 3EVOA 3FEXB 4KPCA 3J81Y 3OTOF 4YR3A 5B08A 2U1AA 2F9JA 4J9PA 4PRFA 1RT2B 4FDFA 4ED5A 5HL7Q 5EN1A 2KVQE 4WXWA 4ALZA 1LOUA 1WOSA 1NNDA 4J9MA 2FVQA 2WONB 3OL6A 2NS1B 1JMTA 3QIDA 1FKAF 2K2PA 5EWGA 4X65F 2X3GA 4OJ3A 4RPFA 3OL9A 1FRKA 3BGUA 1S0MA 1KKHA 3CJKB 2C2RA 3MOJB 4PQUB 2QE5A 2CNOB 5ETLA 3MM5A 2AYGA 4EZ9A 1BHNA 4LIWA 5LSOA 1NPPA 1XNQJ 2HRTA 4ZVSB 2OPSA 2RIJA 3ISND 1NAQA 3M2UB 3PZPA 4J9VA 3THPA 3FRYA 3FK4A 2NYIA 1WOOA 2JX2A 2OLWA 3ZZOA 2F4FA 1RADB 2UXDF 4K0KF 1TL3B 4FS1A 4UQGA 1AXQA 1FXRA 2FVRA 4KHPF 2XS2A 4GVBB 1F3FA 5KFSA 5CXTA 4DLGA 4M5JA 3AA9A 1JKHA 5IZHA 3M8YA 4J9UE 3VZIA 1SL2A 5CH7B 4ZJOA 4N56A 3KUEA 4P10A 1FKPA 1MWQA 2Z58B 3R9LA 2K7JA 1JLCB 1D8ZA 1RA6A 3DC2A 4Z7YA 2R8KA 4DR6F 4R8UB 4ECWA 2EC2A 4GMKA 4ATNA 1LXJA 1QVGR 4IH5A 4FYWB 1VGYA 1TKTB 2WBMA 2XZWA 3FSYA 3SYZA 4X4TA 4UT4A 3DM2A 3C15B 1NSPA 2CWKA 4WE1A 1ZPWX 4B02A 2OSRA 1K1SA 2GIQA 2M0GB 3POTB 3O3LA 2V68A 1VQPS 4ID8A 3MCMA 1RP5A 1FERA 4M63A 2EKYA 2VASA 3CC4S 5FDLB 3PR4A 2OUGA 5KFPA 2PIIA 2QYGA 4NLSA 1NK0A 4IFYB 1GTEA 2ALZA 5JUMA 4ID5B 4JV5F 4DFKA 2UV8A 3BYPA 4DZDA 4Q8FA 4YOEA 5HATA 1A7GE 5F0UA 4QR2A 2VQFJ 4DSLA 2MLYA 4K7QA 5A8WA 2YNHA 2YKOA 2DNKA 1U1LA 5A8KA 2J6TA 2AT1B 3QZ7A 1IBCB 4ED8A 2IIHA 4RW9A 5F8HA 5CAAA 2WSEC 3CIMA 1U49A 1RT1B 5E5NA 3LH2S 4LSNA 1D9AA 1YBUA 3H90A 2FGOA 5AE1A 2DEJA 1RT2A 4OI4A 3BPDA 2BE2B 4WFAQ 3D4JA 2VPYB 2CJQA 2DY1A 1JQGA 2GVZB 2DK2A 4MIWA 1RE1B 1QLNA 4EMDA 3ELHA 3V6HA 2WONA 2RDJA 3HZGA 2RQCA 2RQKA 1WTBA 4MIBA 2OJ3A 4BS2A 4KT0C 3ZFVA 4LF5F 3C16B 3GV7B 2NSCA 3TZWA 5E2QA 1RWVB 1T95A 4C8NA 3GYGA 3CJKA 1HW8A 2QIFA 3EVWA 1MROB 4DR1J 4HI2A 3KG1A 3WX8A 3K5MA 2DH9A 3GIJA 1SUQB 4QIVA 5DO2A 3R7BB 1JNZB 1RTDB 2QRRA 4DHVA 3NGRA 5KFBA 1CS4B 5IS2A 4E8UA 5KFUA 3VAGA 2ZOFA 4ZPCA 3M2UA 3I82A 4AD6A 2ZWOA 2KJVA 3TJAA 1VJWA 1NRKA 5HVGA 4WKRA 5E0OA 3PACA 1BUXA 4CLFA 1VI7A 2NZ4A 1HNIB 1HBOB 3M2VA 3DXBA 2H4YB 4ZVFA 3M1VB 1TL3A 3SQGB 2UU9F 3OTDA 1MU2B 4DV7F 4NOHA 2J0XA 3D6TB 2W2MP 3FDSA 2ASLA 3A3PB 3L7PA 1HARA 3EGNA 2QSFA 3CEDA 3R3TA 3DU6A 4X66F 4NLPA 2JH3A 3QSIA 4KGKA 3FJ2A 3KHLA 2CPIA 2JHEA 2HW3A 3UFCX 3RB4A 3HVTA 2C2OB 3DLLQ 4ANDA 4DX5A 4ANCA 3GYXB 4WFXA 1ZM4A 3NY0A 1WHWA 3SV3A 1VRUB 2OSQA 3NWRA 2RRBA 3NXZA 4JI6J 3UDCA 2L41A 4C0HA 4Z7CA 1HQ2A 1TKTA 1U2RA 1H7XA 1TL4A 1S0VA 2HHPA 3R2CJ 1FK9B 3NGKA 3CW2C 2JRSA 5CD4H 4FS2A 2RRAA 3I31A 3OFHA 4XAKA 5F8GA 2HQIA 4TY8B 3KJVA 3POTA 2R8HA 3LAKA 1X7VA 2ZH5A 1TV6B 4CLWA 1PAEX 3HSGA 4GC7A 3G86A 4NEZA 3NRBA 2YQ0A 2F5GA 4O3PA 1KFDA 4DJBA 4M5NA 4IFYA 3ILLA 1YBTA 4QWAA 4ID5A 2GIFA 1MG7A 3W1YC 5RUBA 5HI7A 2H5JB 3OJUA 5DG7A 3M05A 5D3GA 3DMJA 1V9OA 4N76A 2BXJA 1HNWJ 1JJ2R 2CADA 2KL8A 3IWNC 1RB0A 4RNOA 4X62F 2VD3A 2E5IA 2OPRB 1OWXA 4DR2F 1RT1A 4LUBA 4F4WA 1R31A 4EBCA 1JLQB 2X3DA 4AUKA 2VFRA 1NSQA 3TUPA 1QUVA 1YGYA 1YK9A 4DR3J 1OSCA 3ZTOA 2BE2A 3H2UB 3HHLC 4C8YA 2CDRB 4NXNJ 5H9FJ 4JV2A 3U1MA 1EQ0A 1YJNS 1RAIB 2I8EA 4DCPB 2J0WA 3D1OA 1U0HA 4S0MA 5I3UB 5KFKA 4QYRA 3CE8A 1KVKA 2A1BA 4PWDA 1IM6A 1BQNB 3JAMU 4W4MA 3NAIA 1H2TZ 4LR9A 1EX8A 4DX8H 3DOLA 1APSA 1RWWB 4DX7A 2K3KA 1MROA 2Z57B 1VQYA 2I2YA 2J7WA 4OMFG 1SUQA 4K4SA 4OLOA 1RTDA 1JLAB 3ENQA 1RZMA 3IXQA 4ZVOB 3QO9A 1CS4A 2KG0A 3GFXA 5DLFA 2E5HA 4CO5A 4QQBA 2EG2A 2UUBF 2F4VF 3UWTA 2LQ9A 4WPAA 4DUZF 1Y11A 4WP3A 5KT6A 1N6QB 2N82B 4LF4F 4L3NA 2L08A 3P8BB 4YY3J 4DXLA 2ZBRA 3HD2A 3M1VA 4DV1F 3PRVA 5KG0A 4RNFA 2OEKA 4OHXA 1UAWA 2VONA 4ETXA 3CXCR 2UP1A 2H3EB 4TYBA 1VLYA 2QN6B 3GJRB 2DB1A 1F2GA 2Y8YA 3MAHA 4B17A 1OPZA 3P49B 1UMJA 2AWZA 3TARA 2D41A 2KN4A 1UA1A 2VPXB 4IDKB 4ZJLA 2BDPA 2C22A 3MFIA 5C7PA 3EJMA 2UVVA 1ZTWA 3AOCA 3QT7A 1FX2A 2YNIA 1HQEB 4KSEB 1K8AT 3MM6B 2P2CB 1WJ9A 1UFWA 3HHNB 1ZH5A 2JLEA 1VRUA 4ZVRB 1RA7A 3MCNA 4J9QA 2AGQA 3W8GA 3PX6A 4KTQA 1NPRA 3PKMA 4YB7A 3Q8PB 1JK9B 4C8OA 4LRAA 2JC0A 4Q7AA 4HKQA 1Y5NB 2R2TA 2QZ8A 2NXEA 5D0EA 5T14A 1KLNA 5LXRA 1CPZA 1TV6A 4X84A 2GMLA 5JVGQ 1IJEB 2NPIA 2R7QA 2IM2A 2W9BA 2HHQA 3BQ2A 3IS9B 2QV6A 4YHHJ 2AYBA 2CA9A 4B3OA 3I9ZA 4IH7A 2QO3A 5G0RB 5KFCA 3BZQA 3ILIA 4K5RA 2ZBPA 1KNZA 3FKBA 2BX6A 3BO3A 3HF5A 4MT1A 3G8QA 1G4CA 1FWLA 3KXDA 4FZVA 4OX7A 2B8PA 1HBNA 2Z2ZA 2YWWA 3T19A 2QMXA 1XERA 3GILA 1J2VA 4IQXA 2OPRA 3Q8SB 1SL1A 4DFMA 3HKWA 4TKTA 1ZM3A 2BOPA 1RT5B 4K2XA 5IT9U 1RABB 1N5YB 4AQYF 2HBYB 2I1RA 3OVAA 1G1XA 2W25A 4U8YA 2YY3A 4F0KA 5KG4A 4C97A 2JLGA 4P2SA 4FYYB 4ANEA 2EKNA 5J2QA 3PG9A 4CIOA 3KTQA 1BQNA 3D2WA 4QYZJ 2MQMA 3VGVA 4NXMJ 5DDQC 2FJEB 3H20A 4DX6A 1ZOTA 4U96A 5IWAF 3CCLS 3AJ2A 4TU9A 3I4PA 2XI3A 2ZNZA 2HKEA 4ZS6A 4J9LA 5HSPA 2Y3YA 2E1PA 5IXUA 1N5VA 2MY8A 3PEJA 1JLAA 4WFZA 3UCGA 2BW2A 5DM6Q 2CNKB 3AAWB 4O23A 3MMBA 3CWJA 2ROEA 5F8LA 3IRXB 1SVDA 3D7SB 1N6QA 3BDEA 2BM0A 4CLZA 1NCLA 1U1QA 2BE9B 4PXDA 4DN0A 5KFEA 3N0VA 1UVKA 3HFZB 4HT5A 1UKUA 5E33A 1V6HA 4GRSA 2PMZD 2HHSA 3DYAB 2OGUA 2C2ZB 1Q82T 1TKXA 2G2ZA 1LWEB 5LMUF 1HR0J 2R9LA 3R5JB 3DU5A 3QBCA 4LF7F 5D8HB 4K2JA 1RWUA 1VRTB 2A2DA 1R0BG 5CCLA 3OQ2A 1MN9A 1Q0NA 3NL0A 4F3OA 5ETVA 3LP2B 3FBFA 4OX6A 5A6PA 5AE3A 3HM9A 2IM1A 4FF1A 2QL5B 2Q6BA 2YPZA 5BR8F 2R7OA 5CCMA 1T9TA 1TL1B 4HTJA 4KH0B 3CVKA 1C4AA 1BWVA 3JS9A 5B0CA 1IKXB 1YZ6A 2NUUG 3CGIA 1UEUA 2ZC4A 2OP5A 3N5BA 4L75A 3H25A 3MFHA 4IO9Q 1UWAA 3FUYA 2EXUA 5GAGU 5A6WA 1QDUB 2QYCA 3KG4A 4RNMA 5DGBA 3NCRA 3MECA 1DY3A 3TJ8A 4XPCA 3W9IA 5H9EJ 3SDEB 2XB2D 4I56A 2XYHB 3O8WA 1QSSA 2UXCF 2JLFA 3AODA 1HQUB 3HFVA 3ITHA 3VAJA 3RG6A 1Y9OA 5G0RA 2O67A 3MAAB 1S1XA 1NDPA 4ZN3A 4ICLA 5KFHA 3N01A 2Y1LB 2MY7A 2V69A 3QRRA 2GW8A 3RB0A 8AT1B 4JI7F 2FVSA 1SB6A 2E1MC 5J2PB 2LXFA 4WFNQ 2CAJA 2IRYA 3EDQB 2WVDA 4G1QA 3OXGA 2DEIA 2DD8S 4NLGA 1SBRA 3H7HB 1QVFR 4TU7A 2BQUA 3GJQB 1WC4A 1P27B 3LANA 2V2ZA 2D3OR 2CJBA 3A8JA 3I0SB 3GIMA 4ZVGA 4CCHA 4WK1A 1HLWA 3JTNA 2GAHC 1RT5A 5F8IA 1ZPVA 1XMQF 1WKKA 4DEZA 2XQCA 1R0CB 3KYLA 3J7ZT 4DCJB 4F2RA 1UCNA 2E66A 3JQMA 1KQFB 1N5SA 2ZWPA 4KKOA 2YX1A 3GG1A 1IXKA 1LW0A 1WHYA 2XHCA 1X4DA 3V6KA 2FB0A 1OY9A 2FHMA 3TEGA 2HHHF 2J0QD 3D67A 4ZP9A 2OELA 1TKDA 5L1JA 2Z56B 3QT8A 3E8OA 2J7UA 1RT6B 3QQCD 2MQ8A 3UNYA 3OT9A 1JLGA 4CYUA 4DL4A 3AJDA 4LF6J 1MW7A 1D9FA 5KG7A 3DGVA 3CD6S 2F8MA 3EXCX 3H4DA 3O2IA 3EXYA 2DJWA 4OX8A 4DPOA 3SIPB 5C5JA 2CG8A 4ECZA 3G8TA 2IJRA 2RS2A 2IJFA 2ZJRQ 4CLTA 5HQLA 4C8ZA 1HNXF 3HK2A 2YNGB 2MKIA 5IV3A 1RAEB 2L9NA 2PA3A 1WDTA 3OVSA 2QTWA 5BJRA 2KG1A 1VC5A 1FTRA 4XTTA 1WC5A 2MSSA 4QIWD 1VRTA 4URQU 1REGX 4FKXA 1WG5A 4I2QB 3B78A 2ZFHA 4ES1A 2YNFA 5M2UA 2PSZA 4DF8A 1U02A 1FXDA 4TLRA 1VIXA 4CQ1A 2JDJA 2Y1JA 1C0UB 3V5RA 1TL1A 2HRYA 4OYWA 4A8KA 3G82B 5IV4A 3AOBA 3UCUP 1T9YA 1FD8A 2CPEA 2VKZG 5DQIA 2ZITA 1RCOB 2MZSA 2XWYA 5FD1A 3OSPA 1FA0A 2LEAA 3KJNB 2CQ0A 4J9RA 2LDIA 2OPQB 3C8YA 3V4IA 2YTCA 5KOXA 4OI1A 3VAHA 1CQNA 3OW2R 3CC7S 2JC1A 2O66A 1FJGF 3GMGA 3G4SS 3FCVA 3L4BC 4KV8A 3SDEA 3M30A 2QEXS 3CCUS 2DRAA 2GHWA 4J90A 2C1EB 3SQOP 2O3DA 4OYXA 4ZA1A 3HULA 3TAQA 1QJHA 5D4PA 2MSTA 2BJ3A 3CULA 2IRUA 1J5OB 2D7SA 1YI2S 4O3QA 3W2VA 2HYIB 2HLUA 5CZVA 1FF2A 4N47A 1K0TA 1R8CA 4E2FB 4Y2CA 4QW8A 4FXVA 1O5JA 3RYLA 4OJ1A 3H8YA 3GV8B 2DPIA 2ZOGA 1SH3A 4CNYA 2AX0A 2Q6CA 5A8RA 2ZZNA 4F4YA 4TXSA 1S1TB 5HP1B 1TL7A 5BYQA 4ZCLA 1YBAA 3P96A 4MYTA 5GAHU 1HFEL 4JB8B 3T1YJ 3C6TB 1NKCA 1X9WA 5H1SV 2V2KA 5KG3A 3EZUA 1S1UB 2CJ9A 2VICA 3TX8A 3QGHA 2V67A 2CQBA 3A8IA 3UPFA 1SJ3P 3TAMB 1WD6A 1RT6A 1N33J 4Q45A 1VBKA 4O3OA 3QIPA 4M5GA 4USMA 1KOOA 3W5YA 4B3RJ 5GADU 2FPHX 3P3DA 1CJTB 4RNNA 4LFCJ 1BQXA 3M9NB 3L9ZA 3KK2B 4XO0A 3HHLA 2GV1A 3EUNA 3N6MA 3MR3A 3MDFA 4USKA 4ECRA 2HQGA 4RU9A 5K8OA 4X4RA 4OI6A 2J5AA 4C9DA 3L7OA 1KQGB 4XK8C 3SMZA 2GVDB 3MM9B 2VBWA 2J9EA 2VB6A 1LW2B 1ZA2B 3DDNA 2ZVSA 3IM9A 2B9EA 3THVA 1U1NA 4MIAA 1NBEB 2RHSB 1C0TB 1Q79A 3EICA 2AKWB 4K59A 1S6UA 2R7RA 2GX8A 1FVQA 2HFSA 1ITPA 2YPYA 3PFOA 4LVOP 1CSJA 1M5VC 1KRPA 3K2YA 2Y8WA 2DGUA 5KG1A 3DRRB 4L73A 3FEZA 4TQRA 2JZ5A 3TAPA 4F3QA 2GA7A 4URGA 1NLKL 5F3ZA 1YJWS 3KOAA 3D54A 4RLEA 1FKOB 3TUJC 1PSDA 3CCRS 1FJ7A 3H42A 1IWGA 2ZM6F 2XMKA 3VALA 4CI0B 3QYYA 3DGPB 5K14B 2DRBA 3JSRA 2C2NA 4OX9J 1K1QA 2V8GA 4PXCA 3I0RA 1NPKA 3NAHA 1NJZA 1LV5A 3MCSA 4B08A 1DTTB 1LFWA 4JI2F 1H7WA 1RLDA 4HDGA 1JLBB 3M2RA 3ZNUA 4WIIA 3MZIA 4LR8A 1BLUA 1WELA 3I96A 4X4SA 2NXCA 4D3HA 2HK2A 4H4MB 4B3TF 4M5DB 3GB0A 4KR0B 1NDLA 4MK9A 3HCXA 5THWA 1KEKA 2B4VA 1J5OA 4A8YA 4DV3J 2FJDB 5A0YB 3HHLD 4DR1F 4F4ZA 3KMSA 3S01A 4IR9A 1Z2ZA 3MR7A 1X5OA 3BSAA 3R7SB 4NEYA 2KM8C 4MFBB 2DNGA 1G3OA 2HGNA 3DOKA 5E3QA 4V19J 5I42A 5GAEI 2E5LJ 3J7AN 2M9KA 4ZPWR 2QJ3A 3CCVS 3C6TA 1KTVA 3G96A 2PI5A 3H40A 4OZ3A 4QBUA 4PG8A 3GG0A 4M95A 1TL5A 2J8SA 4P73A 3IG1A 2L48A 1X4AA 4FKYA 4YR2A 3M8ZA 1V5IB 1WHXA 4CP5A 1VBYA 1IN0A 2IMOA 2MDAA 2P9GA 4K4YA 1VC6A 4M8LA 3SCJE 4LF8J 2IY5B 2BKOA 1VISA 8RUCA 2OMOA 3M32A 3DRPB 3MEGA 1AZSB 1Q1KA 3PJ9A 1HW9A 3GLJA 1HI0P 4OI2A 4K4UA 2QFIA 3DDIA 4U7UK 4UUWA 4Z37A 2W8LA 1RGVA 4BDPA 2E9RX 3OFGA 2ZBIA 3EGZA 3ZO7A 4JI6F 2CQ3A 3OUYB 1X9SA 3WQPA 5L46A 1X4FA 2DXEA 3P45B 4KGMA 2J9CA 1NZAA 2GVDA 2V63A 3MM9A 1U24A 4RBUA 4I4BA 4NLTA 1YJVA 2R7WA 4LRDA 1SQEA 3RJMB 3GONA 1R8BA 5AT1B 4KFBB 3QT6A 3NOCA 4FPIA 1KS2A 2N3OA 2CYYA 1SKWA 2WAQD 4NCGB 3BEGB 4YMEA 1VQ5S 3F73A 3GFHA 4RUHA 1IKWB 4UF4A 3CUNA 4FF4A 4PEOA 1TUWA 3PX4A 1FFGB 3GFYA 1Q86T 1EETA 3EPGA 4WWSA 3UI3A 2FY1A 2WB1D 3NNAA 1C1CA 4B9UA 1HNZF 1Y5LB 4OJGA 1TKZB 1DURA 3BDPA 3IWLA 5KT7A 1RYSA 4N77A 2XLIA 4HACB 2UUWA 2NR0A 2SXLA 2B4PA 1UL3A 2VG5A 2IC3B 2CQIA 2BR0A 1OO0B 2BOAA 2R8JA 2HBZB 3IGNA 4DPUA 5D4LA 3ZZ0A 2H65B 2CUYA 5C25B 2M5YA 1DTTA 4DR3F 2VQEJ 2RE1A 1DJ0A 3CJ8A 3T5LA 1RTZA 4NYOA 1JLBA 1YRTA 2VH7A 3CJ3A 4UY85 1GQEA 1R0AB 5F0WA 2XG8A 3BB5A 4H4MA 1WORA 4M5DA 2BRKA 1W25A 5B0BA 1VQSA 4IG0A 1T03A 1WKLA 3JTOA 2H1YA 5EDWA 3LGNA 1AUSL 2MZRA 4DV2F 2LP4A 5A0YA 3EDRB 4PZVA 4GO5X 3AXMA 3GU0A 2D3O1 2YKQA 2HGLA 3KNAA 3VR1A 5CYQB 3PRBA 4Q0BA 3MM8A 2W7PA 1KQKA 3D0GE 2MB0B 4MFBA 1L3KA 4BWJA 2KKHA 1Q81T 5DDPC 5KFQA 4CM2A 2VZ9A 1WI8A 3DLKB 3UN5A 4ZIVA 1VQ9S 2A6OA 1ZTTA 4K4XA 3WZ0A 2QLFB 2MXYA 2ZHOA 3JYTA 4G1PA 5KFWA 1SPBP 3FMWA 3TA0A 3W9JA 2B8QA 1UWBA 2CQPA 4Y2AA 3MM7B 2OTJS 2C42A 3MWBA 4C8LA 3QLHB 3FGVA 3C46A 2DHHA 4WK3A 5MAOA 4EK2A 1IBMJ 1FJEB 1RT7A 3IRWP 4O4RA 3W9HA 1AZSA 1M1GA 1RKIA 2HVIA 3HDSA 4RW8A 3G6VA 5LMNF 4CLSA 5D78A 2DO4A 4OHVA 4OHYA 5ETPA 3TZXA 1UFLA 3J7YU 1ROFA 4ELVA 2G0CA 2BACA 2B6AA 2YWKA 1U7LA 2DISA 2NZCA 3OHAA 4DV4J 3HVRA 1U8WA 1IR2A 4CZCA 4Y65A 1M1HA 4Q2MA 3OR2B 2I5JB 4DCOB 5DQHA 2CQCA 1J5EJ 5L1KA 4USVA 1UVIA 2QC3A 4KFBA 3AD9C 1Q8IA 3KFWX 1PIEA 3LUYA 1EP4A 3IC1A 1T11A 3H5YA 3C6UB 1Y7PA 4YHHF 3KUHA 4ZPTR 3MUTP 3M9OB 3VAMA 2ALYB 5FIIA 4NZ7A 4CT8A 5KG6A 5SZTA 2UVWA 1IQTA 2BYCA 5KT2A 5DDRC 4X4NA 3Q8RB 1RHKB 2FZGB 3EM1A 3ENWA 3HP6A 3T9ZA 3AQOA 2EFNA 3C19A 1RTIB 5ETMA 1ZM9A 4RJVA 3U02A 4X4OA 3MOZA 4HACA 2FLOA 2IC3A 5U47A 3CIZA 4JYAJ 2MKSA 4CH0S 1FFSB 3BJYA 1Y10A 1UZDA 3RBZA 2A6MA 3CDAA 1FDNA 4KO0B 4QU6A 1SQGA 3CD5A 3LP0B 1YG0A 2AYEA 1I1GA 5B0EA 3JSMB 1CJUB 1ZS6A 2R7VA 2O5DA 5KFOA 3MAQA 2RMLA 4OV6A 2ZJQQ 3D9BA 9RUBA 4DS4A 2VA2A 2YKMB 3TZYA 1IBLJ 2OMLA 3W3SA 1P9YA 2GNKA 4RW4A 1EKRA 1IJFB 3K5NA 1EQMA 1NJIT 5CYQA 1HWUA 4FNHA 3PV8A 5K8NA 3ET6B 2UUAJ 1UTAA 5DG9A 4BCAA 4DR7J 1B99A 2DCLA 4KJIA 4DL7A 5GMDA 2DPJA 3T1HJ 2U2FA 2OHDA 2R7UA 4BLGA 2XHWA 3KUGA 2VA3A 1VQLS 2GQCA 2H54B 2QL7B 2MLZA 3AD7C 4LRBA 1YRUA 1WF0A 4CRJA 2MGZA 5KAKA 3VZHA 2BE7D 3I5CA 3B6BA 2CQ2A 2E1CA 1HR0F 3G6XA 3QLHA 3OFFA 1GT8A 1T9WA 3GJTB 2W2NP 3ENAA 3T3FA 3W5ZA 4GKKJ 1R3NA 4N41A 4IKAA 1S7IA 2LQBA 1PKUA 3Q83A 2KM8B 4C4WA 2EBEA 1UEKA 4IG3A 1UVLA 4PPZA 5HQ8A 2WSCC 1VK3A 1F5BA 1JJHA 1VHIA 2V8VA 4NZ0A 3M8RA 1YSJA 3F44A 4M5KA 2H5EA 2AV5A 2PDAA 3AY0A 3B8HA 1S6QB 4DQIA 1RT4A 4NL5A 1B7FA 4IOAQ 4QOTA 1UJ5A 1KDNA 2E5GA 2GO9A 2JSXA 2B3TB 2CPXA 1HBMA 3VQTA 5AXKA 4RWWA 4EI2A 3K7RA 2FZKB 3OR2A 2F65A 1WEYA 1Y3JA 3D68A 3I5BA 1U6FA 4MTPA 4XDDA 3TA2A 2KYZA 3GR1A 1AW0A 4DL0C 1KC8T 4QJVA 5JXSA 1PYOB 5KFVA 1QTMA 5HVFA 4U8VA 3W62A 4X4PA 5DS7A 3LP1B 2GGPA 2A18A 2PFDA 2Z30B 4M5HA 2AYMA 1Q7YT 2MMYA 1J27A 2BQ3A 3DLEA 2C3YA 5KFTA 1M90T 2YKNB 4DPWA 4WKYA 1Y00A 2QMWA 4I1TA 2DR9A 3NP5A 4P9SA 3A13A 2DNQA 3EVMA 3MM5B 5J2MA 3WC2A 1SC6A 1S4FA 2E1AA 2ZD1A 2ZUAA 1YHQS 3IO1A 4CNZA 2VDIA 2HVZA 1NEEA 4KO0A 1XNRF 5HJYA 5IM0A 3LP0A 1X9MA 2XGQA 1I3OB 3CC2S 3FBEA 2D74B 1SJQA 3TJ9A 2CQ4A 4DV6F 2V2VA 1KLMB 5KG5A 2FC9A 1D0EA 3KLHB 1OJ4A 2R2UA 2N7YA 2VUGA 1FRLA 4YFUA 2CXEA 2ZNYA 4F4KA 2QLWA 5GMKa 1EIYB 1O0PA 5B7WA 3W8PA 4K0KJ 5L39A 2HVHA 2XS7A 2B9YA 1ZAXA 3BQ0A 3VAFA 1O8BA 1VJQA 4B9MA 4ZKAA 3FFIA 2EW9A 1FKPB 2RT3A 5HK4A 3D0HE 1CQMA 2CPYA 2VU5A 7FDRA 3QJLA 3HMJG 4KE5A 2C3PA 2OFGX 2J9DE 4ED7A 2M7SA 3CMQA 3MF5A 2BJEA 1A9NB 4I7FB 4C0OC 1FRMA 1JWWA 2LCWA 3CMES 2R2RA 3UDEA 1FNMA 2RF2A 5EHHA 2RS8A 3JB9k 2B4OA 3NNHA 4F04B 4ZVTB 4WU2A 2YH1A 2ACYA 1WF1A 4NCAA 4OYMA 1JXLA 4ZPVR 3K5PA 3EWGA 4YB1P 2DGSA 4EU0A 4P72A 4GVLA 1IKVA 4WE1B 1U4BA 1CBKA 5DDOC 3TUZC 4W90B 3HFKA 2XO7A 3CCJS 1PG5B 2HAFA 2HPUA 5AXMA 2K1RB 2KDOA 1XK8A 4ZP8A 1N48A 1D1UA 4IR1A 3B82A 3WHIA 1NK9A 3KJFB 2ASJA 3CB4A 5KT4A 2R4FA 1WG4A 2LQ8A 5A8WB 2YNHB 4WYLA 2HNZB 1M0SA 4AT1B 1GNKA 3BBCA 4QIEA 1XEZA 1S76D 5A8KB 5KT3A 1NK4A 3QMQA 1T8EA 3NS6A 3G6ES 5FLXU 4RW9B 1F0XA 3DRSA 4C6AA 4DR4F 4DQSA 3NS7B 4LSNB 4CO2A 2BJ8A 3H2VE 3QGIA 1NK8A 4N5SA 1WEXA 3N79A 1PO6A 1DQ8A 2FQQB 1GMVA 3LP1A 1JLFA 4HL9A 3IM8A 2GCFA 2KH9A 4HYKA 4ZLNA 3M8SA 2VL1A 4PCQA 4I0WA 4OLPA 2LXUA 2AEFA 4DQQA 3T5HA 2ZE2B 5HLFA 2BANB 2YKNA 4FBTA 4JI0F 1NO8A 1H0HB 3ILOA 3KLIA 1U48A 3PYFA 1DTQB 1VBZA 2FLNA 3V81A 2CJYB 1YZ7A 2XLJA 3H5UA 2DT9A 3RR8A 4ZLPA 1VQ8S 1FESA 4ECYA 4Y2IA 2W9CB 1YTYA 3K8VA 1S97A 4N7TA 3UCZP 3FCWA 2H51B 1G2EA 2C2EA 2HS0A 3HT3A 3A8EA 4AYBD 1FE0A 2YKPA 3L95X 3S6EA 1KLMA 4A8XA 2E9TA 3N4WA 3KLHA 1VS3A 3CO9A 4OHWA 3OLBA 2FUG9 3LW5C 3M2VB 1E6YB 4MKVA 4LRFA 3HSDA 2XMMA 5CD4A 1UW9A 2HS3A 3IA0A 4EO8A 3LPEA 1KOHA 4MK8A 3MXHP 3TVKA 3LA0A 3KMQA 4B3RF 1VQKS 5LXYA 1S6PB 4XDCA 3TYTA 4DLEA 4OZ5A 4LFCF 4B9TA 3CSKA 4E0DA 1FNXH 4ECSA 1YQHA 5JVHQ 4DN9A 4F0MA 3V4MA 3HPOA 2IDEA 3VV2B 3RW6A 3HVTB 1QSYA 1TK5A 4QPTA 3LQVA 4FVCA 1HD0A 2P6TA 5J1NA 3MCOA 4I7FA 4LMZA 3DHXA 4B9NA 4U95A 4WXOA 5L1IA 3LOUA 1IR0A 5ETOA 2W2QP 1HL6A 3OVBA 1Z4UA 2XMWA 2HK3A 2F40A 1PBUA 2VFTA 3PJXA 1NMEB 3ZTPA 5M2RA 3BH6B 4TYAA 2K3IA 5EWFA 1G6BA 3KJVB 3W2WA 3DOMB 4NMLA 5AJ3J 2FZCB 3CJ4A 5KFRA 4G65A 2ZZMA 2FHOB 2BA9A 4P6QA 4ZLJA 1SL0A 2FHJA 2PT0A 2K1RA 3HVWA 3P6YC 5L9XA 4A4JA 4ECTA 2R8IA 3PVXA 5D77A 1F3VA 2KFYA 2G2OA 3NS5A 1FE4A 3ETOA 3Q24A 2HBQB 4OX9F 1L3SA 4RW7B 2C3MA 2HNZA 4TN2A 2JNJA 5D3GB 3DMJB 3BN4A 4OZLA 3AXKA 5KFAA 2QLXA 1BE4A 3BGFA 5F41A 1Q5VA 4X62J 4I68A 1N36J 2DNNA 1HNVB 2X1AA 2IRXA 1X8DA 3MR6A 2ZZTA 1GAOA 2E5JA 4ZIWA 2VIHA 2CZ9A 4DL6A 2AJQA 1WDDA 3OSNA 3D3CJ 1U0HB 1BXNA 4WZMA 3CDBA 3BSOA 1NM2A 2FLPA 1RT3A 4PWDB 3GFZA 2HHVA 3VAIA 4F2SA 4ZVQB 2ZE2A 1WC1A 2HVDA 3BKUA 1NH7A 2BANA 1WEZA 3DOLB 5JJBA 2DVIA 2HVEA 3G2XA 4J9SA 3MPVA 4QWDA 2IA6A 2QT7A 1DTQA 2YQ3A 4FBUA 3TNVA 1RWOB 4PR6A 3HJVA 2E5LF 4LBPA 2W9CA 3JQJA 5KOWA 1IWAA 1OS5A 3QO9B 3M8PB 1RYRA 5C42A 2CJAA 3SSQA 1MMNA 2XMAA 2D9PA 2F4VJ 1RI7A 4BC9A 3W7BA 4NA1A 3V6JA 1E6YA 1S77D 4NX9A 1X4CA 5JMNA 2XZDB 4LF4J 3CCMS 5KFLA 2CQHA 2FHJD 4DV1J 1XMOF 2JEIA 2ZBQA 2DYAA 2DNLA 1U0SA 4MKYA 4OV1A 3MTKA 3MPYA 1S6PA 2DXFA 4LREA 2Q66A 2IJNA 4A8QA 3OPKA 2KTQA 1U6BA 1LXNA 2Q79A 2LYVA 2YNIB 3Q8QB 2R3VA 4PUOA 4OZ1A 2LXIA 4RNHA 1KD1T 2HFNA 1AFIA 4HHJA 3ZZZA 3RB3A 2B9XA 4UZCA 1YKWA 4P52A 4A48A 3IP0A 1F5AA 2WCXA 2AMCB 3SSRA 2M70A 3IAS9 2JOQA 1HYSB 1UP1A 1U1RA 4RUCA 4RZRA 3OL7A 2HQDA 1NJXA 1L3VA 2A3JA 4ZVUB 3E01A 4H4KA 5L38A 2MHEA 1CJKA 2Z8QA 3Q8YA 4BBYA 4LFAF 3DOMA 4DU8A 4HLBA 2AF6A 3BGRB 4RR5A 2W9BB 3LAMA 3OXLA 4DV0F 5E41A 3MEEA 4O3NA 4B3OB 1VQ6S 3DLGB 2DGVA 1C1BA 1W2IA 5DZ7A 4J5OA 4CDIA 2YBVA 1PBAA 1WOPA 1Y5IB 4F4XA 1EAYC 4C3MA 1R89A 4QR0A 1R7IA 4RW7A 3BKFA 3MEDA 2LKZA 2UXBJ 3FC9A 1HBNB 5HROB 4C7QA 3HD1A 2RRNA 2XBPA 3TVZA 2ZH4A 5DLGA 1A6LA 5CYMA 2VQEF 4YS2A 3FEYB 3P5TL 4R25A 5LJ3Y 1HNVA 4M1KA 1Q4RA 5D0GA 4EO6A 3WC0A 2FIUA 2H5IB 1SV5A 2DIVA 4X2BA 3BBBA 4ZHRB 1SC3B 5HVHA 4WZQA 2DBBA 1KVJA 2IYIA 2CWXA 5F8JA 2KT3A 2CQGA 1Q95G 1WUUA 1D8YA 5J2QB 3NCQA 3CO0P 1AB8A 3TZZA 4ILRA 2R7TA 1L5UA 1FNOA 2MTLA 4LVNP 5A2QY 5D0HA 1U1OA 5IC6B 2G4BA 1SQFA 3VVTA 2KI2A 3CMAS 1FO1A 4DV5J 4LFBF 2J9DA 3VGSA 3IR5B 4RW6A 2HMIA 4WU3A 3N9UC 1TFYA 4NLQA 3ZZPA 1IBKF 3FNNA 5HN0A 3FBCA 2EFPA 3UR0A 4NI2A 2WRMA 1LFPA 3EYZA 2GC8A 3M8PA 3CT9A 4Q2LA 4ZPBA 1KWMA 3RAMA 3MMBB 3SV4A 2OD6A 4IQMA 2O01C 1RWXB 4DG1B 2XMVA 2DGTA 3Q2TC 3H98A 4KY3A 3DI6B 2ZH7A 1FCAA 1QAJA 3FBBA 1GXLA 2HEKA 2IDLA 3O1LA 2BKPA 4ZVPB 2DH8A 1X5PA 3H4BA 1CC7A 2MKJA 3ENVA 5EX3A 1IBMF 4KHRA 2L3MA 1VQNS 3GIKA 3CCZA 2Q43A 1TKXB 1BD6A 3D6MB 1R8PA 4F67A 4B3MF 2H9ZA 1S72S 1T05A 1SCJB 3IGVA 1B0PA 5LMUJ 4UOGA 3UN2A 4WJBA 1UFKA 4LF7J 1BC6A 3UDVA 3FZ2A 3BQ1A 3MMCA 3D3BJ 1FEHA 3JAMY 1JLEA 5BR8J 2W24A 2JFKA 2DGQA 1U45A 2FJBB 1GEHA 2M8HA 3RBXA 4Y00A 1F9EB 4WYWA 2AZ1A 3B4MA 1J5EF 1Y4ZB 1UPMB 1HYSA 1DBDA 2OO4A 1T3NA 5GAHI 1W26A 2NXUA 3UVJA 1OSDA 5KT5A 3CCES 3MECB 3BBFA 3CD7A 3DLJA 2E44A 2EWHA 2VG7B 3BGRA 2V8HA 2MJUA 4IFVB 3H2LA 1BWEA 4LSLB 2BRLA 3ITHB 3DLGA 3GCXP 4DBQA 2KHCA 1T7PA 4UUXA 1FDDA 1S1XB 4F0HA 3QSYB 4ICLB 1ULRA 1YJUA 1OYEA 1RAAB 4P71A 2MQLA 3PKYA 2AGOA 2HGMA 4OYBA 3RTVA 2YWFA 2BABA 5KFJA 4JI7J 4G1QB 5HROA 1Q5YA 4LBIA 3T5JA 2AHOB 2ZC3A 1SJ1A 4IO1A 4FP9A 5ETRA 4GKJF 1N34J 3HHEA 2E7VA 2OEMA 4ZPDA 3VVUA 5HBMA 3O44A 1U6ZA 2Z2YB 1TMJA 2IAJA 1JJ4A 1FRJA 4ZHRA 4F7VA 4PG6A 3UDLA 2P9EA 1XMQJ 3GTYX 4PWWA 1IBLF 1FWPA 4KKOB 5CHCB 4RWXA 1NSKL 2NXJA 1CG2A 1LW0B 1H38A 4WIQA 2IBOA 2RDIA 1K44A 3NGTA 1H2UX 5BXIA 1HA1A 4DUYF 2HHHJ 2UUCJ 2UUAF 2R7XA 4GO7X 1S9EA 4L74A 3I55S 1X4EA 3G71S 1JLGB 4CYUB 3Q8UA 2PEBA 3G9CA 4M5IA 2P5VA 3EZ5A 3J81U 2CKWA 4ER8A 2XY7A 3QATA 2XYPB 1XN9A 1KHVA 5E3PA 1YIJS 1NDCA 2FTRA 4DG1A 2IM3A 4LRCA 4I64A 3DI6A 4DS5A 5DRKA 1S49A 4DSFA 2VC0A 4GKKF 4J9KA 1HNXJ 1CVJA 2CDQA 5IT9Y 4CTAB 1S4EA 1RUSA 4AXIA 3E3XA 1Y3KA 5HQMA 2YNFB 2V4JB 4LF2A 4LBHA 1DFDA 2CRLA 3HXMA 2Z2MA 4Y28C 2RKIA 1RTJA 2BMBA 2CZ4A 3EGVA 3RRHA 2CG4A 4ZVHA 4MK7A 1QE1A 1SH2A 1B0VA 4ITSA 1F9HA 2KXHA 4K8RA 4I69A 2RSQA 3ADAC 4ZN1A 3PCOB 1NK5A 2FY8A 2ACMA 2PD1A 3VGUA 2HBRB 2W8KA 5L8RC 3V4IB 2WHOA 1EZZB 5E3CA 3U7JA 3R7NB 4DI6A 2AX1A 1ELOA 2VG7A 5E7OB 3MUMP 2QGFB 4IFVA 4KV8B 1PJ5A 2AEJA 1RHUB 1FJGJ 1W2BR 3M30B 4LQ9A 4LSLA 1P6TA 2HFZA 3N5FA 1LWCA 2MLXA 2NUHA 4DPXA 4LQ3A 4HI1A 2J7KA 3IMQJ 2N7CA 4ECVA 3HHDA 2Q3PA 4LR7A 2MPUA 1VRQC 3AFGA 4Y2KA 3MEKA 4FXDA 3R6GB 1WC6A 3W2VB 2F1FA 1O6XA 1Q8LA 2GHVC 5DGAA 2YX4A 1FHTA 3PO4A 3C14B 2CPFA 5I4MA 3G87A 3PR5B 3LGMA 4Q5VA 4NRUA 3RB6A 1DZ5A 2ADBA 1N4LA 5A8RB 3S1TA 2C28A 1TK8A 2MKCA 1T94A 2XWXA 2R2SA 3G6YA 4DWIA 4NLOA 3OTBA 1KP6A 1TL7B 2QMUB 2LVWA 2VF3A 1U1PA 5D15A 4K50A 2BZ2A 1ZM2A 4LF9F 4M5LA 3ZNJ1 4JP8A 4WBFA 3ZC4A 4JV1A 2V9WA 3MMAA 2HNYA 2KYXA 3NCPA 2WSFC 4JI4J 2CQ1A 2IBKA 4ZOSA 4JI5J 3DN9A 1LQ9A 5D0RA 4NLYA 2YWEA 2W4DA 1SIWB 1OYDA 5H9FK 2APOA 1NHVA 4PG4A 2W2PP 4GC6A 3QIPB 2GO8A 3KDNA 3M6UA 5F8NA 1BY9A 2B7CB 2KHDA 3CJTA 5M2PA 1MNEA 3R8YA 4AFFA 3CJQA 1H3DA 3FVYA 3HHLB 5HANA 2LFVA 2EK6A 2ZHBA 1HWKA 2BJDA 2ZH3A 1CJVA 3M8QB 2KZZA 4NYZA 3UD5A 5CA5A 1LWFB 2CPDA 4C98A 4ZCIA 2OAUA 3A4TA 4YUDA 3PTWA 1VC0A 2YVSA 4NE9C 2MZ1A 3KLVA 4CTAA 3LTOA 2OEJA 4C48A 4PABA 4QWEA 1EB0A 1KHWA 3GSDA 1HHQA 1FWKA 5F9LA 2ROGA 2PE8A 1YRXA 2ROPA 2V4JA 2E29A 4ECXA 3R27A 1PJ6A 1B7YB 1FT8A 2XC9A 4X64F 2RB7A 1S5ZA 2Y1IA 1OY8A 1R6VA 4RUAA 3GE9A 1K73T 4K4TA 3T9NA 3RUBL 4JI8J 3GIIA 4ERDA 2HQCA 5HJXA 1XTZA 4OYPA 1FRIA 4A8MP 2VFVA 1TK0A 2NLWA 2FJVA 2EK1A 2VOPA 5K5MA 2ZM6J 1S9FA 4ILMA 4KPYA 4CLKA 3I0RB 1OMSA 4ED3A 1KBRA 3D1HA 4QWBA 3KK1B 2ZH6A 1YJ7A 2MQQA 2DNPA 1X60A 4EZ6A 1NKEA 3WIVA 4U6PA 2VFUA 4ED1A 2EVZA 2CVIA 2GJ2A 1F2HA 4NPOA 3M2RB 3BN7A 1QD1A 4O44B 3BR9A 4JI2J 4USWA 1G7CB 3SSSA 3KHGA 2DY9A 4WTYA 1UVNA 1RAFB 1RU1A 2F63A 4LJMA 3UD3P 4CM0A 4LIRA 3FMBA 4B3TJ 3BO4A 1ZAVA 3QFHA 3MPWA 4NRTA 2MZQA 1S99A 2C3OA 1PC4A 1FFWB 1JNRB 3ZTSA 1DQAA 3C14A 4PQUA 2PN6A 1TP7A 1DAXA 3QAEA 5E3AA 3J7YI 1RTHB 4R0JA 2H4WB 1XNQF 2HZVA 5EGYA 4J9OA 4N8OA 3ZTRA 1LK7A 3P5BP 3PDNA 3AT1B 4AL7A 1KN6A 2AJ2A 2DRDA 3FZBA 3SBMA 2E9ZA 3DOKB 3CJ2A 3TOQA 5I42B 1GXUA 2AP6A 3BR8A 2WVCA 3HZEA 2VC1A 3KHRA 1D3WA 1H72C 2G0IA 2YXLA 3D1QA 5B09A 4OYZA 5HMWA 2WBRA 4F4AA 2RHQB 3ZTQA 3IG1B 3GQCA 2QX0A 2GAGC 3MGJA 5EX0A 4ES3A 4TY9A 4GVBA 3L3CA 1TAQA 3AA8A 1FJCA 4USHA 2O1PA 2RQMA 4QCLA 1WC3A 3RR7A 2ZUGA 1S57A 1S10A 3TANA 4UZBA 1YDLA 1N52B 4HEA9 3M6XA 4W92B 1R6YA 2JL9A 3M32B 2LEBA 1XC9A 3JQKA 3TA1A 3MEGB 5HAOA 1WF2A 2VPWB 2I6WA 4QYZK 5HMXA 4P7VA 2DNRA 1P8GA 3NWGA 2E7WA 3TWZA 1JLCA 1S0OA 1I5OB 3DHWC 2J76E 2CPJA 4C0BA 4L3KA 2EEYA 4DQPA 4MKAA 4R8UA 3A3OB 5B0DA 3DXSX 3NNCA 3M8QA 2G1HA 1LWFA 3LPYA 3D0IE 1WSRA 3CJRA 2BJ9A 4PAAA 1B0TA 3TP2A 1IR1A 2M2BA 2W4PA 5B0FA 2HHWA 5LSRA 2HRUA 3NKYA 2OKQA 2G9OA 3C15A 1XJWB 1F1BB 1N56A 1B64A 5AJ3F 5A2QU 2PC6A 4G3IA 1O51A 4G1IA 3OR1B 1JB0C 2W2OP 4V19X 3FQKA 1S79A 3MHYA 5AXLA 3ZZUA 1SJFA 2VV5A 5FDLA 1QAXA 1VIOA 3BH7B 1VQ7S 2EFQA 1TAUA 1EETB 2VQFF 3TW0A 3ZZRA 1M5KC 1C1CB 3M9MB 3QJPA 1H98A 3I87A 1R27B 2HZCA 1HNZJ 1ZA1B 4OZ2A 3HT0A 2UUTA 2ZVIA 2IVYA 1XR7A 1N36F 2VG5B 3QT5A 4DUTA 1R43A 1URNA 3IBCB 2RQ4A 3K17A 4CH1A 5DQGA 5AXNA 3K5OA 4NASA 1RAJA 3KK1A 3AHPA 4PXEA 2AD9A 3UNGC 2Z0GA 3W64A 5ETNA 1CLFA 1BGXT 4USJC 2LU2A 4WCEQ 4YDXA 4C2MA 4IOBA 2JWNA 4O44A 3BKTA 1SKRA 5LM7E 4QIFA 4QW9A 1YJRA 3CCTA 3NGDA 2GVZA 3CCWA 1HHTP 5BYRA 4IG0B 1T03B 3PYGA 2ZH1A 4DPYA 3TR5A 5H9EK 2AJ4A 1RXOB 5CYJA 1REVB 3ETMA 3C16A 4RU2A 1TQLA 2C2MB 2PO4A 2UVRA 3K5LA 2B51A 5IT4A 4DL5A 4DV2J 2MJNA 2FD2A 4BHQA 3ZZTA 3J80Y 1RHQB 4A46A 2GIRA 1RTHA 4Q0BB 3MM8B 2IMWP 2F3JA 2X51A 2WOMB 2F7VA 2MKKA 3D66A 3CNQP 3KKFA 5GMEA 3Q23A 1I94J 4IRKA 4YEAA 4EYHB
chains in the Genus database with same CATH topology
2DNOA 2J7UA 2XMMA 2RU3A 1RT6B 2KXNB 2CVEA 4ED6A 1GH8A 5KG2A 2HS3A 3IA0A 4EO8A 1HNIA 1JIHA 1HBOA 1KOHA 3OTCA 4CO0A 3DLKA 4MK8A 4XIUA 3MXHP 3JYTB 3TVKA 3GYNA 2ZJPQ 4A47A 1JLGA 3SQGA 4DL4A 3CDUA 3KMQA 1MU2A 2J6SA 1MSWD 4B3RF 1VQKS 1UWBB 3FCHA 4EWTA 5LXYA 1MW7A 1S6PB 3R5AA 4XDCA 1D9FA 5KG7A 3TYTA 2MZJA 3AB4B 3DNCA 4DLEA 4OZ5A 4LFCF 3CD6S 4B9TA 3CSKA 4E0DA 1FNXH 4OJHA 2F8MA 1ZZFA 4ECSA 1YQHA 3EXCX 5D6GA 4DN9A 5JVHQ 3H4DA 4NLWA 2JVOA 2KT2A 3A1YG 5K8MA 2IM0A 1NJYA 4WFYA 3O2IA 1SI9A 3EXYA 2DJWA 3V4MA 4OX8A 4DPOA 3HPOA 3VTIA 4UW2A 2NREA 5B0GA 5C5JA 3RW6A 2Z2LA 3HVTB 5C24B 3MM7A 1RT7B 4ECZA 1QSYA 3G8TA 2G13A 1XWLA 1TK5A 4FYDA 4QPTA 2RS2A 2IJFA 4EGLA 3LQVA 4PKDB 2ZJRQ 4ED2A 4FVCA 1HD0A 5J1EB 2KXFA 4X4UA 2P6TA 1C4CA 5J1NA 2D3ZA 4I7FA 1HHSA 1HNXF 4C8ZA 1OQ6A 1FDBA 3HK2A 2YNGB 2MKIA 1NK7A 4LMZA 4RW8B 3DHXA 2HIQA 3MR2A 4B9NA 2L9NA 2NPFA 1URRA 2PA3A 4WXOA 4YP3A 2DHSA 3OVSA 5L1IA 2CJKA 3LOUA 3Q0AA 5BJRA 1S9GB 1IUJA 2PA8D 1HD1A 2KG1A 1VC5A 1IR0A 2ZOMA 1FTRA 3BSCA 3QGGA 2AU0A 2XLKA 1HL6A 2D1CA 1FXLA 3OVBA 1Z4UA 2MSSA 2XMWA 4QIWD 3US5A 3QJJA 3U27A 2F40A 3PJXA 2VFTA 2B6AB 1HMVA 3M4XA 1VRTA 4URQU 5M2RA 2RKIB 1WG5A 4I2QB 3B78A 3O5TB 2ZFHA 6FDRA 1RTJB 1X0FA 2HS4A 4TYAA 2YNFA 4ES1A 3NG8A 3C66A 4I6YA 2ASDA 4ZMMA 5M2UA 2K3IA 2PSZA 4F8RA 4DV4F 4DF8A 5EWFA 2Q1LA 3K59A 1FXDA 1U8SA 1G6BA 1VIXA 4TLRA 2B5JB 2V0NA 4ZP6A 4BC7A 4CQ1A 4TU8A 1FK9A 3C2PA 2CIMA 2XNRA 3KJVB 3W2WA 2JDJA 2Y1JA 1QE1B 1NHUA 4NMLA 1C0UB 5I3PA 4B9SA 2YKAA 3V5RA 3ONQA 3CJ4A 5KFRA 1RQ0A 4F25A 4A8OA 1GXTA 1JXEA 5GAEU 1TL1A 2XGPA 3RBEA 2ZZMA 2FHOB 2I0XA 4ZCMA 2BA9A 2HRYA 4DSKA 4P6QA 3PXGa 1WHVA 2I5JA 1X4HA 3IFEA 1DLOB 2VBYA 3HKZD 3OR1A 4A8KA 1VOMA 4TY8A 1EP4B 1SL0A 3KLFB 2ERRA 2FHJA 2PT0A 2K1RA 2RD5C 3HVWA 3P6YC 3UCUP 1GX5A 5L9XA 1JX4A 4A4JA 1FD8A 4ECTA 5DG8A 2R8IA 2M52A 2LLZA 1AROP 1BQMA 1N5TA 4O3SA 2M4MA 3PV