2IBBA

Crystal structure of the first and second fniii domains of ihog
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
213
structure length
208
Chain Sequence
b'STYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLAHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CG9211-PA
publication title Structure of a heparin-dependent complex of Hedgehog and Ihog.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 42
structure length 208
sequence length 213
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ibbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ibbA02
3QRGL 3GKZA 5IW1B 5J06A 2QHRL 4JO4L 2XPGA 1ZLWK 1OL0A 4OFYA 2GJJA 4IMLB 5SWSD 2EYTB 5F9JA 4MA7L 4Q9RL 4LCWB 4BQ8A 2A6IA 4KPHH 4LFHD 4HUVB 2EDJA 3SOBL 3DTXB 3S34L 4NQDE 2ZNXA 3CVHB 1QTYT 1G6VK 4XB7A 4MD5B 4LSDA 1QPPA 2VLKD 4POZD 4Y0GA 1KB5A 2C3WA 3L95A 3LAFA 3QUYA 3VG9C 1MPAL 3MA7B 4PB9L 3TBYA 3ILPB 4YBQC 1FRGL 2E5EA 1T5XA 4X7SL 1UM5H 4JREC 1NMCB 2F19L 5HYSA 1J5OH 5CJ8A 2QQNH 3DXAB 5T5FH 1KTKE 4RWHA 3FQWA 5HI3C 3KG5A 5EPMB 1FL5A 4HS6A 4S2SB 2VXUH 4WNQA 1DBKH 5D9SB 3ZKMC 5GJTL 3QUZB 2HA1A 4YNYA 1FC1A 1JWMB 5KSAC 4EI5D 2BNRD 3SJVA 3EOYG 5BV7B 3S37L 5DD6A 2IGFH 3IDIA 3OGCA 5C6TL 1ED3A 5L2KE 3ZHKA 1HK6A 1CD1A 4JFDB 2A9MH 5DJZB 3R8QA 5GRYA 1TTUA 2HKFL 4QCIA 2P8MA 4XXDB 2BVOA 2IFFH 2YUWA 4GW5A 4PPTA 4Y5XA 4HULB 3VFOB 4PRPD 3NZ8A 3QIBC 2QR0B 1KJ3L 2AXHA 3S35L 4PGCB 5FYJL 5I16A 4KZDL 4G9FB 1GAFH 5ESQA 3LQAH 1M05B 3KNBB 4LLYB 1SYSB 4LEXH 5FKAB 1X7QA 43C9B 5D1ZC 2CRMA 4TTDC 5E99H 4LRNL 3BESR 3BO8A 4M1GL 3L5IA 5D8JH 5DMJB 5MEPA 3QUKB 3U7YH 5DMYA 2XWBA 3LHPH 3JV6A 4PUBH 3BOVA 1FV1A 1OGTA 3L9RA 3U1SH 3QNXB 4K94C 4WI4A 3WIHH 1ZVHA 2UUDK 5HVHC 4YHMH 5T1KB 4JCMA 1WSST 3CPLB 4YEFA 4OCSL 5EUKB 5F9JB 4HT1H 2XZCH 2YOCA 4JPVL 3ZKND 1KV3A 4P2RD 4Z7VA 4G9DB 4CUCA 4TNWF 3ZE2F 3IDYB 1PKQA 2EYSA 1FBIH 4R4BA 3P11L 5DUBA 1CLYH 3ZL4H 5K9KB 3GRWA 5E9DA 1P2CA 1MWAA 4FQCH 4I18C 5LAXB 3ZYZA 3EYVB 3G9VA 2X41A 3R0NA 1P5VA 2XICA 3K7UA 2NY0C 2NY4D 1KB5B 2VUOA 1T7YA 2YMXH 3QUYB 5GQBA 3WDJA 2OR7A 4Z7VF 1LO2L 3PWJA 4H25A 4J6RL 1WICA 4GKNA 4MX7A 4P4KA 3UTQB 3F7RA 4RWYL 1TCRA 4PRIE 4N8CH 4F9PA 5J89A 5JA8B 1FNGA 2Z31D 4FABH 1FL5B 4HS6B 1RVFH 2VDRL 5B8CA 3KXFE 5DHVH 2BJML 5ETUB 2EKSA 1EA9C 4U0QB 5D6CA 3UBXA 1M6OB 1W72H 1ZT1A 4Y5YA 4U6HA 1BZQK 4XCNA 1LO4H 5DMIH 3RKDC 5CMAB 1ZLUH 1ZMYA 3SJVB 3AVEA 1RZJH 2D03L 4HJJL 4XH2B 1WZMA 3H42L 3GM8A 1XR9A 2QADD 3MLVL 2ZUSA 2NX5A 1AQDA 3WD5L 2P8MB 2NTFB 3AY4A 3MJ9H 1A6VL 3T2QA 3S88L 3CLEH 4RFNB 3HC0A 3C08H 1FIEA 4NZRH 4FHBD 3P2TA 3M1BB 1V7NL 4P59L 1J86A 4N8VB 4KI1A 5ESQB 4ODHH 1ZT4A 2HJFA 3WL9A 2M2DA 3WIHA 4RFEA 2W9DL 2HJKA 3MXWL 4P99A 3C5ZD 3STZA 4TN9A 5C6WH 3OR6A 3CAFA 3IXAA 6FABL 2X4UA 2HFGL 1TXKA 5MEPB 3EW3B 4FRWA 4RDQG 5KSBF 1IMHC 1OGTB 4L5FL 4AJ0A 1WZ1L 1NBZB 3OKLA 5AG9A 1JN6B 4BELD 1U8LA 4QGTA 1VADB 1ZA3B 1EEZA 2Z35B 1ADQH 1PKQB 2EYSB 4R4BB 5DUBB 5C0FB 2VWEC 2CLRB 3UTTB 4F80A 4IRSC 4WCYH 5E9DB 3ULVC 3OKOA 3EBAA 4I0PC 4QKXB 2BSRB 1CG9A 3WN5C 4O5LH 2X1WL 4G7YH 4F57H 1R3KA 4XPFH 1AGCA 1X44A 4N1HB 4U1MA 3IS1X 2KL6A 3NFNB 3U2SA 2Y06L 3NIDF 4K55A 5B21A 3TA3C 1N3NA 5DHVA 4QNPF 1BIIA 2G5BB 3AB0C 5HHMB 4OM1L 3T0EC 3D2UD 4ISVA 1RK1B 2G60L 4WI8A 5D1XC 4HKXA 3MXVL 5HPMB 1PSKH 3TFKC 3O4LE 3SE3A 1K3ZA 2DQIL 3R1GL 4P0DA 3WKML 1QYGL 3UBXB 3KPNB 3FQUA 2R2HA 4Y4KD 4U6HB 3H7LA 4XCNB 4R7NA 1OWRM 5E1HB 4HPOL 3VXPB 1WAAA 2P5WB 1MSPA 1B3JA 2XN9A 4OCXL 1SYVA 2XTLA 5IQ7H 5FYJD 2R8SH 2NMSA 3VXRB 1U2CA 2NX5B 5IEKA 1AQDB 1FH5L 5DA0B 1RU9H 1MJUH 2WWMC 4YFLF 1KC5L 4WU5A 1W0WB 3TWCH 1JZ6A 4XNYH 1NEZG 5HI4D 4JM2D 3GNMH 4LCCA 1DTUA 1QSEE 5ILTL 1WAAF 2FJFA 2YPVL 5F1NB 2ITCA 4MCZB 3EO1A 1GHFH 4AENA 1N4XL 3LB6C 3IDUA 3MLUL 1QPXA 5KSBB 4NQVA 5LJYH 1RUAH 2NYYC 3FCTA 2HJFB 3BGFC 4LEOA 3T4YB 3EYUL 4HJGB 3MLWH 4RFEB 3MV11 1ACZA 4NN6C 3STZB 5DJ6B 1JF6A 2FGZA 1ZOXA 3PWNA 1YMMA 3CUPB 1U3HB 3DV6A 5J13B 5E70A 4HF5L 1QVOA 2R1YB 3OZ9L 3DOSA 1X5AA 5E6IA 1ADQA 5E8PA 1KJ2H 2GYSA 2Z0BA 1O5DT 4YC2B 4PP1C 5FA4B 4AEIH 2CDFB 2EE9A 3ZE0F 3Q0HA 1FZKA 5LBSL 5C0NC 1PYWB 1T3FB 4XGZB 1M7IA 4MS8D 3V6OA 3LS5H 1KXQE 1BFOB 5HYEA 2VJXA 1P4BH 2I25N 4E41D 2Z8VC 2HFTA 3OKOB 4TVPE 1LEKA 1L0YA 1CL7I 1CDBA 5MERA 4PRBA 4U2ZA 2VDOL 1CG9B 3DGGB 5EBMA 1HH9A 4IEFB 1R3KB 3QIWA 4WY7H 4U1MB 3V7MA 3BP7A 3MUGB 4RAUA 1IRAY 4WVRA 1MCLA 5LCVL 1FNLA 3T0VA 1XCTA 5DHVB 2BRRH 4OLVL 4O9HH 1MJJA 1W72B 4JQVA 2BERA 1UB5A 3WS3B 5EO9A 4C83B 1T03H 1H15A 5CZVH 4ISVB 3NOIA 3NPSB 3MRMA 1X5FA 1T1ZA 4HKXB 4MAYC 4KI5D 5BMFL 3QDJD 2QHLA 1ZT7B 4XC1H 4M1DH 4HS3A 1DN2A 3FQUB 5DC0A 2J6EH 5JQ6L 3LRGA 2QEJA 5I1JH 5INDA 5MEOA 4CW1A 1F90H 1B0GA 3B9KC 2VE6A 2H32A 2XN9B 3U0TA 3TYFA 1SYVB 3P9MA 1HDMB 5ADOH 1XGUB 4H8WC 2DS4A 2XOTA 3H9SB 4MXQC 2ZKHH 3BT2L 3MCKA 1J8HD 4N5EC 5J12B 3HG1A 5I8OH 1YEJH 4PJCE 3DETD 2BCKB 3KJ6L 4QTIL 2FB4L 2GFBA 1BGXL 3PIQA 5HJ3A 1S3KL 4LCCB 2IH1A 2LABA 4DN4H 1OTUC 2A6DA 4M5ZH 5CWSB 1LK2B 4PD4J 3FRPA 1FP5A 2AQ3A 4NZTL 5F71A 1ZSDA 1OVZA 2ITCB 5IMKA 3U4AA 5DRZB 2J5LB 5ESVA 1CZ8H 3GB7B 4YXLL 1MQKL 3FO0L 4EN3D 3D87B 3MODH 5AYQA 1JPST 4G8EB 3MGOA 4WU7B 4MQ7A 3RWIB 2PCPB 5D71L 4Y16B 3HI6L 4F2MA 4AMKH 5L8KB 4AIXA 5I1LA 1G7PA 3CXHJ 3M8OL 1G0YR 3FQXB 3PGFL 5T3XE 3CVIL 5KN5B 3SDDA 4DGIH 3HE6D 1P9MA 2ICWA 4OLXH 4PGEA 5D96B 1OGAE 4DZ8B 3RBGA 4XCFL 3QEUB 3O0RL 1HHGB 4ZS6C 3IAPA 1A7PH 3C2AH 1LEKB 4PRBB 4X8XA 5EBMB 5IWLA 1HH9B 5EWIL 5TF0A 3IS0X 3QIWB 5FHAL 1P6AB 3MLXL 2UZIL 4YDJA 4LOUC 5FHBL 2NLJA 5D70L 4P23D 2B4CC 3W0WE 1XCTB 3BWAB 3O3EA 4NPYA 3PHQA 4MA8L 5JW4M 4S1DC 1NC4A 2FIRT 2J6EA 3CFJA 2K7QA 5EO9B 1H15B 4YHZH 5L2KA 5CJOL 4KY1H 2Y5TB 3VD9A 2R4SL 3JWNC 3MRGA 3SGDI 3MOBH 4KVNL 1QA9B 4OAWB 5HI5D 5I0DA 5IFAH 4W4NA 5I1DA 4CBPA 5A3IC 1UJ3C 3QDGE 1IT9L 2W9EL 3EJYD 1D6VH 1XF2A 4HS3B 3OHXB 3ZLQC 4AQOA 1P84K 4M43H 1S7QA 4Z7WA 4ONGH 5INDB 1YQVH 5SV3A 2GJ6E 4GKOA 4CW1B 1E27B 3C87A 3JWOL 1QHOA 4YUEH 3JVGC 4OT1H 3RIFF 3TYFB 1T80A 3CXDL 3HC4L 3JWDC 3OPZL 3RTQD 4GQ9L 5DQ9A 3MCKB 1A4KB 1FFOB 1KEGH 5KTEL 1T2JA 2FD6H 3HG1B 1IC7H 3ILQD 3VH8B 1QNZH 3FMGH 2GFBB 4U31A 3PIQB 4Z7WF 3BQUD 5HJ3B 3UTSE 2JE8A 3TN0D 2J8UE 3BRDA 2A6DB 5EOCH 1NL0H 3QULB 2GEEA 2CXGA 4LIQL 3INUL 4F7TA 1KJ2B 3G5VA 5GS2D 1YQ2A 1CLOH 5FCUL 3VFRA 1V8HA 1SM3L 1JGVL 1CLCA 4CADA 1KTRL 1D9KD 3BE1L 4H1LH 3EFDL 4UUJB 1WQVT 1G7PB 4B7IA 1NUFA 3FTGB 5GRWA 1P53A 1LHZA 1JMXA 4XPGH 4XVUC 3LQZB 4BFIB 3KYNB 2ICWB 4LLVB 3KYAA 4YFEA 3CDCA 1Y18B 2DLEA 1D5IL 2VWEE 4HAFA 3U0WL 1V5JA 4C57C 3ULVE 5C0JA 4N0YH 2OL3L 3BPNC 3MFGB 5E5RB 1G7HB 2CLVB 1U8HA 3JTSA 4KVCL 2QQLH 2PXYD 3ARFB 5HDQL 5MP6H 3KXFA 3WJJA 3C8HA 3F7YB 5CCKL 3I6GB 5SWZE 4ENED 2YZ1A 4TQEH 5C08E 4NP4L 4DKEH 4WFGE 3T0EE 1IM3B 3PHQB 2AXGA 3MRRB 3BN9D 5DF0A 1CYGA 3KPPA 3GSUA 4M4PA 1ZGLB 3L3KA 4JFYA 1IQWH 3MRGB 2P5ED 2K7PA 5I1DB 3L3DB 4XNUL 3W2DL 5ITBH 4O02L 1S7QB 3EFFA 4Z7WB 2EYRA 4Y8DC 1UT9A 5J4MA 2Q20A 4O2EA 4WW2A 2GK2A 2FEDC 2QL1A 4L1HA 5AUMB 1DEEB 3O45B 5FV1L 2UWEE 3SDYL 5FGBC 2CMRL 5IUSA 3TH2T 3KYOA 4NGHL 1Y6MR 2EEAA 2J88H 4XCYA 2F74A 5INCA 1Q9OA 3ARVA 1MJ8H 2AS5M 4WW2F 4IIQB 3AUVA 1YEDA 3PQYB 4X0KA 1F8TH 1FNSH 1RI8A 5DD5L 3RHWK 3O3UN 1QSVA 2JELL 3MC0A 5F96H 4F7TB 5GZOD 3ZKQD 2XQYG 4DFIA 3GSNA 4M62H 5GGVY 2OS7A 1Y0LA 5L2JB 1W8NA 1P69B 4IJ3C 4O4YH 4Y19B 4U4BA 3RPIB 4PD4K 3VFPB 5C0DB 5EB9A 4CADB 5IKCA 1J0HA 4GUPA 1U41A 2Q1EA 5ECJE 1C1EH 4S10A 3VFSA 3PGCA 3QCUL 1INDL 1F3DJ 2YUVA 5LGHL 5D1QD 2D7MA 2VSDA 1E28A 4MJIE 1FAIL 3DVGB 3QEGH 4LFHG 5EZOH 1QR1A 3DURA 4Z0BH 3ZDXE 3N06B 3OKMA 5EBLA 4GG6A 5A2KH 2ED7A 2XG4A 2VXQL 3CXHK 1AXSA 1IGCL 2IQ9H 2OM5A 1U8HB 4ETYA 1XIWD 1ZWIA 3TBWA 4YPJA 4NKOA 4JQIL 1E6OL 4IMKC 1X5XA 3AROA 4EUPG 3EOAA 1R3JA 5EIQA 4L8SA 4GG6F 3MUZ1 3UJTH 4N90D 4NHCH 2MMXA 4POYA 1MCHA 2MPAL 1BFSA 1AJ7H 4QHNB 3FHQA 2AXGB 2VDPL 2F5BL 4JY4A 4JO3L 2D7NA 2Z91A 4RMVA 3RBSA 5ISZD 3QQ9C 4ALAL 5CEZL 1A7NL 5TPWL 1NGPL 1MFDH 4EI6A 2H41A 3N1MC 4KKCD 3NA9L 5TQ0L 2IAMD 3CDYA 1EXUA 1QSEA 4M7LL 1EMTH 1U3YA 3LKRA 3NABL 2YPLB 2EYRB 1JI2A 3AREC 1QSFD 4O2EB 4PJ9D 3H3PH 3CK0L 4WW2B 2JJTA 2X7LA 1MCFA 1A5FL 4H26B 3ARGA 3GI8L 3S97C 4HWEH 3KYOB 5IHBA 3O11B 5HGDB 3QDMD 3QXWA 4XCYB 4M6OH 5INCB 2MSPA 4JO1H 4I1NB 2VN4A 3KPOB 5FGSA 4YHLL 4X0KB 1M7DA 4PJHE 4H1LB 3MCLL 5I19L 3PXJA 2C26A 5C2BH 5I1CL 3K3QA 1EIBA 3ZDZF 1VFOA 5E94A 1S9WA 4U33A 4FMFA 1RZFL 2HTKD 1Y0LB 5I75C 1DBBL 4JRYE 5F93C 3B5GA 2EIEA 3CFCH 5FCSH 4ONFH 5FYJU 4Q97A 2ADJA 4GUPB 1JWSA 5CZXD 3C2SA 3PGCB 4AZ8A 4AEHL 4M9OA 5E8EA 2XIDA 4N0CC 4PJ5E 1E28B 5FGCE 3ROLA 3LKSB 4BFEA 1QR1B 2BDNH 1E6JH 5F9WB 5I1KH 4GG6B 1G7MA 1L7TH 4ZUUA 2WUBH 4EDXB 5IBLD 1TETL 3BAEH 3V0VB 2R23A 2XNAA 1FYTD 2BNQD 1AXSB 5J6HA 4HCRA 1J87A 4QOKB 1OTSD 2P8LA 3C9NB 1FCCA 1EAJA 3EHBC 1NGXA 4JO2H 4R90H 5C0AE 1KN2H 1R3JB 2ZSVB 4L8SB 1YC8A 3FO1B 5I1AB 5KSAA 4MXWH 4OSUH 1FPTH 1MQ8A 4G6FB 3VDBA 4I9WD 3R06A 5FUOL 1NAKH 3G9AB 3VI4E 3RY6C 3EYFA 2Z91B 5EIVA 4OGYH 4W6WB 3T1FB 3PWUA 5MI0C 4BZ2L 5HGHB 2WNGA 3SKMB 1EFXD 4XZUA 4EI6B 4PJCA 2QLVB 2R0ZH 5D7JD 2ID5A 1JNLH 5GIRA 2AV1A 3QIBA 2EDKA 4X4YB 3FB8A 3ZE1F 3THML 4XP1H 1LP9F 3U0PA 1P4LA 4M8QA 3MFFA 1B6DA 4LHUD 5C0BB 1WEJL 2EO9A 3OKKB 4ZTPL 5D1ZA 2AJXL 3OKDA 1IGIL 1JGUH 2AK1H 3HLAB 5T3ZE 3UO1L 2H45A 1EDQA 4XBEH 3DNKA 4JFPA 4R2GB 3KDMB 1DCLA 2BZDA 1F4WH 5F9OH 5CKGA 4HMCA 1NSNH 4DGYH 3CGTA 3GMLA 2NXYB 5B3JF 5CP7A 5DQDH 3L3JA 4P9HC 3O4OC 1IARB 2MQCA 3ULUC 1S9WB 1KFAL 4GRWH 2P48B 3O9WD 4P5TB 4XI5D 2V6HA 4I18A 2ADJB 5IVXE 1JWSB 2A74A 2ZUQC 2OTPA 1M7XA 5AWNL 1P6FA 3A6CL 3CZFA 1YPZF 4FP8L 2V7HA 2W65B 4IOIB 3ROLB 2ARJA 4K3GA 5GRZA 3PHSA 3W0WA 1F11A 1G7MB 1VGKA 3BZFA 4Q0XH 4ZUUB 4PJFA 1QSZA 2PTTA 5JOPE 4EXPX 3DRQA 3L7EB 4X7TB 2IQAB 5JA9A 1DQTA 1A8JH 4NQCE 5IB5A 2BOBA 3DHMA 2DBLL 1F5WA 5I66A 3ES6A 2V7NA 4PJFF 1LQSR 4TUJA 4A2LA 1A6AA 4QRSB 4YEEA 1LP9B 3VMPA 3HAEG 5EZIH 4HS8H 2WBJC 2PO6B 4KJQD 4NJ9L 1MCSA 5IMMA 3IJHB 4NQXB 5HHPB 3L7FA 4CMHC 4GG8B 5F7HA 1E4WH 1RUML 4XZUB 3FONB 3RFZC 2A1WH 3TVMD 4K8RL 2MTPA 3DSFH 5GIRB 2RCSH 3ORJA 3RVVD 4JB9H 3FB8B 3UTSA 4X5XB 4GOSA 2J8UA 1MCJA 1JF1A 3MFFB 1A7QL 4NT6A 2XXCB 1OPGL 1JPSH 1G7QA 4D3CH 1JYWA 4MNQE 1UM6L 2AK4E 5D1ZB 1FL3A 2NY1B 2AJ3A 3S98A 1HXYB 1CL7H 1QUNA 3STLB 3OKDB 4KKLD 2HN7B 3BEVA 3CU7A 2DN7A 1JPTH 3U6RA 2J8UF 5FA3A 4HUWA 3F8UB 1RUPH 3LKQB 1UB6B 1NCNA 1IC1A 4G8IA 2CKBL 2JJUA 1IQDA 3G5YB 3HRPA 1HZHH 3QXDA 4HFUH 3KPSD 1NBVH 4YAQA 3TBTA 4H20H 2UYLA 4QXUL 1YPZB 3ARRA 4WWKD 4J1UB 2MQ0A 5BRZE 5JXED 4KJYA 4M7KH 5F7DA 1RIUL 3HKFA 1NH6A 2ZG2A 3CFDA 4V1DE 4IRSA 4GRWF 1YUHA 4MA1B 4I0PA 2UV3A 4UBDC 3VWKB 3WN5A 2A74B 4KHTL 2WUCH 4AL8L 4ZUTA 5EU6B 3DV4A 3T2NL 2EXWD 1CWVA 2YD1A 3V4VL 1I7ZB 1I1AB 2YK1L 3TA3A 1AI1L 2VQUA 4OLYL 5SWZA 3EOBB 1ITCA 3B5HA 2W1NA 2X4OA 3QZWA 5C08A 1F11B 3ULVF 1HHKA 2DOCA 3T0EA 4OFDA 4UIKL 4PJFB 2ZPKH 4PB0L 2PTTB 5D1XA 2F5AH 4F7CA 2HVJB 1WITA 3DRQB 2ED8A 1ZLWH 2FGWL 1T1WA 5DK2A 4YJZL 2W07A 3SKOA 5D93C 4NO2A 1KACB 1EEYA 3FT3B 5I66B 4MJ5A 3SKJL 2D2OA 3VFUA 1CTOA 4GAGL 4TUJB 5TGBB 5T33L 2DTMH 1MVUB 5CP3H 4GXUM 2PW1B 4PJ8C 2ZCHH 3ARTA 4FTVD 3H8NA 3VXSB 4Y2DB 4WHDA 5F6IC 1I1YA 2UWEA 5DUMH 1ZLSH 2AI0L 5GGRA 4ZNEE 1KCRH 1FAKT 1MVFA 4O2FB 3SPVB 3V5DB 3ZTJH 1DQML 3R8BB 4ONHA 2BY3A 3ARPA 1MI5D 5DYOB 1KPUA 1E4XI 5EU7C 1A14L 3VDAA 4Q9QH 3WLWD 2GUOB 4FZ8L 3OF6A 1XGRA 3HRZB 2Q8BL 4HXBH 2Y72A 1N7MH 3ELAT 2EDNA 1ZGLP 2DMBA 4NO5A 4NT6B 4P49A 1KELH 3U36B 3HNSL 4J2XA 1G7QB 2UWEF 4L4VE 3RWJA 1ZHNA 5A2IH 1MCEA 1XF4B 5HGBB 1T20B 2DQHH 4ZXBD 5DTFA 2H2PC 3GI9H 4JG1L 5GSVA 1TZGL 3P0GB 4IRJC 3ZKXC 3UYRH 4QRQB 2E9IA 3U6RB 5FA3B 2KBGA 1NCAH 4GRWB 1BVLA 5T1DH 3IETA 5FDWA 4G8IB 2O5YH 1L6XA 4TYUA 2N4IA 2DM3A 1CXFA 4WHYG 3QG7H 4MJIA 4AH2B 4JG0L 2HH0L 4U2YA 1XGPA 3MJ8B 4JDTL 3L3HA 2CR3A 4OJFH 4P5KA 1JNHA 4P46B 3WDHA 5C0CB 4ERSL 4IRSB 1V3JA 4Y1AD 5HYFA 1U2HA 1QLFA 4HC1L 3WN5B 3SN6N 4HEPG 2Y36L 3GK8H 1D5XA 2B0SH 3SO3C 1L9MA 4HBCL 3C60B 2RB8A 2YRPA 1EV2E 4IOSD 4L3EE 4JFEE 5SWZB 2ED9A 3RDTB 4QRRA 3QZWB 2X4OB 1HIML 1MCDA 4JPIA 1MIMH 4OZGE 5C08B 1UA6H 1VA9A 3MBEB 1JCKA 3B3IA 5EBWA 4H5SA 4GMSH 4PLOB 5D1XB 4MAYA 4F7CB 5DDHB 2NY6D 2CDEA 1MOEA 5ERWA 5DK2B 2UUDH 5T5NG 3MYJA 1KYOJ 4PTUB 3JBG7 2AJUL 5E1AB 1NFKA 1ZVSB 4K8RD 4I4WA 3GSQB 4OLEA 3I6KA 3B9KA 1U8QB 5C0GA 2NY3D 2NY2B 5I73B 2YEZA 3DHJA 1U8NA 5D7KD 1MAJA 1I1YB 3H0TB 3VXUB 5I17A 1C7TA 1BF8A 3OR7A 1NCWL 3TF7C 1EO8L 3G6DH 5HTSA 5MEND 1OAXH 2BX5A 3BX7C 3ARBD 3UZEA 4K3DH 1XGRB 3QIUD 2VERN 3N0PB 4RMTA 2A83B 5ID1A 5JZ7D 2ZWLT 3RQ3A 5JPNB 1J0YA 1DQDL 3LEYH 3VE0B 4QY8A 4PJHA 1YN7A 3X3GL 4PY7A 2R0LH 4ZO9A 1OCWH 3HZMA 5ICYB 1UC6A 1LMKA 1WC7B 3SDAC 4JRYA 3FO9A 5HSFA 1S9YB 1KLGA 1EK3A 4PRHB 2BSSA 5L7XL 4ZAKC 2YC1B 1UJTA 1BVLB 3RZCC 1I9RL 5FDWB 4HW6A 3HE7C 4UILL 4FZEH 4PJHF 4I77L 1KN4H 4PJ5A 5I1EH 2PYFB 4LVOC 3ZSSA 3ULUE 2NZIA 2A6KA 4JANB 1XGPB 1S9XA 4N1CA 4UTBH 3P40A 1CD9B 1ORQB 4KRPC 1Q72H 5IV2B 5CINL 3B9DA 1IBGH 3CMOH 4P5KB 2WV3A 3SCMC 4ODUA 2ZSWB 4NZDA 1YYML 3QPXL 5CEYB 1QLFB 4U49A 2H1PH 5CGYC 3VG0L 5ICZA 1M71A 1VCAA 1DQLH 3WNLA 3C8KB 3MLTB 4YDVB 5C0AA 4E42A 4NKIH 1KJVB 5EDXA 1J1OL 5F1IB 5IQ9A 4QRRB 2W0FB 3G6AA 2HTLC 4JPIB 5IGXH 4KJPD 1T5WB 4Z7QE 2W91A 2FLBT 5C6PB 1KXTB 1I7UB 3D0VB 4XWOD 2XACC 3B3IB 4FXKB 4RQQA 3JV0A 2R29L 1CFVH 2GTZA 4KK9C 4HIXL 5J6GB 1UJ3A 5ERWB 1QFUH 5E2VL 1T0NA 4XVTL 2BC4A 2YS4A 3BKML 3UTPE 5DEFA 1S7SA 4I4WB 1FDLH 4UQ2A 4U1GC 3I6KB 5FB8B 1MH5A 3VFTB 2EDEA 3B9KB 3JVGA 5FO7A 3C8DA 5EC1B 5FGRA 3VGEA 4MDJB 3CSYA 2XZQH 2VLME 3QJHA 1TENA 3FB5B 4G3YH 1CS6A 2VZVA 3I6LD 1CIDA 4K9EC 5L9DH 3SDXB 1AKJD 4J3SA 1BBDL 3VI3E 2QSCH 4CVUA 4UV4L 2M26A 3MRFB 1NCCL 2V17L 3RVUC 3NIFF 5CBAA 3NTCL 3ECBA 3DUUA 3G5ZA 5CGTA 3IFLH 2KZWA 2D4DA 4NRZA 5DMGD 3OAZK 1X5JA 1AHWC 4OQTH 4BH7B 4YX2H 3HFML 1CFSB 1KIQA 5F9DC 4GBXD 1VGEL 1N6QL 1YJDC 2NXZB 4DJMA 1G9MC 1CK0L 5KOVC 2B2XL 1GGUA 1RJYA 5HDOA 1GGBH 2R39A 1FC2D 1CVRA 1KLGB 1X5KA 2BSSB 3PWLA 5IVZA 2F54D 4JR9L 2A77H 1S9VA 3TZVC 4L8BA 3NCFB 3O6LL 4YHKH 4WO4C 4PJ5B 4GAFB 1I8MB 3O8XB 4C56D 4KV5F 2DM4A 4OGXH 3GHEL 2VXTL 4YWGL 4L8DB 4LSUL 1S7UB 2GI7A 2YPKA 3QCVL 2X2YA 1QBLL 1OLLA 4F3FA 2LAGB 3EO9H 3SE4C 3O81A 2I07A 4FS0A 1IAOA 4NDMA 5TE7H 3GSWA 5ICZB 1PEWA 5DJXA 3U46B 4MB5A 2ORBL 1XH3A 1I7RA 4OF5A 1RZKL 5BOZG 4E42B 5J8OA 5HYJB 3D3VB 3PDOA 5HD8D 3UPRA 5IM7A 2NY5L 4S1SL 3DRTA 3OKEB 1A0QL 3BIKA 3EGSA 3LQMA 1UVQA 5IQ9B 5TDPA 5T1LA 3RWFB 1ZANH 3G6AB 4BK4A 4X5WB 5I1HL 3KVQA 3IFNH 1KOAA 3PE9A 1A6WH 1UWGL 5DJDA 2NW3A 1TZIB 3BZEB 1EAPB 5IROC 3BD4A 3TO4D 1A02N 1DL7L 4B41A 4XAWL 5ACZA 1P4IL 3O2WH 4MNGB 1UJ3B 2H3NA 3NACH 3VWJB 1DBAL 3MRIA 5J9PA 5IB3A 4BSWA 3GIVB 4YHPB 5BOPA 1TJIL 5JPMA 4OUUA 1MH5B 5I71C 1RY7B 2AABH 3IFOB 2DQJL 4NUGH 5I76B 5KZCB 5IMOB 3CSYB 4EXKA 3QJHB 5FM5M 4XVJH 1XF3A 2PYEE 4WUKL 5FGBA 3QNZA 1KB5L 3HC3L 4MNQA 1LO5A 2AK4A 2H26A 3KGRA 2EEDA 1TVHB 2YUXA 5F7UA 4XP4H 1OARH 4JFFD 4OFVA 3RUGE 3SGJC 1N5AB 1EEUA 4W4OC 5I18H 3UTZB 2HT2D 5CBAB 3K2UH 3ZSTA 4ODTH 1E4JA 1LDPL 4LSTH 4OLWH 5ANME 1G7LA 1OSZA 1B2WL 2VNCA 1KIQB 5HVGB 1H3PH 2WSKA 2OP4L 3PDDA 5BRZA 3ARWA 4TRPH 2ESVD 4DK3A 4JY6A 4M6ML 4U1SB 4V1DA 4M48L 5C0RH 5HHQA 2Y6SD 2C1PA 2BOCA 1Q0XL 3BPOC 1IZJA 1WLHA 5I1GL 1SHMA 3A6BH 4L8BB 2VLRD 2RFXB 4NWUL 2ZUTA 3VGGA 4LSPL 2X4RA 5DMKB 1T66C 2HRPH 1KTLB 2YPKB 3QWOA 4OZHE 4TSCH 1FL6A 4F3FB 5IBUB 2A73B 4LLMA 3F5WA 4FQ1H 5F21B 3O3DA 4X7FC 1IAOB 4PGBB 4CVWA 3ARDC 1PKOA 1J05A 1FFNB 1YNLH 4FQLH 5F9AC 1JTTA 3FOLB 1I7RB 3L5JA 4BZYA 3GSOB 3PDOB 4MWFA 3UPRB 1UFUA 4LCWD 3EGSB 3LCYA 3MV7B 5T1LB 3RWDA 1U93A 1WT5C 3BW9A 5LQBL 1GOGA 1Y6NR 2VISA 5DJDB 4LLAA 1KJMB 2N56A 2NW3B 3RX7A 2VKWA 4WI3A 3UYPA 4KQ3H 4PRNB 4XP5L 4P2CG 5FYKL 5ACZB 4ZNEA 4LAQH 5JNYA 2AW2A 2XY1A 2GSIB 1TZHB 3ZHLA 4PYHA 5CEZE 3GRWL 2GJZA 1MFEH 1NC2A 3AREA 4Y4HD 3LZFH 4OZIF 1UM5L 4IDJH 4RFOH 4M02A 4AEEA 4OUUB 1Z3GH 3DXAD 3QFJE 3NBNA 1J5OL 3P3YA 2IANB 3VFVB 1U8OA 2QQNL 2FECI 2X6MA 2F8OA 3UJJH 4L4VA 5I15L 2NNAA 1T1XB 1ETZB 1O7SA 2VXUL 3GMNA 1G9NC 3G04B 4LHUG 1DBKL 3DMMD 4X7EC 1QBMH 3D39B 3MX0A 4FQHB 4NJAH 1QFWI 5DK0A 3BRFA 5H35A 2N7BA 1QRNE 3Q2CA 3BDXA 2FX7H 2IGFL 4JFDD 3RGVD 1U92A 2VMFA 1G7LB 4NBYB 4J23A 1CBVL 5IR1A 4P4RA 3BDBA 4KZEL 1EGJH 4V1DB 1FJ1A 3W39B 4BUHA 1DVFC 2EE2A 4QRUB 2CIIA 5DZNA 4P9HH 3D5OF 4G9FD 4LHJB 5F6HI 2QBWA 4NQED 4F8QA 2YBRA 1GAFL 3MV8D 4X6CF 3LQAL 2B1HL 1OM3L 3AMKA 2XKNA 3CH1B 5C8JA 4L3EA 4JFEA 1GOHA 1AY1H 4OZGA 1FL6B 4LLMB 1AQKH 2A0LD 2VAAA 4XNQB 3PWVB 2FCBA 1VACA 4PUBL 1J1PH 3QXVA 4JPKH 4OFYD 3WIHL 3BPLC 2CIKA 4YHML 25C8H 4MWFB 2HFFA 4NC2B 3O6FB 3S6CA 5KVDL 3B9AA 3TJEH 4OZGF 2GAZA 4KMLB 3OXRB 2HAZA 4OGAD 3I3EA 3EYOA 3RWDB 1U93B 3RY6A 2QKIA 4OZIB 5IB1A 1CLYL 5DA4A 5AEAA 2JJSC 2VXSH 3H7BB 4HK0A 4MB3A 4OM0H 1X4XA 3TT1H 1FGNH 3QUYD 4HFWA 2PTVA 4P57B 1VFAA 4EQ3A 1U3JA 2P7TA 3H9ZA 4U1LA 2YN3A 4XMKH 3W11D 3AREB 4OGZA 5KOMC 3PP4L 4CRPA 1A1NA 5H37G 3T09A 3FQRA 3N9GL 5ESAA 3CDGA 3NZHL 1I8KB 1RZ8A 4K23H 1LEIA 1U8OB 3RVWC 2NNAB 3G6JE 5J1AA 2BXZA 5F89B 2XWTB 1PZ5A 3KPRB 1WCBA 4BJLA 3W9EB 4RGNE 4WFEE 1M4KA 5IBTL 2AEWA 2P47B 1HKLH 1BVKA 2I9TB 1QG3A 3NN8A 1R5WA 3SJVD 1R3LA 1F42A 1EJ6A 1LO4L 4KKAD 5DMIL 1CGXA 1U36A 3L3IA 2VITA 3SE8H 1EGJA 4LPVA 5DK0B 5H35B 1RZJL 1JNJA 2VZTA 3MRPA 4M1CD 3ARQA 4ZQKB 4X6CB 5KW9L 4K3EH 3SDCC 5GRVK 3EJZC 5KG9A 4LCIH 2D31B 2X4QB 3MV9E 2VQ1B 5DT1H 4LLDB 4PTTA 3CFBB 2HFEA 3C08L 4ELME 1DDHB 4NZRL 4QTHA 3KLSA 2FO1A 4JKKA 1I9EA 5F3HB 1XR8A 2DTSA 1A1MA 4OD1L 1BHGA 5ICXA 1I9JH 4GRLC 4ZO8A 3VD4A 4LCYA 4ODHL 4TSBH 1MLBB 4MMZC 1IM9A 4P3CH 4PYGA 5DHYA 2NW2A 1CF8H 1IEBA 5LGKA 3P4MA 5J11B 2VL4A 2EH8H 2XWJA 4N0FB 1B4JH 5C70A 1JV5A 4MD0A 2IWGA 1HXMA 3JUYA 5EUOF 3UX9B 3MGTA 4WUUE 2VAAB 1XMWA 5AAWA 1JHLH 3OX8A 4HWZB 3V5KA 3LIZL 3CFIC 4TOYH 1BIHA 4I2XE 4UOJA 5FYKD 5C07E 1B88A 2WBWB 5TH2B 2GAZB 1J8KA 3L1OH 4IRZH 1JZ8A 4G6ML 4XHJD 1ADQL 2DIAA 5E9DD 4D8PA 5CHNA 2QKIB 3CX5K 5IB1B 2WBJA 3AAZB 4KK6D 4IM8A 4ZFZB 1YECH 3KLHC 2QSVA 3L5XL 4MXVE 4WTZG 4NBXB 4HGWB 3I9GH 5DC4B 4G7YL 4F57L 4XPFL 5EO1B 4HFWB 1VFAB 1IJ9A 2JB6B 1IGJA 3TCLB 3CSPA 4P4KD 4Z7NE 1LE9A 1A1NB 1I3RA 1NBYB 3VJ6B 5DD1H 4XCEA 3RNKA 1NMCC 1RZ8B 1LEIB 1WVZA 3V52H 4AM0A 1PSKL 2VDKL 1AO7B 4MCYB 4ZFOB 3VI3F 1WCBB 2DIBA 5EN2B 5EH1A 4HIHB 1JGEA 2JK5B 5GGUB 3NN8B 1R5WB 3QUZC 2VLJB 5MENE 2ENSA 4BYHA 2P42B 5D2NB 3PDGA 1MCPH 4LKCA 3WUWA 5IIEB 2IPTH 3WXWH 4M03A 5BV7C 1NEZB 2NX5D 3MBXH 3O4OB 1LO3L 4KXZH 1K4CB 3OAUL 2OTUB 3VXTB 2KKQA 2X05A 1RU9L 3GZKA 4Y2OA 1N6UA 1V05A 4K71B 4XNYL 3RGHA 3BSZL 4AG4L 2KQMA 2VR5A 5EUOB 2HKHH 4HD9A 3T8XA 1IFHL 1XR8B 5CIPH 1V3LA 5ICXB 1GHFL 3D48R 4P9MH 5JUEH 3F6IA 1BD2E 1DJSA 1IM9B 1RUAL 1KEML 4LLQB 2W0LA 3MLWL 4V2BA 1ZHLB 3IGAB 5JXAH 3CNKA 1JV5B 1RJZB 4R3SA 4AY0A 3E0GA 1C12A 2C3VB 2LTQB 3IDGA 1UXSA 3OX8B 5ACMA 3S96B 3V5KB 3MNZB 3B2UC 1C5BH 7FABH 1R5VA 2DD8L 4AEIL 3CX2A 3E3QC 3TIDB 2H9GB 1BZ9A 4I48A 3RHWF 4R4FH 3BPCA 3LS5L 4ODSL 4PJ8A 4BA8A 5D7LE 3IDYC 1SBBA 3BHBB 2PYEA 4KTDH 1HQ4B 12E8H 4HPYH 4PBWD 1W2KT 1DLHA 2Y9RT 4KH2A 1D6EB 4K7PX 3RUGA 1IGJB 2BRRL 4UB0H 2MOVA 3TNMB 2P24B 4DVRH 1U3ZA 4ENEC 2HVKA 3WHXB 4ODVH 3MRKA 3RY4A 3KYKH 4HDIA 5I6XB 4PV9A 3OWEA 2DQUH 5ANMA 1MHPH 1TJGH 5FKPA 4AM0B 1G1CA 3I6LE 3BISA 1RIHH 5CKAA 4IRJA 1CR9H 4XC1L 3RUGF 1A3LH 1N59B 2OJEA 4M1DL 5FF6A 2J6EL 5I1JL 5F8QC 4D2NA 1PG7L 2XN9D 4PLKC 5I2IB 4LKCB 3WUWB 4LAJH 1T1YA 3GJEB 3KLDA 3ETBF 5ADOL 5C0IA 5F1KC 3AS1A 5CIPA 4RNRA 3RI5K 1KB9J 4AIZB 3RNQA 5B4MC 2DDQL 2EIDA 4OZHA 3MLPA 1HNGA 5TDOA 2K9UA 3T4AB 3SQBA 2GIYA 2ZG3A 3B83A 4RFNC 4M5ZL 4OZFH 5F88A 3T8XB 4WFHD 2F54E 3PL6C 3ALWA 4L29A 2BHUA 4M4RA 3KHQA 3WMSA 5IESL 1G1YA 1TPXB 2FHBA 4KKBC 4OBSA 1T4KB 3ESUF 5CSZA 5FDYA 3RA7H 3QJFB 1B0WA 4K7FB 3MODL 2OQJB 5FO8A 1QR4A 5EU4A 3CDFA 4G8GB 3UPAA 4OZHF 2GCYB 5GZOC 3O3BA 3QUMH 3VXME 2EIZA 4NUJA 2ATKB 4P2QE 1YMMD 4G6KL 1UWEH 2OTWA 2X42A 4OCYL 5I1IH 4L4TB 1C12B 1A9BA 4UDTB 4IHOA 2Y7QA 5E6ID 1E4KC 1KG0A 1YNTB 4RMSA 4AMKL 3IDGB 2PW2B 3HR5A 2ZCLL 4O2CB 1CXLA 5IMLB 1MCRA 32C2A 5CFHA 4U1KA 1R5VB 4PRAB 2R9HD 4DGIL 3PXHA 3SQOL 3PV6A 4XMPH 2D7OA 3IT8D 2VR4A 3LOWA 1WFTA 4PJ8B 3QFJA 4NRYA 2WIIB 4FFWD 4G7VH 1A7PL 3C2AL 1RZ7H 3S36X 1KCSH 4PJDF 2PYEB 3IXTB 3QIWD 1V7MH 2YD3A 1S5HA 2VDNL 2YA0A 1FORH 4JQXC 3DX7B 3VFNA 4ZFGL 3QEQB 2L4OA 4WFFE 1QLEH 3FKUS 4XMLH 4K9EH 5F7NC 5TF1H 2HVKB 1OB1A 5TDNB 2CUMA 1NGZB 1QRNA 2HJLA 2P46B 4HDIB 5EZJA 3T2PA 3AU1A 2PTUA 4U6YB 4I0KA 3P4NB 2R4RH 5A16A 3SDAA 1NGQH 4WV1B 1OT1A 2CRIA 1JZ7A 4HEME 1D6VL 3TPKA 2Y4SA 2VL5A 4ZAKA 3RZCA 2C9AA 1CXIA 2FZ3A 4M43L 3HE7A 1XGTB 1A47A 4GW4B 4HUUA 2SEBB 1BJ1J 1YQVL 4LLWA 1KLFA 3S5LA 3GBNH 1UZ8A 4OT1L 5BS0E 1MFAH 4OZFA 3LKPB 5JDJA 3HG1D 5CIPB 1C16B 1PZUB 4CU7A 1RK0B 3SCMA 2ADIA 5DVKA 4A2MA 4JKWA 2XTJC 3P0VL 3QUMA 4MVBC 1A64A 4GW1A 5D6DC 3LKOA 4C54A 1NL0L 4C4KO 3HI1A 5DRXB 3HPJB 4YQXL 5I30L 4HJ0C 1A7OH 3QAZC 4NQSA 2IH3B 5GHWH 2NTSP 4HQQL 5E2WH 1CLOL 3O3BB 4WWID 3W9DA 4LSVH 5FECA 1OP9A 2BSTB 5IHUH 3LRSA 4HHAA 1AP2A 4XPHL 4A6YA 1HI6A 5JMOC 1U3HC 3HR5B 4NC1C 4PJDB 2J2ZA 2QQKH 3GSNL 5TFSH 5JHDB 3SDDD 2C3HA 1JFQH 4XPGL 2CDGB 4UQ3A 1WFUA 3S35X 4GAYA 4WTZA 1YY8B 1RMFL 4BQBA 2IFGA 1L6ZA 2DRUA 3MRHB 1SEBA 5F3BA 2DQDH 1BQLL 2YKLL 3G6JA 5MP6L 5IFHL 4JN1H 1NQBA 3Q1SL 1JYXA 1WIUA 1S5HB 3DO7B 3DROA 4HWBH 3VFNB 1SBSH 1FZJB 1ZTXL 2W92A 4TQEL 1CGUA 1T21A 4DKEL 5DJ2A 1NC4D 4JLRA 3BRGC 1AHWA 5L2KD 1J0ZA 5KANI 4DZBA 2CLZB 3G6JF 4CKVX 1TNMA 3RWGA 4OIIL 2APVA 1IQWL 5JOFA 4YPGA 2IPKA 5A16B 5JW4Q 2FJHA 3PNWB 1BQSA 3MV9A 1C08B 4LF3A 5CLTA 2P49B 2VH5L 3TO2B 2VL5B 4LSQL 3U7WH 4ELMA 3HE7B 3TZVA 3NFSL 1S9KC 4WO4A 3ALXA 1UZ8B 4TUOA 4JRXA 4LVOB 5DRWB 3AS2A 2IALA 2HP4A 4JFDE 1DN0A 2VIRB 1CD0A 4U1JB 2ATPA 3X17A 2RQ8A 3AMLA 1A4JB 3SCMB 5J12C 1C5DA 3T77B 1H8OA 1RIVL 3SE4A 4DAGH 4ELMF 4WUUA 5DD0H 3TM6A 4PJ7A 1TIUA 1HQRA 2QHRH 3V6ZA 4GW1B 3UROR 1AGEB 1MJ8L 4K7PY 1HHIB 3LKOB 5H2BA 5IFJB 2LU3A 1F8TL 3HI1B 1KB9K 4I2XA 1FNSL 2GQHA 1G0DA 4JFHE 4MA7H 5C07A 5SWSB 4Q9RH 4ODWB 4O4YL 2NQCA 2APWA 2NPLX 2X44D 2W60B 3FOMB 4KRNA 5FECB 3P0YL 4PJ7F 2C1OB 5IROA 4YHNA 4Y16C 3GJFK 4ETQB 4L8CB 4YFLI 2ZUYA 5H8DA 3H9HA 5GRUH 1ZHKB 2AJZA 3E3QE 5E6YA 2MHAA 3O6KL 4QYOA 1NLBL 1QFWH 5JMRA 2VLKB 3DYMA 5HHVH 4R7DA 3QEGL 5EZOL 4HKZA 4KK5D 1EO7A 4Z0BL 2R1WA 3HMXA 3IU3B 1FRGH 3QCTL 3MMEA 4X80L 5C3LD 4TNVF 4UV7H 4CMMA 4HWBA 4TVPL 5KAQG 5IEHB 3KPMB 4NZUL 1NLDH 1A1OA 3FAWA 4MXVF 3P77A 4P3DA 3KXFD 1JF5A 4HZAA 3VD5A 3V5HB 1CFTA 2OSLA 4FG6C 3DROB 3SGJA 3M45A 1EERB 1I9IL 4W4OA 4Z7NF 5HYQA 1HE7A 4HCRL 4HX1A 3KAAA 1AJ7L 5JLZB 3S37H 4ZPVA 1AHWB 3EYQC 4EI5B 5TJWK 5C6TH 5FYKU 1G9NH 2DLGA 3CFEB 2HRLA 3HAEH 2HKFH 2BVPA 4YPGB 3WBDA 1MRDH 1MFDL 1YN6A 4UOW0 1BQHA 3NAAH 1P7KA 3MV9B 2VO5A 2AJVH 3V0AC 2XV6B 4PRPB 3TZVB 3S35H 1Q94A 1E0OB 1F45A 5FYJH 4KZDH 4HWUA 3H3PL 4JRXB 1QLRA 2IALB 4AYFA 3C09B 3I50L 3K81A 3BH8B 1DN0B 3RWCB 1BD2A 2AXFB 4E0RA 2ZCKH 2X4TB 4HWEL 5HHNB 4LRNH 3TBVA 3MV01 2D3VA 4M1GH 1KIPA 4M6OL 5GGSA 2I26N 1UADC 1F3RB 3N85H 3IF1B 4PJ7B 3ARDA 4JO1L 4RGOL 5EZLA 3KS0J 1V3MA 2VN7A 4FOMA 5EFIB 5KSUA 5JTWA 3CFKA 1DR9A 4LARL 4TSAL 5C2BL 1MFBL 2YD4A 4OCSH 2ILLA 1W8OA 1YA5A 4JPVH 3SO5A 3IDXH 3V8CA 1WT5A 4ZTOH 1A9EA 4P2RB 1K8DB 3H9YA 3CFCL 4OKVA 4ONFL 2X70A 3P11H 4K94L 4GXVL 1H0DA 3ZE2E 5D7LA 1GGCL 2IADA 3VFMB 4YHNB 5HBBA 5T3XL 1RQ5A 2FWOA 3MREB 5BZDB 3T0DA 3VRLE 1KCUH 2EDOA 3DX6B 5DHXB 3H9HB 2MHAB 3MRCB 4FXGA 2VZOA 4Q2ZB 1F13A 4OLZL 4U7SA 2NY4B 3LEXA 4YK4B 1E6JL 3OTTA 2R1WB 5F7LB 3WV0A 5I1KL 1MIEH 3MMEB 3E6FA 3HUJA 5I71B 1NKRA 3BEWA 3K8LA 3BAEL 3RPKA 1EFQA 4CNIA 3ULSA 4RWYH 1DUYB 1WBYA 3UTTE 5E9DE 1PQZA 1ZEAL 3P77B 1JZ4A 4WW1A 2C7UB 1SJHB 3O4LD 2PNDA 3MJ7B 2Z31B 1SEQL 4JO2L 3ARFC 2BJMH 1KN2L 5HYSG 5ID0B 3QXTA 1FG2B 4MXWL 4F33B 4OSUL 1PFCA 2V9TA 1FPTL 3HUJF 5HYQB 3OG4B 4LNRB 1OLZA 2OI9B 4HX1B 2AV7A 5HHME 4QF1B 4JJ5B 3IU4L 4N0UB 2D03H 3VCLA 3NGBC 3V6BR 3H42H 4YHOH 3MLVH 3CZJA 5LKNA 2E27H 1JHTB 3T3ME 5E5MB 2QADB 4DKDC 2R0ZL 1BQHB 1OTTD 1UH4A 2JCCE 1MUJB 1JNLL 1S7WB 2P45B 3S88H 1DVFA 1QSED 4FFZL 1CCZA 5CS7A 1Q8MA 1YY9D 4NFCA 5ITFB 5GRXG 1V7NH 3RL2A 2P5WE 1JZ3A 2Z93A 1R24A 2IBZX 4K3JL 4N9OB 3G08B 4NM4H 3VXRE 3GMPA 3ARGD 5E7BA 2W9DH 3GMRB 3MXWH 4ORZC 1LEGB 3B8YA 3VXMA 1JGUL 4PR5A 3C5ZB 4IOFC 4P2QA 2B5IC 1Q0YH 4JM2F 1HOCA 4MNHB 1CU4L 1ZHBA 3X11B 4OQ1A 4URTB 1HH6A 3E6HA 5CBEB 3WIIL 1Z9MA 2V2WB 1F4WL 4L5FH 3RVTC 4HUXA 1HHJA 2EXYC 1NSNL 5J3HC 4DGYL 5KSUB 1WZ1H 1C8PA 1TCMA 4IIQC 3CFKB 2XA8L 5KSBE 1MY5A 4WHYH 2XZAL 5GGTA 1AD0B 4MLSA 1N5YH 5B39A 2JJSA 3QO0B 4HKBA 1UM4L 4R4ND 4TVPD 5D7LB 3LH2L 4NC1E 3HB3C 4YGAB 4E41A 5IB4B 4UOW1 4FFVC 1NPUA 3I75A 4YBQD 4ZS7L 2DI7A 1N0XH 2P8PA 2X5PA 1A22B 4NSKB 3ULVL 4LSRH 4WHCA 2VZUA 3IJSA 5GS3A 3WE6A 4QHUB 4UDUA 8FABA 5IHZB 3HUJB 3BEWB 3OMZA 3QB7C 3RJDA 4OM1H 5HI3D 1ACYH 2HLAA 1WBYB 5B38A 4WDIA 2G60H 4G80A 3DWTA 1MREL 4MQSB 4Z76A 3FRUA 3ZKMD 3QG6A 4W68A 2DQIH 3R1GH 5KSAD 1QYGH 3HAEB 1IEAA 1JYVA 3BP6A 2DM2A 2OK0L 1HWHB 1OAZH 1CIUA 4Y4KB 3WNPA 2BP3A 4HPOH 3WFBH 1REIA 3UBXG 3GSRA 4HS8L 2YZ8A 5BS0A 4U1NB 3SDCA 1ZS8B 4PP2B 2V2TB 2O5XH 1FH5H 2A6JB 4PV8B 4GKSA 1J8HA 2LVCA 4D0CA 2DAVA 3QIBD 1KC5H 3KHOA 4MD4A 4OTXL 4XNZC 4NHUA 3RWHA 3QNYB 5CUSL 1DVFB 2K1MA 2X4SB 4JB9L 4MHHI 3C5SB 4UIMA 4JM2B 5ILTH 4GRLA 3MO1A 2YPVH 5CAYB 1OT2A 2OCFD 2Z93B 1M1SA 5D1ZD 3MLUH 2XN9E 2VTFA 4NCC2 1FVDA 3B6SB 5HHOE 5JZ7C 3O41B 4NNXA 4TTDD 4QRPA 1IE5A 3H9SE 4RAVA 2VLLB 1CL7L 3UJIL 3E8UH 3A6OA 5KSVA 4WEMB 3LN4A 4PR5B 1Q9WA 4X9IA 4D9LL 2P44B 1KT2A 4QHKJ 1HOCB 1WTLA 1ZHBB 4UNUA 4WJ5B 1CQYA 5L88L 1EZVX 4HF5H 4JY5L 3FJTA 3P30L 5IW3A 3E6HB 1DQJA 3BPLB 4LCUA 1A3QA 5T3XD 1EBAA 4HUXB 1JPGB 1U8PA 2N1KA 4JM4L 2AEIT 4IMLA 5FV2A 4HG4K 5GS2H 2EYTA 2VOTA 3ZE0E 1OGAD 1G6RH 2HT3C 4M5YH 4M7KL 2AEPH 3PWPE 1HEZB 2MKLC 4HUVA 1UYWH 2MCPH 1NCDH 3DTXA 3CVHA 2NY0D 4E41B 1T83C 1UH3A 4N9GB 3I75B 3P73B 4CDHA 4YO0A 5E8DL 2F8VA 2P8PB 5LCVH 3W0WD 1QRKA 3MA7A 3CC5B 3ILPA 5F8RC 3WE6B 3V6OE 8FABB 5F9WC 3IAQA 4LDEB 2CPCA 4YXKH 4Z8FL 5MHSE 5B38B 2F5AL 4Z76B 5EPMA 4JVPA 2EEBA 3QDJB 5J7CC 4QWWC 5D9SA 3RKDD 15C8H 5JQ6H 3QUZA 4ZYKA 3V79C 1JWMA 2Z8SA 1BEYH 2Y1VA 2Q3ZA 1CGTA 4PIRF 2DTML 3S4SA 3B2VH 4XPBH 1OF2B 4Z5RB 2EC9U 4OF0A 5AZ2L 5DJZA 5DUML 4Q6IB 4ORGB 4APQC 1KCRL 3F12B 4XXDA 1HINH 1HSAA 1J8HB 5BJTB 4D0CB 3KJ6H 3EDEA 4QTIH 3I2CH 3UTSD 3RWHB 4DVBB 4LBEB 4H8WL 1MHHB 4HXBL 1LE5A 1IKFH 4PGCA 4TUKH 1YEGH 1OQXA 1FVDB 3FQTA 3KNBA 4LLYA 4NNXB 3WFHB 4QRPB 43C9A 4KRLB 4EN3B 3HG1E 3NH7H 2Y23A 3GI9L 3BVNB 2AGJL 2UVFA 3CIQA 5KSVB 2D4FA 3L5WB 4KU1A 3KPLA 1A6ZB 1Q9WB 4MJ6B 1G6RA 1WCQA 1VEMA 3QUKA 1S7VB 5H94A 1MAMH 3M8OH 3NCYP 5DR5H 1DQJB 4LCUB 1KPVA 3QNXA 4R2GC 4PJGA 1CI5A 1U8PB 3HI5L 5CJQL 4H0GA 3CVIH 2D7TH 3QO1A 5T1KA 3CPLA 5EUKA 5IK3B 1CE6B 2NXYC 3PHOB 3HE6B 4BQ6A 4KTYA 3ULVD 4G9DA 4XCFH 4I0PD 3O0RH 3TLRA 5AAMA 5K9KA 2WIMA 4P5TC 4PJGF 1BX2B 5LAXA 4G6JL 3EYVA 4HK3N 5EWIH 2D9CA 2B0SL 3TA3D 3IJYB 3MLXH 2UZIH 2EZ0C 5SWZD 5FHBH 4YO0B 3SKNA 5C08D 5D70H 1IC5L 5LXGH 4WFGD 3T0ED 4PJXE 1F4XH 4P23B 4WEBL 1UA6L 4MA8H 5TQ2H 5D1XD 2XKSA 3SBWC 4X83A 3UTQA 3TFKD 5CJOH 4GMSL 2R4SH 4KVNH 1AD9B 1RZIB 4YGVB 2B20A 2B4CL 4GMTH 2EIBA 4HIEA 5ETUA 5GJSL 1IT9H 3PV7A 4L9LB 4TTGA 5DFVC 2APFA 1M6OA 3TPUB 3DVNB 2A38A 3EKCA 4ZYKB 1WV7T 3DSNA 4JFOA 3WEXB 4F7EA 1IAMA 5CMAA 1EBPA 3GBML 3S4SB 2RR3A 3CXDH 4XH2A 2WWMD 4RIRB 4XPAL 3NCMA 2PO6C 3FFCA 1HSAB 1T7WA 4U6VH 2NTFA 2YD6A 4JFXB 3OF6D 4ZOCA 3JWDL 3LB6D 3PL6A 3BQUB 2X10A 4Z7WE 3TN0B 1LE5B 4WTXA 3F6LA 2NYYD 3M1BA 1BWMA 4NM8H 1MF2L 4LIQH 4N8VA 3V4UL 3FQTB 1H9VA 3D6GA 5T3ZL 2ICWJ 3FRPG 2IMMA 5JW4N 1H3UA 2NY1C 2BVEA 5FCUH 5CEXB 3KPLB 5C09A 4HMDA 1E4KA 2L7UA 1G6RB 3T65B 3BE1H 4JE4B 3LD8B 4PP1D 5H94B 2Y07H 3BXNA 4XAKE 1IAIM 1JTPA 4FZEL 5F7YC 1KPVB 3PQYE 5C0ND 5JO5B 4MJID 1LD9A 1KN4L 5I1EL 2C5DC 4PJGB 3QO1B 1NBZA 2ZOKB 1FYHB 1JN6A 1RV6X 1Q72L 2JB5L 4Y19E 1VADA 2YN5A 1ZA3A 5E03A 2Z35A 4BSVB 4KVCH 5C0FA 3VRLF 2CLRA 2FL5B 3UTTA 3MZTA 4MA1C 1DQLL 2BSRA 2PXYB 3VWKC 5K9QG 4OKDA 4JQXA 2OZ4H 1IILE 1ZVYA 1INQB 2J4WL 1UXWA 5CCKH 3NFNA 4QRRD 1D5ZB 5C86A 4MAUL 3SKNB 1I1AC 3MRBB 4NP4H 1SJEB 2G5BA 1ORSA 2ZOLB 4OBRA 4MAYD 1NANH 1X4YA 1CE1H 3O2DH 4ZOAA 1RK1A 1WWWX 2CRZA 4RGMB 5HPMA 5IW6B 1EZVY 5GS1B 2P5EB 1QFUL 4HIEB 1TVBB 5DD3H 2JCCA 5FM8A 3KPNA 1K8IB 3RL1B 1FDLL 4O02H 3B9KD 1GXEA 3IVKA 4JFOB 1JNNL 4F7EB 4FMKA 4MXQD 3VXPA 4QRTB 1NGYB 3GMOA 2P5WA 2XZQL 4N5ED 3T3MF 3UC0L 3MACL 4DGVH 1NDMB 3VXRA 2DQTH 1OP3H 5L9DL 4Y2DC 3FFCB 2JCCF 4NGHH 2X09A 2VZ3A 1OTUD 1W0WA 5DUPH 2V2XB 3BIBX 3OB8A 5D6DA 3PL6B 1JJUA 2YPLE 1BLNB 5F1NA 1G84A 1LK3H 4MCZA 4J3OC 2EDDA 4YX2L 43CAA 1WF5A 4KROC 5KSBA 1AR2A 3T4YA 1ZLVK 1MRFL 4HJGA 4JRYD 3MRNA 1YC7A 4FQJL 2O26U 3LN5B 5DJ6A 4M3JA 1BFVL 5C09B 1GGBL 4X7CC 1JRHI 4ZOBA 3CUPA 1U3HA 2R1YA 2E8YA 2A77L 4L4JA 5MEQA 3BXNB 1B9ZA 4NWTH 4NFBA 4PJ5D 5LGHH 4ZNCD 3MLSL 5BCAA 1LD9B 5FA4A 1FAIH 1VEOA 5D1QB 1VFBB 4K07A 2CDFA 3DLQR 4OGXL 5DURB 1D5MA 3MLZL 1PYWA 1T3FA 3TBSB 2CUIA 4XGZA 2OZ4A 1UACH 5DWUL 4UTAH 3UDWC 1KBGL 5L6YH 1BFOA 1H8NA 2VXQH 3EO9L 1IGCH 4MDIB 2APXA 4P46C 5AZEH 4X4XB 4LPCA 1XIWB 1IGYB 5C0AD 4LOUD 3DGGA 3Q48A 3O2DA 2APBA 1J9CT 3I02A 4OCRL 2WWKT 1UXWB 1L7IH 3MUGA 2A9NL 3B43A 3C60C 4S1DD 1ZANL 4GG6E 3U30C 4Y89A 1BBJA 5C1MB 4LQFH 3RDTC 1WFOA 1W72A 3IFNL 2VDPH 2HWZH 2F5BH 1ORSB 4HIIB 1K6QL 1PLGH 1KF9B 4JO3H 3WS3A 4C83A 3MBEC 1NDGB 4QOKE 4ALAH 3OB0K 5ISZB 1A7NH 3O2WL 3FN3A 1NGPH 4AK1A 3MROB 3NACL 4OZ4B 3DGCR 2FR4A 1ZT7A 3NA9H 4J3UA 2JCCB 4EBQL 2IAMB 2OMNA 5FO9A 1DP0A 3IVKB 3MJ9A 5KZCD 4F7PB 1MEXH 3HPLB 3GSVA 3W11C 1G9EA 4LHQB 2GK0A 3GMOB 4DW2H 5H37H 5K59F 4PJ9B 3U4BH 5HHOA 1HDMA 4Y4FC 3V7AE 1XGUA 3BUYA 2NY2C 1A5FH 3H9SA 5I73C 3GI8H 7CGTA 5T3ZD 4FQ2L 4XP4L 2XTJB 1OARL 5L8LB 2BCKA 3FFDA 5A2LH 1TFHA 1JWUA 1IC4H 3QDMB 2PF6A 1IGMH 4KGJA 1EHXA 4RZCB 4QXGH 2AAVA 5TE6L 3C6LC 4ESKA 3KWWB 2ICEB 1LK2A 3K2UL 5CWSA 4YHLH 3BUTA 5C0BE 5JW3L 2DKSA 4ODTL 5BO1H 4LSTL 3MCLH 1UCTA 1PVHA 43CAB 3QAZB 5DRZA 4PGZA 3GB7A 4M93B 1J11A 1RZFH 3MRNB 3GBLA 1DBBH 1TJHH 3ZDZE 4E5XA 4G8EA 4WU7A 3PWPA 3RWIA 2PCPA 5C0RL 4Y16A 1CFNB 2HMIC 3MPCA 2WWKO 1T04A 4BM7A 5HVFB 4KHXL 1BOYA 3P9LB 4XTRC 3VFGL 2OL3B 5MEQB 4AEHH 1KENL 2DJUA 3O2VH 3FT4B 3A6BL 3VDCA 3FQXA 1CN4A 4XVUD 3BP5B 1XAUA 1YYLH 3U79A 5KS9B 1D5MB 5KN5A 2FYYB 2Q8AL 4PJBF 1TETH 4DZ8A 5DLMH 5JR1L 5JOPD 1HHHA 3QEUA 4FQ1L 1HHGA 1ES0B 1N6VA 4NNPL 1FYTB 2BNQB 4JGMA 2BNUB 4FQLL 4Z18A 4OF7A 4UT7L 1D7FA 4RMQA 4NOBA 3I02B 4NQCD 1FN4B 4W70A 5T1LD 4QT5B 1FO0H 4KJWC 1BBJB 3BWAA 4QEGA 3RIFK 2WP3O 2BHZA 1A6UL 3FHAA 4JFQA 1FZMB 4CGTA 2RHEA 1FE8L 2Y5TA 3C5JA 3WIFA 1QA9A 4OAWA 3LV3A 2FR4B 1BJ8A 2CK0L 3TH4T 5EBGA 3GMQA 3E2HC 5D7JB 2CGRL 5FYLE 3OHXA 2VXVL 1MLCB 2Z8WC 4YDLB 5FO9B 2FEDD 4RFOL 4OI9A 1Z3GL 4U05A 3ZE1E 3T0WA 1LP9E 1E27A 3GSVB 3MLRH 5DGRA 2GK0B 4H88L 4MNQD 4ZTPH 3OJDA 2AK4D 2J1KA 3UJJL 5HHOB 5FAAA 2DQEH 3BUYB 3F58L 4J3VA 1A4KA 1FFOA 4X6EB 3PF2A 1BJMA 2BY0A 1IGIH 2CO6B 3VH8A 1NFDF 4GAJL 3FB7A 3D25A 3FFDB 3UO1H 1FNHA 3I3DA 4LGRB 1JWUB 1LGVA 2GY5A 1OAUH 3FN0L 4JKMA 3RU8H 5CD5C 4NJAL 4OB5H 3QULA 1YMHB 3GGWB 2D0GA 3VRJA 1KJ2A 4QHMA 1RURH 5B3JE 2CO7B 4XCCH 5BRZD 1WWAX 4P2OC 5EU3B 3MTRA 4NFDA 4V1DD 4E5XB 4PJBB 4EOWH 3ARZA 1J1XH 2HT4C 2NXZC 3PWPB 3DECA 5BQ7A 1EGJL 1T04B 3O9WB 4P9HL 4UUJA 3ULUL 5EORL 5DJ8B 3FTGA 4QO1A 4U6TA 3A6CH 4FP8H 3QQ3A 1UKQA 2R69L 2X9WA 5E4IA 3O8XC 3LQZA 1YPZE 1RD6A 4BFIA 3KYNA 3QYCA 1B0RB 4LLVA 4PJXA 3RI5F 1Y18A 3OL2A 3WSQL 1IAII 1HHHB 1AQKL 1FO0A 1EO5A 1G7HA 4JHAL 2CLVA 4R26L 3ARFA 4JPKL 5BXFB 1CDGA 5EU6E 3WDIA 4GQPH 4Z0XB 3F7YA 3BWUC 3D9AL 4NN5B 2DBLH 1JGLL 3I6GA 4PJXF 1GZQB 4NN7B 5FOJA 1ZE3C 4YFDB 1AFVH 4BKLA 1S5IL 1IM3A 3UMTA 4PJFE 3QQ9D 3MRRA 3ZDYE 4DFHA 4JFQB 2VXSL 3MA9H 4Z7UF 4N5UA 4MB4A 4U3XA 1ZGLA 2FEEI 3C5JB 1FGNL 4CU8A 3IDMA 5IB2B 3WIFB 5GS0C 4UINH 2EDRA 1Q1JL 3LV3B 4XX1E 3VRIB 2JLLA 3L3DA 3U9UB 3GMQB 4OIAA 3OSKA 3TVMB 1NC2D 3V0WL 3VWJC 1NFDB 3RRQA 1CT8B 1MI5A 4BH8B 2ADFL 1A7QH 5IOPB 2WQ8A 4R6UA 3AGVA 2FIKA 4L4VD 1ND0B 4LQ1A 1JGDB 3BZ4B 3OJDB 5AUMA 3TIEA 5C0EB 3VXSE 3Q3GB 5D2LA 1DEEA 3O45A 2V5TA 5IT2H 1RAMA 2G9HA 1AXTH 3J8F7 1VFMA 3FB7B 3D25B 2ZJSL 1TITA 5JDSB 2KUTA 2CKBH 4NIKB 4ZPTA 4IIQA 4LSSH 3HHRB 2GSGB 3PQYA 5D2LF 1U58B 3DO3A 5DZLA 3KPSB 1T7XA 5GGVH 3VRJB 2RIKA 4QHMB 2ZNWA 4R96A 4LCIL 3GEWB 5I74B 4Y19A 5L2JA 1RIUH 4X98B 3UZVB 5DJYB 5BQ7B 3RPIA 3VFPA 5ENWB 5C0DA 3L3OB 5I8KH 4N0CD 4GRWE 1GC1C 3WFZA 3GMMA 3H2WA 4PRDA 2YK1H 2FLRT 3QQ3B 4L3ED 4X9BA 3DVGA 4JFED 1CF8L 3IKKA 1FVEA 1GIGL 2EH8L 4PJXB 1B4JL 1ERNA 5C7XL 5C0CE 4KMQA 3EHBD 4OD3L 4OI7A 1FO0B 3BP4A 1JHLL 4NRXB 3W81A 4BFGA 2HLFC 1E4XL 2FGWH 3N1FC 4Z7UB 3TYGL 2V5MA 4XWGH 2VDLH 4TOYL 5DXWA 1X5LA 1YNKH 2GW5A 2E7LC 1Q9KB 3MOQA 3SKJH 2EE6A 2R9HC 3TV3H 4BKLB 1PW3A 4QHNA 3NGBB 3MLYH 3GJFH 3VFWB 1K4DA 5DI8B 4FTVB 2AI0H 2X4PA 2YRZA 3IDMB 4IBLT 1SJVA 5IJVB 3LS4L 5L0QC 3S3SA 2DQFA 4W6YB 1DQMH 5DJAB 1A14H 1KGCE 1MI5B 4FZ8H 5ALBH 3L5HA 2Z8RA 5J1SC 1OAQL 2YPLA 4JFZL 5DD1L 3V9FA 3HNSH 3SY0A 1KUMA 2FIKB 2FATL 3TIEB 4JDVB 3K74B 5D2LB 3HZYB 4DEPC 1J10A 5CD3B 2I60H 3VXUE 1UWXK 3ZYOA 1KSRA 4H26A 4D0DA 1CDJA 1RJCA 2B5IB 1J0KA 2G9HB 3RVXC 1TZGH 3O11A 5HGDA 1YEHL 3Q6GH 2OR9H 1X5YA 1CICC 3QHTC 4YIQB 3OJVC 3KPOA 4ZPTB 1MCPL 2BVYA 1EH9A 2IPTL 3WXWL 1S7XB 3ULUD 2XQBL 1EJOL 4H1LA 4JG0H 2HH0H 2R15A 1VERA 1CGWA 1X5ZA 3AS3A 1GSMA 1TQCC 4LK4A 4UAOB 4GXUN 4R96B 3VA6A 4ERSH 3S3PA 4CDGC 1QQDB 4JZJB 1KPRB 4PRHE 2HKHL 1T83A 4HC1H 1LDSA 4HXAL 3FO2A 3GMMB 4U3HA 4RX4A 4PRDB 1IM9D 4HUNB 4HBCH 4JHWL 3I3BA 3LKSA 3QSKB 5GGSY 1FVEB 1HIMH 4YZFF 4EDXA 4F15B 5HHXH 3V0VA 1VFUA 2IPUG 4PLJC 3BP4B 3VGFA 4QOKA 3QZWG 3BKJH 3C9NA 4ZODA 7FABL 3GJFA 2NY6B 2B39A 1RUKH 5DRNB 3UTPD 3ARSA 2ZSVA 1P5UA 3FO1A 4HZLB 5I1AA 2CKNA 3O6FC 4R4FL 4QRRE 1GGYA 1NCTA 2WBJD 1G7IB 2VLMD 3BKCH 3QA3A 2ADGB 4PJEB 4ZD3H 3UEZA 1K4DB 2NY3B 3T1FA 4APQA 2X4PB 1L0XA 5HGHA 3SKMA 5FYLH 12E8L 4XNZB 2DQFB 1T7VA 1EO8H 5BVPH 3BGAA 3K4ZA 4LDLB 2X89A 4X6DB 3X12B 4U6XB 4JZOB 4X4YA 4UB0L 5CJXC 5DO2C 3ARBB 4OCWL 1AGBA 3QIUB 5C0BA 4OIBA 3SY0B 1DQDH 3U9PH 4DN3H 3X3GH 3OKKA 2DQUL 3RWEB 2CKBB 1TJGL 2EDXA 4I3RH 2J12B 3SDXE 4D0DB 5KVEL 1A3LL 1BOGA 3HLAA 1G7JB 1I9RH 1AIFB 2W38A 4N1EA 3QWRA 4UILH 5EO0B 2XYCA 3KDMA 3OKNB 4PGDB 2FHFA 2DL9A 1X9QA 4WGVB 3BH9B 1UZ6E 5FUCC 4UBDD 3ZTNL 2CJUL 3AXLA 1I8IB 4MZ3A 4P5TA 1YYMH 1BAFH 3REWA 2LE9A 3VG0H 2VSCA 3FO2B 2B1AL 5E5UB 3RA7L 4IOIA 2W65A 4UT6H 1BMGA 5F7WC 1J1OH 3TNNA 3VGAC 4DKAA 4PJAA 2ZP0T 3FQNB 3QUML 5J11C 1UGNA 3PGDA 3REVA 3O6ML 3HMWL 3M17B 2R29H 4G6AC 5E6ZA 3OAYK 3L7EA 2NZ9C 4M7JL 4NKMB 4X7TA 3MUHL 3TP4A 1H3VA 3IDNB 1Z0NA 2IQAA 3GJFB 4XVTH 1MFNA 1T0PB 4JKLA 4J4PC 5HYJE 3D3VE 3BJ91 1LNUB 4PJAF 5E2UL 5EOQL 1A7RL 1OSPH 5EA0L 4PJIE 4HLZH 4A6YL 4PJ8D 3R4DA 4QRSA 1YEFH 1KTDB 1LP9A 1HN1A 3QA3B 4Y8AA 2PYED 1RZ7L 1DUZB 2PO6A 2FHCA 1JRHH 3ZTJG 4APQB 4AT6A 1V7ML 3IJHA 4MNGE 4NQXA 4U0RC 5HHPA 4GG8A 2VABB 3BD3A 1BBDH 3FONA 3FZUC 2R1XA 4UV4H 4TVSa 1NCCH 5DVNA 2V17H 2EC9T 5ALCH 4X5XA 4K9EL 1AGBB 5E7FA 1OAKL 4ZDHB 2WM0A 2P1YA 3NIFE 1JHKL 1DSFH 1UG9A 1TQBB 1EVTC 4IRJD 1FNEA 1NGQL 1HXYA 4GBXB 4EEEA 2XA3A 3STLA 3QQ4A 4CAGA 1BOGB 2R56H 2DMKA 2XQYK 2HN7A 3V2AR 4ELKB 5A1AA 3UAJC 4MLIA 4JR9H 5EIIB 1ODAA 4X6FB 3LKQA 1UB6A 2AKRB 3VGDA 1YJDL 3BFOA 5HY9B 4LU5L 3GBNL 1ONQA 1G9ML 2I9LB 3O6LH 5D2NC 3G5YA 5DVOA 2H2SC 1MFAL 4S1RH 5JIHA 1UQSB 2VXTH 4YWGH 3WYRA 4C56B 4YXHL 3TT3L 4KV5E 3GO1L 1YPZA 4J1UA 5GRJL 2YXFA 3A0OA 3MR9B 3AXLB 4FN0A 1XT5A 4PG2C 3LMJL 4K71C 3REWB 4F37F 1FLRH 4HV8A 3VWKA 5FIEA 2IPUK 1R0AH 1YDPB 2ORBH 3IRZA 5EU6A 1WBZA 2EO1A 1I7ZA 2NY5H 2IC2A 1I1AA 4S1SH 1A7OL 3ROOB 2NR6C 1FGVL 1A0QH 4KK8C 3TNNB 1RZGA 4JN2A 1PX3A 3EOBA 4PJAB 4I5BB 5KBNC 5E2WL 1Q9LB 3UTOA 5EC2A 1FFPB 1D5BB 3PGDB 1UWGH 3REVB 3TJHC 3W5NA 4CN6A 1T2XA 1DL7H 1AGDB 1U42A 2HVJA 1MCOL 2LTQC 3TO4B 5GZNC 2QQKL 1CLZL 1O0VA 1QO3B 4CN4A 5CEZD 3QHFL 3VXQA 3NMEA 3FT3A 1OAYH 1HSBA 4FQIH 3MV7E 5FK9B 2QJDA 1QZ1A 3QFJD 1KCVH 3ZDYF 1CDCA 5TGBA 1MVUA 1Y6KR 1RHFA 2PW1A 4DCQB 1C5CL 2DWDB 5FFLA 2DQDL 4WUKH 3HC3H 4RMWA 3JSSA 3VXSA 4Y2DA 5KAQF 1UEMA 1TMCB 4AT6B 3HMXL 5GSRB 3EYSH 4O2FA 5FUZL 3SPVA 4HWBL 3V5DA 5IVOA 2R1XB 5DYOA 1WBXA 1YEIL 4JFFB 4JDZB 1XF5B 1XFPA 4M6NL 5F7EH 2GUOA 2N7AA 3HRZA 1QRND 1YEKL 4CVZA 3QPQC 8CGTA 1FHGA 1NUNB 2IANE 3NFPB 3U36A 2Q86B 3HA0A 1SY6H 3SDAD 3O3AA 5I6XC 5LWYH 2GY7B 4KUZL 1EHAA 1XF4A 5F44A 1FNEB 1II4E 2OP4H 5HGBA 1T20A 4L3CB 1IEHA 4M6MH 3QQ4B 4ZAKD 1JUFB 3RZCD 4KMTH 4M48H 2ESVB 3HE7D 3D39E 1P1ZB 4QRQA 4ZUSB 1UKTA 3K80A 1A21A 1CD8A 1AXIB 1ONQB 1KLUA 4KRPD 4NWUH 2OLDA 3QP3A 4AH2A 2VLRB 1BZ7A 3SCMD 4D9RD 3MJ8A 3L6FB 1KCKA 4YE4L 3UDWA 5D72H 5ELIA 5CGYD 4P46A 5C0CA 3U4EB 3EIFA 5DD0L 1SMAA 1TDQA 3VMNA 1AR1D 2EKJA 4HV8B 3OJMB 5IJKC 2XRAH 4YHIB 5E08L 5IBUG 1WBZB 2HTLD 3C60A 1TPXC 1T89C 2FECL 5DVMA 1HILA 1RZGB 4JN2B 3QH3B 4Z95L 3RDTA 1S7RA 2BMKB 3PG2A 3FB6B 5EC2B 1NMBL 5LQBH 1D3CA 1JPFB 2EDYA 1JTOA 3MBEA 2KQNA 4KK9D 2OR8A 1DE4B 4UT9L 1J18A 4XP5H 5GRUL 3D0LB 4R4NC 5FYKH 5DDHA 3EOTL 3MRLB 2W59A 1QFWL 3K4DA 5HHVL 3OV6A 1RULH 4PTUA 3VXQB 2E9BA 5E1AA 3TCXA 3GRWH 3IRPX 1HSBB 1ZVSA 1MWAH 2DYPA 3GSQA 4UV7L 3TGXA 3SKUD 3EO0B 4JPWH 4Y4HB 1A2YA 1PY9A 4OZIE 1U8QA 1NLDL 4Y4FA 4Y88A 5I15H 1VPOH 2QTEA 2H8PB 4GT7A 2C3GA 3QI9C 3J7HA 3H0TA 3VXUA 3NCJL 1XGQB 1S8DB 4XT1C 4RGND 4WFED 1SY6A 3RVUD 4DTGL 4CL7A 2GT9B 3DMMB 1WBXB 3C6LA 1MCKA 2X9YA 2A83A 4CVZB 5F72S 4NC0B 1NMAH 5DEGB 4YR6A 4KROB 4BUGA 5JPNA 1G9NL 3DUSA 4MYWB 3RGVB 3VE0A 4Z78B 5ABDE 1IAIH 2R0WL 3O3AB 1CBVH 5ICYA 3QXAB 1MRDL 1VEPA 4XC3L 2X40A 3BKYH 3MV9D 3KPRE 1U8KB 1WC7A 2B8OT 5D7SL 1UCBL 4KZEH 2ERJB 3NAAL 1S9YA 4RCAA 5B22A 2WINB 4JGUA 5FOBB 3TZVD 4PRHA 2AJVL 4WV1C 2YHGA 3MOAH 5AG8A 3BDYH 4WO4D 2YC1A 1DBJH 4JRXD 2V9QA 1KLUB 3U82B 4NQEB 2B1HH 5GISH 1OM3H 2PYFA 1S78D 1Z2KA 3MV8B 5FUCE 5A40E 4X6CE 2O5ZL 3WXVL 2VRAA 4JANA 2ZCKL 1BZ7B 2YWYA 1R3IH 1ORQA 5IV2A 2EDLA 1B90A 4WUUD 4NBZB 4RRPA 4HK3J 2ZSWA 3N85L 2LAAA 1AE6L 5CEYA 4NNYA 2XPGB 1CVSC 1F02I 1U6AH 3C8KA 5C07D 3MLTA 4YDVA 2DMCA 4J3WA 1KJVA 1G0XA 5KVDH 3U30B 1HILB 5J0BA 3IDXL 2EDTA 3JTTA 5F1IA 4ZTOL 5JW4R 1S7RB 2W0FA 2A6IB 1T5WA 4DKFL 4PBXA 3D85A 5F7KC 4Y5VC 1I7UA 3D0VA 4KXZI 4FXKA 3NCYS 4DQOH 3VXNA 1KCUL 3CH8A 5CP3A 2AVGA 5GGTL 5CJBA 4S1QL 3BZDA 5J6GA 3L95B 2B7DT 3TBYB 2LFGA 1MIEL 1T5XB 2DYPB 5CILH 4LMQI 3PP4H 3CCHA 5FB8A 2A2QT 3VFTA 5GS0H 5HYSB 1A2YB 1BQUA 3N9GH 3NZHH 5B3NA 1WGOA 4OFIA 5EC1A 4MDJA 1T2QL 4Y4FB 4DUVA 3FQWB 3FB5A 1QHPA 3VGBA 4MZ2A 4WNQB 4KC3B 3SDXA 5IBTH 4Q74A 4M7ZB 4WI5A 3GIZL 4YNYB 3MRFA 3C6LB 2F53E 4P2YA 1MJ7H 2I27N 3IDIB 3OGCB 4YR6B 5DD6B 3S9DB 1ED3B 2IJ0C 1BM3L 3DUSB 4YHOL 1CD1B 4BH7A 2E27L 5KW9H 4P2OA 4QCIB 1CFSA 3SDXF 1AO7E 2BVOB 3T1WA 4GW5B 3TC9A 4Z7OE 3QUXC 4Y5XB 4BFBD 4EDWH 4WIQA 1INEH 3NZ8B 4MQTB 1U9KA 2VLJE 3WHE0 5EU5A 5D2NE 1CGSH 4OD1H 3ALPA 3T04D 5I16B 1NCBL 1BD2D 4NM4L 5IHLB 1I8MA 3O8XA 3WNKA 1T66D 1X7QB 2V5YA 1UZ6F 4POUB 3VD3A 2LQRA 4L8DA 1GC1H 3RZWA 1Z9SA 1S7UA 3BO8B 4KAQL 1Q0YL 3ARDD 1IVLA 2XWBB 5EUOE 4GRMA 3JV6B 1ZAGA 3QRFM 1FV1B 3LIZH 3L9RB 4NNYB 3WO3B 3U46A 2PUQT 5HYJA 3D3VA 5ADPH 1ZLVH 1VSCA 3OKEA 1N5YL 5HDBE 3JTTB 1PG7X 4PJIA 4Z7VB 3RWFA 4G6MH 2XY2A 4X5WA 2KDGA 1F4YH 5D7LD 3S8WA 1GPOL 4RSVA 3D85B 1P2CB 1S7TA 1MWAB 3WUZA 1TZIA 4JCLA 3L5XH 3BZEA 3VXNB 1EAPA 3WFCH 5KVGL 2C4XA 4MNGA 2E9JA 3E2HB 2I24N 1N0XL 3VWJA 5E2JA 4PJIF 4LSRL 3GIVA 3PWJB 3X3FH 4YHPA 4H25B 4POZC 3DI3B 5JW5A 4GKNB 1BECA 3CCHB 3CVHL 3Q6FA 4MX7B 4P4KB 2BHYA 3VXOA 1N64L 1P84J 4O58L 1ACYL 1TCRB 4HH9A 5I76A 3IFOA 4RBPK 2E6JA 4KUCF 5IMOA 1FNGB 1Z9LA 2VDKH 3P9WB 1AH1A 5B8CB 1TVHA 4ZSOE 2EKSB 3PJSA 5D6CB 1XGYH 1ZT1B 1EVUA 3GHBH 4OLUH 4Y5YB 1N5AA 1OAZL 1I3GL 4YDKH 3ARXA 3CD4A 3WFBL 3UTZA 5I0ZA 4ZO7A 4O51A 3TEUA 4EI5C 4LP5A 1XR9B 1LO3H 3EJJX 2OJZH 3OB0H 5L8JB 2J8OA 4P2OB 3OAUH 2O5XL 3RIAK 4OCMC 4N8PA 3IDJA 2XFXA 1DVFD 4U1SA 3BSZH 3HC0B 1IGFH 3V4PL 4AG4H 5BV7L 3NIGE 2H32H 5EOTA 2MQ3A 1IFHH 5EU5B 4PGJA 4PFEA 1W0YT 1ZT4B 1K5NA 3WL9B 5A2JH 2RFXA 1EHLH 1KEMH 2F58H 3C09C 3EZ8A 3D18A 1CXKA 2HJKB 3VXMD 1X6NA 3E8UL 4P2QD 5DMKA 2C3XA 3OR6B 1KTLA 3A67H 3IXAB 4KQ4H 5CLWA 2X4UB 4G5ZL 2Z92A 2A73A 2VQTA 5JORA 4J7RA 4OV5A 4GRMB 1PD6A 4PGBA 5IVNA 4UI2A 1FFNA 4CU6A 3FOLA 2DD8H 2E7LA 3GSOA 2F8XC 2YUZA 3OKLB 5DFWH 1G6RL 4G8GE 1U8LB 4M5YL 3G5XA 3MV7A 4PJIB 4O00A 4ODSH 2AEPL 1EEZB 3ZKNC 1UYWL 4L4TE 2MCPL 1S7TB 1NCDL 1KJMA 5TE4H 2FNBA 1PG7W 5E8OA 1NUGA 2D7QA 4PRNA 4FQXD 1MNUH 1AGCB 3U2SB 1EUUA 4X4ME 1JZ5A 3WNMA 4WFFD 3LEVH 2GSIA 1TZHA 1RFDL 4CJ0A 3WHE1 1N3NB 1BIIB 1R3HA 2NY4C 5C71A 4XP6L 4YK4C 3RVWD 5JW5B 2DKMA 3Q6FB 1U8JA 2E6PA 4YXKL 3VXOB 4HH9B 2IANA 3VFVA 5M95B 3NVQA 2E7HA 1T1XA 4KTEL 1KYOK 1ETZA 4OQTA 4XBPA 3PJSB 2BK8A 1A7BA 2Z31C 4NYLA 3G04A 5EU7E 2R2HB 15C8L 3QEQE 4P5MA 1CICA 3D39A 4BZ1H 1BEYL 5KJRL 4R7NB 1PG7H 4FQHA 2P4AB 5JHLL 2OI9C 5BS0D 5LGJA 3SDCD 3B2VL 4XPBL 2W0KA 4O51B 3EJZD 4D0BA 2DLHA 5IEKB 3SE9H 1HINL 2VDQH 2QADC 3IDJB 3WUWG 2DDQH 2XFXB 4WU5B 3BI9X 4XB8A 3I2CL 2VDML 2DQGH 1BF2A 1HYRC 4GRLD 3W39A 5EOTB 1Z0MA 4QRUA 4LRIC 2FJFB 1IKFL 4TUKL 3EO1B 4AENB 5IESH 1YEGL 3LSOA 4QRPD 4NQVB 4RISL 4C58B 2WW8A 3BGMA 2AJYH 3JV4A 3FCTB 4LEOB 1K5NB 3VW3L 4WGWB 4LMQE 3CH1A 3U48A 1MFCL 3D18B 4M9PA 4PS4L 3NH7L 5IG7A 4FQQA 3C6SA 4KDVA 4G6KH 4OCYH 2X1XR 3PWNB 2Z92B