2IBGA

Crystal structure of hedgehog bound to the fniii domains of ihog
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
STYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CG9211-PA
publication title Structure of a heparin-dependent complex of Hedgehog and Ihog.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 44
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ibgA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ibgA02
1UENA 5I8KL 2AERT 3LDBB 1P4BH 1BIIA 3MV9E 3R06B 1KIRA 2OL3L 2CXKA 3ARDA 3EBAA 1T80A 1BOGB 1FYHB 1XF1A 3K4AA 4KKBC 3V6BR 3NIDE 5DFVC 5EG6C 35C8L 1OP3K 4HIEA 1CD8A 4M7LL 4G6FB 5KTEH 2GTZB 4FFVC 3UJTL 1HIMH 4L9LB 4XVUC 2P5WA 3SKMB 5JZ7D 1TETL 2UZIH 1JRHI 3TYGL 3U7WL 4WEMB 3VG0L 1KB5L 2P8LB 3UC0L 1C5CL 2OBGA 2ZG1A 2B8OT 3QT2A 1HILA 4LSUH 4NKOA 4LKCB 4LQFH 3GZKA 3HPJA 5SX5H 3BSZL 4H25B 3BP4A 2FEEL 1SYVA 1CFQA 3MUZ1 5GJSH 1HH9B 4HCRH 1SJEA 2I07A 4EUPA 3SO5A 4QRRA 5L6YH 3DXAD 4ETQA 1RZ8A 2DM4A 2HTKD 7FABL 3BUYB 3DPBA 3R8BB 4WU5B 3FOLB 3BKML 3R0MA 4HS6B 4I48B 5CJXC 3O9WB 2EYRA 4RSVA 1MJJA 4ZSOE 3BPNB 3TO4C 3QXDA 3QDAA 3KLAB 3LKQB 3MREB 4HC1H 3JWDL 2IBGA 1H3GA 3NPSB 1HXYB 2R9HD 3AMKA 4UDTA 5TH2B 4KC3B 3U6RA 1TNNA 4ZAKC 4U7SA 4YHMH 1BBJB 4XP9L 4KRNA 1YQVH 5BZWB 5ICXB 5A43C 5GJTL 2ICEB 3C5SA 4Q0XL 2V9TA 4FNLH 5L8JB 1JYNA 1WBXB 3C2AL 1INDL 1S5HB 3PABB 4B0MM 1QBBA 1DBKL 3H9SB 2FD6L 1B6DA 3NCJH 2XI9A 1T3FB 4P2RA 5JR1H 2WUBH 3DLQR 3QIUD 3RTQB 2AV7A 1DQLL 3DSFL 4B50A 5ETUB 4HV8A 2W0FA 1OTSD 4AENB 4EI5D 1KB9K 1KTLB 2FB4H 4FXKB 4MQSB 4PRPB 2NX5D 3GSNB 1VACA 1QA9B 3QQ9D 4LAJH 1CTOA 1XIWA 3DX9B 4LPVA 5EO9A 4MJID 4U0QB 4OF5A 3D0LA 4DJMA 4NPYB 2BJML 3L3OA 2VDKH 1AKJA 3CFDA 4H1LB 3G5VA 4M7KL 4F9PA 4K8RD 1FQ9C 2FATH 1F11B 4BELD 1IC7H 4XPBH 3F6LA 3TO2A 1KPUB 3EOTL 2NY2C 4JHAL 4HT1L 4BSWB 5ADPL 4JPWL 2P24B 4NZJA 1WAAE 1RAMA 3G6JB 5A16A 3HC3L 3L5IA 5CKGA 3ES6B 1WFOA 2VLRE 1KCLA 4P46C 3ZO0A 1CK0H 1A3QA 1FNEA 5ENWA 4FFZL 5CJBA 5TE6L 2IH3A 2DMCA 1IM9D 2HT2C 4R2GB 2VWEE 1CGUA 3CUPA 3SDYL 1IGFH 3BT2H 4X6EB 3WL9A 4RBPK 2VZ3A 4OLUL 1NFKA 1NANI 4OI7A 3TVMA 4M6AA 4MQXD 3MBEC 4CKVX 2PF6A 4PREA 2JK5A 1WZKA 3D3VB 4JN2A 4MNHA 1RZ7L 2ZSWB 4GJTB 4AEHL 2JB6B 1G7QA 4K7PL 1SYSA 4GRWF 3ARSA 3E6HB 4JZJC 3GIZH 3STLB 5J12C 4P4RB 4XCNB 3HI1B 1N8ZA 3FN9A 1MQ8A 1U9KA 2IQ9H 4P5MA 2EXWD 3OPZH 4CUCA 2VXVL 4F80A 4NQDD 1V3JA 3QP3A 4HKBB 4A6YB 3ULUD 3BIKB 1A7QH 3P0GB 1DVFC 4OCSL 3GHEH 4MXWH 5FF6B 2BVPB 4OM0L 1UXSA 2DQJL 2XQBH 1X5FA 5J6HA 3TJHD 1NL0H 3UAJC 5BV7C 3VRLF 2V5MA 1HHHA 5C0RL 3ZKXC 5MEQA 4RAUB 2MNUA 3MX0A 3D48R 3NTCL 1Z0MA 1H3TA 3AREB 5JPMB 4HWEH 4YJZL 3OAZK 3QIWC 4LLMA 3CFKA 4GRMB 4IRJD 4JREC 5DC9B 3QIBB 2ZCHH 1RV6X 5EU3A 4Z5RA 2YKLL 1QP1A 3MJ9H 4LCYA 1HSAB 2A74B 1WISA 1ZSDA 2M2DA 3K7UA 1Q0XH 3I75A 3QH3B 3VFWA 1OQOA 2X4UB 1UM5L 3NFNB 5IQ9B 4G8IA 2DN7A 3T09A 3WS6A 3P9MA 4FTVA 5BVPH 5C08E 3VG9C 4D94A 5EUKB 5F9DC 5C0BA 2NW3A 1J8HE 4U2YA 4Q6IA 1MCIA 1XCQB 2P7TA 1T5WB 1ZWIB 1MY5A 5TGBB 5ERWA 4URTB 2EC8A 5F89B 2BMKB 2Z9TA 3GMPA 5IWLA 1Z9MA 1CFVH 4XBEH 3DYPA 4HIXL 3ESVF 5C0AD 1G6RB 3WXVH 1PVHA 2VOTA 1JNNH 5F6HJ 2Q7YA 2J8HA 1HQ4A 5FKPB 4GQ9H 3BP7A 1J10A 1YUHB 4UOW1 4ZSOB 2ZOKB 3TT3L 3RDTA 4XNXL 1J9CT 2I24N 1U95A 4AH2A 2YBRA 1ES0A 2LTQB 5ESQA 1DP0A 4BUGA 1KT2A 1CU4H 5IB4B 4JO3H 4UOJA 1KIQB 4KDTA 5F6HI 4OD3H 1U8KA 2GJ6A 1QEWB 4OZFA 5DUML 3D1MC 4RMSA 1S3KL 1WWBX 3WLWC 4QO1A 4TOYH 4V1DD 5F7EH 4Q6YA 2EXYD 2R0KL 4PRNA 4Z77A 1U3HB 2ZKHH 3SDXF 1C16B 1OGAA 1CL7I 4XRCB 3EYQD 2QEJA 2G60L 3T3PE 3QUMB 5CKAA 1MEXH 2PNDA 5EORL 5DMKA 3BWAB 4U49A 1SBSL 2AK1H 4Y8AA 1FNGA 4Z7WA 2NY5C 2OYPA 1CLZL 43C9A 4FQHA 3RGVB 4I77L 3F7RA 4UINH 3QPQC 5CINL 1T66C 3VCLB 4CU7A 2IANE 2NLJA 4IRZL 1F5WA 3SGDI 4LHQB 3OAYK 3HHRB 2YD3A 4ZYKA 4OBRA 4B53A 3LEXA 5F72S 4MVBC 4G7YH 2COQA 3V9FA 3AAZA 3FO2A 1J05B 1MRFH 3UEZA 3CFBA 1QFWH 3DUHA 3DV6A 3UTTD 3ULVC 1H8SA 1OP5K 4NZDA 3ORJA 4PJBE 4PUBL 4TULL 3G6DL 4JRWA 5EUOA 5C9JA 1V7NL 5TJWK 1BZ7A 3JWNC 4XMLL 4L29B 4M5YH 3V6ZB 3VXUE 1FC2D 1KULA 1GGTA 2Z8VC 5ADOH 3U1SL 5IBLD 2IPUG 3AM8A 3FCTA 2DTMH 3D0VB 4NQVB 3RX5A 3BMVA 1U8PB 5DD3L 5D2NC 1TDQA 1MCOH 5CEYB 1E6OH 1BEYL 1TQCC 3KLHD 3GGWB 4JO1L 2X4PA 3GSXB 5HYEA 3TT1H 1U3YA 3L9RB 4ZTPH 1LDSA 1RZGA 6FABL 5ELIA 3BPOB 4J6RL 2HMIC 2PO6A 3QUYD 3D39E 2D0GA 4GKZB 4I3GA 3T65A 1N2RA 3O6FC 4ODWA 3QZWG 1QSFA 1N4XH 3WNMA 4NN5C 1YY9D 3UTSE 4P23A 1WWWX 4CU6A 1N0XH 2XKUA 2NNAA 3A6BL 1U8MB 3IDNA 4P2OB 5EPMB 3WLBB 5SWZE 4S1SH 4GAFB 5A2LH 2J6EA 3SKUD 5JZ7C 3C09C 5DJ8A 2PYFB 3RWHB 5EFIB 1D5IL 2Z4QB 2D03H 3WNPA 1I7RA 4YGAB 5GGRY 5L0QC 1OW0C 2JJUA 2VZOA 3NIGF 3CFEB 1RMFH 4XCYA 1ORQA 3P73A 4JM2C 2GTWB 1E4KA 5FUOH 3Q6FB 4XP1L 4GAJL 3ZHLA 2W65A 3OKKA 5E4EC 5I1KL 2DYPD 3OR6A 2R8SL 1YNKH 4X99B 4UNVA 3QUKA 1HHJB 3RVVD 1JYXA 3WFHA 1YNLL 2ADJB 5H35A 1XGPA 1HSBB 1NGZB 1WEJH 2NY0D 3R0NA 1NGPL 1YNTB 2IH1B 4M00A 5C08B 3GEWB 5H8DA 2LV4A 4NQEE 1J8HB 2BVQA 2J5LC 3GBNL 1NMAH 3R1GL 1QVOB 2EC9U 1ZTXH 2PW1A 2BSTA 4U3XA 4KJYB 2HFEA 3VDBA 2OSLB 4WTZG 4ACPA 1YEJH 2H6PA 3P4MB 2WSKA 4POUB 3QUXA 2R9HC 4FQCL 5FO7B 5E2JA 2BNQA 1E27B 2ILLA 1FLRL 3OKNA 2IGFL 4KMTH 1OARL 4WENB 3B5HA 1DBBH 4P3DB 1BQLH 4DQOH 3TESA 1G7JB 4JR9H 1YEEL 1MFDL 1T2QL 4U1MB 3UPAA 3BE1H 2D9CA 1JJUA 2AABH 2X4SB 2MCPH 3U0PA 1C7SA 2D7TH 4G9DA 5KANI 3EOBA 3MJ7B 3DVNA 1MFBL 5DQDH 4OUOA 2EDRA 2C9AA 1OTSC 1FZMA 3ROOA 2ED7A 2IPKB 1IT9H 4JFDE 1RJYA 4QF1B 1JWMB 1Z3GL 5E95B 1U8HA 1Q9LB 3QQ9C 1X6LA 2JB5H 4UT6H 1EV2E 3LQAL 1A3RL 1QQDB 3GO1L 3IETA 4HHAA 4WJ5A 4OZ4A 3N9GL 3MRGB 3TZVD 2XN9A 4PRPD 4U3HA 4P59H 3GMRB 5F7HA 2HLFC 1KG0B 5EZLA 3RIAK 4AK1A 4K8RC 3EZ8A 4CNIA 1ZT4A 2PYEE 3QJHA 3PE9A 1E0OB 2OP4H 1U58B 2LAAA 4XNYH 2XA8H 2UY6A 2YPKB 5BXFA 2IBBA 7CGTA 4NWUH 1FNSH 4NQCE 3QEUB 3ZT6A 2AEQL 3IFOA 1MIMH 2IANB 1MRCH 5ID0A 1QD0A 1MCPL 4CJ1A 5D9SA 1G7PB 1W8OA 2IJ0C 3SDAC 5D1XD 4PJAF 3VA6A 3T3ME 2OR7A 2R0WL 3KYAA 5DQ9A 3HTLX 4H20L 1T1XA 5DD6B 3UYRL 2X9XA 3DWTA 3EIFA 4I1NB 5IFAH 3LKOB 2EH7H 4PJBB 3CSPA 4X7SL 3SKJL 1QBLH 1I9JL 2H2PC 1KCUL 2J12B 3I6LE 5JXAL 4MJ2A 3QUZA 3SKNA 3MV11 2Q8BH 1RJCA 2E8YA 3MTRA 4G6AC 1FAIH 4R2GD 4HFUL 4HS8L 3VXUB 2GSGB 4ODXA 3C60D 1BVKA 4CVUA 4JAMA 3VXRA 4LGRB 3X11A 1AE6H 4GG6A 1NCCH 2Y4SA 1NC4B 2J4WL 5KVFH 3P40A 3D3VD 1SM3H 2EXWC 1GGCH 4Y4FD 1Z5LA 1CFNA 3HR5A 1ZLVK 3KNBB 2FNBA 4LCWE 4LHJB 2Q6WB 4PJCE 3BH9B 5JPNA 3C6LB 4RFOH 2HJFA 3U30B 2QQLH 3D39B 3VD7A 4CDHA 4HIIA 4QWWD 4Z78B 2VZTA 1CWVA 1T1YB 1IEAB 1A7PH 3ARPA 4HX1A 5F44A 4NNXB 3UTSB 4MJ4A 4W6YB 1H5BB 1IM3A 1B90A 4HPOH 5SWZB 2R2BB 2HJKB 4KZDL 4QRTA 1QRNA 1VEPA 4NDMB 3MV9D 5AAMA 3X3GL 4IRJC 2R1YA 5SV3A 5GGUA 4LU5H 4FQ1H 4L8CB 5D6CA 3O3BB 5D2LA 1NCAL 3WN5C 1NEZG 3VWJA 3BZEA 1S7VB 4O4YL 4MSWB 4N1HB 3OKEB 1DN0A 1CXIA 4LPUA 1ND0B 1KOAA 3DI2B 4GS7B 5DRZA 5K33A 5I1AB 4W4OC 5EBMA 3RIFF 5EU7C 1DBJH 2XWJA 3PGFL 5DJDB 5E1HB 4TUOB 1F6AA 5EOQL 5J1SC 1IGIL 2ZUTA 5FOJA 4HUXA 2CUHA 3MRNA 3ZE1F 3CLFL 1RUPH 2QQKL 4Y4HD 3NBNA 4XC3H 4NQEB 5I9QB 1JHTA 1AFVH 4WV1A 1Z9LA 1I85C 4ODHH 2R2CA 2OS7A 1PEZA 3PHOB 3EJJX 3SDDD 5BJTA 3IDIA 3T0EA 1BJMA 1P4BL 5E0QA 3CLEH 1GHFL 4E5XB 3SDCA 2FECI 4NJ9H 3QDME 3P9WB 2CMRH 3UBXG 4OFVA 4JFEA 5EB9A 1JZ8A 1HIML 4OZGE 3OJVC 4RAHA 2UZIL 1F2XK 3VXOB 3RQ3A 1G1YA 1FL3B 5ICZB 1J1XH 3DRTB 2DIJA 5I2IB 5H37G 3SPVB 4LSUL 3H3KA 1QFUL 4PJEF 4LVNB 1A6AB 3EYQC 3DJ9A 1ORSA 2O61A 3VXNA 4S2SA 5JO5B 3TNNB 1WZMA 2AJVL 4ZG1A 5JLZA 3ZZ1A 1RK0A 4R4ND 3GSRB 4MNGA 5GJSL 3R8QA 5HHOA 1U3HD 1W0VB 5HGBA 1KFAL 4HCRL 4DVRL 1XF4B 2F5AH 4PS4H 2CKNA 1IKNC 3LN4A 5GZNC 1VEOA 4UDUA 5CJ8A 4OCWH 1T20A 5BS0E 5SWQB 4MNQA 2XZZA 3O3DA 1UACH 5T3XH 3WS3B 5CBEA 3K4DA 4KKCC 1UH2A 1FN4A 2PYEB 5DSCA 1NBZA 5HI3C 3T4YB 4OF8A 4NQCB 4X6FB 4KI5F 5T1LA 2VQTA 4Z7WF 2NTFA 4HDIA 1KCVH 1C5DA 4G43A 4F7MA 5MHSE 1FPTL 1IC5L 4YHML 1CICD 3KPSA 5FK9A 1YQVL 4LSVH 5E99H 3P4NA 3NCYP 4YE4H 5DC0A 4OUUA 3CC5A 3Q48A 4FNLL 4LSPL 2CIIA 1JWUB 1UFUA 3W9EA 4MJ6B 4EDWL 1BLNB 4ZXBB 3NCJL 2VLRD 3QHZH 5JR1L 5IFJB 2WUBL 5E2VH 3ARBC 2XY1A 4LSDA 3VE0B 2WUCH 2SEBA 2FB4L 2ADIB 1BF2A 2B7DT 4ZFGH 2CDFA 1AGFB 5EUOF 5KSAC 2E27H 3Q0HA 1A3LH 4XP5H 5HGGS 2DQDH 1EHNA 3B9KA 4KJWD 1LO5B 1BFOB 4C83B 1EGJA 2W60A 3QUYC 3IF1B 4P48A 5FB8B 3W39B 3QO1A 4LFHG 2VDKL 4MLIA 4MJ5B 4FQQA 5CEZD 4XX1E 1NEZB 3S3JA 2AJYL 4HLZG 4LLQB 2VN7A 3DGCR 3S35L 2FATL 4DTGH 4LCWB 1MFEH 4PJCB 3U9UB 1IC7L 4XPBL 2P43B 1G9NH 4MA7H 3OKLB 3KR3H 1T22A 4NO0B 4S1RH 3RX7A 3HZVA 1QFHA 2X40A 3G6AA 1RZKH 1EFQA 2AAVA 2G75A 2J88H 4W81A 3ECBA 3IJSA 1JTPA 3BD3A 5CP7B 1BECA 4Z95H 3KPNB 5ACLA 1IGTB 3IKCA 1CK0L 3RL2A 43CAB 5H94B 4F58H 2UWEA 4XMKH 1M71B 4DN4L 3PWVB 5JW3L 4O2EA 1HNGA 3HKFA 1E4XI 3FB8B 2XNAA 4OSUH 4XX1G 3H2WA 3BT2L 4LKXA 4KPHL 3U9PH 4NRZA 3SGKC 4K3EH 2CLZA 1A2YA 3OGCB 2LAGB 2IQAA 1F4WH 4HUVB 3EO0B 5JDSB 2X70B 1LE5A 5HJ3B 3WDIA 3UBXB 1VA9A 3PWNA 5HHNA 3WHE0 2QKIA 3GIZL 3LD8C 4JDTH 4HBQA 4KHTL 5E08L 3V5DA 1HOCA 4HBCL 4HEME 3HZMA 5C08D 3OPZL 4KZEH 5JW5B 4MZ3A 1J8HD 3IXTA 2NY3B 1OTUD 3KS0H 3CDGA 3GKWH 4UU9A 4Y5YA 3HI6H 4CVWA 3GHEL 4MXWL 3BXNB 1JGVH 2XQBL 2CRYA 4WGWB 4LLWA 1NL0L 2GQHA 3MV7E 1QLFB 3NPSC 4PGCB 1LILA 4PJHA 5LBSH 3WFBH 1GZPA 2R56H 1PLGH 3VXTB 3QDMB 5FA4A 5FYJU 2G5BA 1FNHA 1I3RA 1NMCB 2NXZD 3IAPA 4HWEL 3VFNA 5F96H 1XGUA 4OZGB 3V2AR 2ZCHL 1NFDB 3KPMB 1VDGA 5IF0B 3GMLA 1SJVA 2H9GB 4HK0B 3C8DA 4I2XA 3RTQC 2JCCA 4FQXA 1NC2B 1Q0XL 1R3LA 3WIFB 4PJ8A 1UXWA 5E6ZA 1JTOA 2CDEB 1GGYA 3QDJA 1A7NH 1D7FA 1MCKA 3L6FA 3ILPA 4KXZH 3TZVC 4MB3A 4DK6A 4Z8FL 4IRSD 5F88A 4P5TD 4FZEH 4CMHB 1QLRB 1WIUA 1CFVL 4XBEL 1KACB 2X4TA 3HUJA 1KEML 2YEZB 4I0PA 1YEIH 1T2XA 5BS0B 4JJHA 5LCVH 2BNRD 4RNRB 5D7IF 4OI8A 1EH9A 1MHCB 2VL5A 5T5NF 3QO0B 2ICWJ 4XNUL 2Y36H 2EDJA 3E6FB 1ACYH 2DBLL 3VRJB 2IAND 2DF3A 4S1QL 3P3YA 1CU4L 4I5BA 2GT9A 3MJGX 5HHMD 5HGDB 5FCUH 3AUVA 1H3XA 4Y19D 1I9RL 4EIZC 1QNZL 3NAAH 3K3QA 1YMMA 4R2GC 5E70A 3GJFH 3O2VL 1W72B 2ICWI 4AIZA 3J7HA 5F7EL 3GK8H 1F2QA 5K9QI 2ZKHL 3ARRA 5JMOC 4C58B 2ITCA 2YD5A 4X6CA 4HG4J 1MEXL 3BP4B 5FGSA 5C0BE 4KDVA 2AK1L 2H32H 4UIMB 1L6ZA 2LE9A 5C1MB 5INDA 1NC4D 2I07B 2YMXH 4OT1L 3O41A 1NUNB 5E6IA 5CZVH 1RZ8B 4MAYA 1SY6A 4I13B 3NCMA 2BSRA 1FIEA 1IGYB 1GAFH 2EYRB 3HAEH 4G9FE 3C6LD 4L3EE 3L3KB 5I76A 4GG6F 4CN1A 3D39D 1ZLUH 4R97B 1KGCE 1S9VA 2VKWA 1I1YB 1QBAA 3VFUA 1MRFL 4X6BA 5EBGA 4RGOH 1QFWL 1J0KA 5KN5B 1EEZB 3Q6GH 4J3VA 2YXMA 5DK0A 1I9IH 3EOAA 1FV1B 3B5GA 1KJVA 2A9NH 2EIDA 1M4KA 3HMWH 5B8CA 2ZNXA 1I1AD 2C1PA 3AREC 5K93A 4M8QB 4I18B 1D9KD 1CGSH 1HDMA 1SVCP 3FFCD 1R5VB 4M5YL 2VLJA 2P8MB 3FB6B 3TFKD 3WDJA 3SGEI 5FYJH 5J6GB 3FQRA 4RAVA 5GRVL 1S7QB 2P4AB 4ZDHA 1G9MC 2WWKT 1UWGH 1FG2A 4LVOB 2Y7QA 3REVB 1AY1H 1NAMA 4WI3A 1OGAE 3BUTA 4YHLH 4WDIB 1E6OL 1ROWA 4WI5A 1QBMH 1JP5A 3TT1L 2V5YA 4ZFOL 3VGEA 1I1RA 3EDDA 2D4DA 4JFPA 2F5BH 2G9HB 1A1MB 3G5YA 4ZOEA 5C0NC 3MRQA 3RUGF 2VISB 1MHHB 1U6AH 1AKJB 4QHKJ 1WTGT 4OZFG 3H0TA 1N4XL 4TVPE 4W6WB 1UZ8A 4X7DC 3VFRB 4HQQH 1N0XL 2E7LA 4AG4H 3HG1A 5IMMA 1WBYB 1EVTC 4S1SL 4NM4L 3MV7B 4PD4J 2LTQC 4OLVH 2LVEA 5T3ZH 5CJ5A 4PV9A 1X6NA 5BRZD 1BD2A 5J8OA 2VABB 3TH3T 5KJRH 1MJ8L 2D03L 3F5WA 5IW1A 1R5WB 5C07A 2BRRL 5EUOE 4QHKI 3GSVA 3MNVA 1RMFL 4JFOA 3RI5K 2OMNA 2IH3B 1EZVY 5FUOL 1OP3H 5F1NB 2FYYA 4IHOA 4YFDB 1YNKL 4JQIH 1MF2H 3CUPB 4MXVE 2HWZL 1BFTA 4R4NC 4XHJD 3WJLC 3WL9B 1U3HC 2BC4B 4BQ9A 5FECB 1I7ZA 1WEJL 2NY4D 4JFDD 3RWEB 4GXVH 4TPRH 4DZ8B 4DN3H 4PTUB 4PREB 2JK5B 4R26L 4XPHH 2NYYD 3NGBB 4JN2B 4MNHB 4NCC2 2VXTH 5DD5L 1IGML 1JF6A 1NMAL 4RQQB 5D6DA 2AQ2A 1ZTXL 1RIVH 1IZJA 3OF6D 4Y4KA 1RPQA 4R96A 1OY3B 1OSZA 3G5XA 2A6KA 3O3UN 5HYFA 1P7KA 1LO2H 12E8L 2PYED 3GMOB 5HHPA 4K7PX 3X13B 1D5MB 3BQUA 4UQ2B 1S7WA 1X5AA 1ZS8A 4KMTL 2V2WA 1AXSB 1DBBL 5CMAB 3WNNA 1BQLL 3DROA 1UXSB 4JR9L 3KPOA 1TXKA 5J6HB 1DQQA 4R4FH 1BVLB 4F3FB 3KLSA 4OFPA 5L2KA 1S7TB 2K3TA 3BE1L 4ODSH 2OK0L 4BQBA 1V3KA 2YA0A 2MCPL 5HYIA 2D7TL 2RIKA 2RR3A 1KCKA 5DQDL 1W8NA 2VERN 1AO7D 5CSBA 1IT9L 2VWEC 3CFKB 2P44B 4JRYA 4L9DA 5TQ0L 2JB5L 2KBGA 5INCB 4HAGA 1IL1B 4WW2B 3I6LD 5FUZH 4OGAD 4JY4B 4ZPVA 3VWKB 4P2YA 3UZVB 4YXKH 2DL2A 3TA3A 5I1LA 1MCBA 3BRDA 4P59L 3OKMA 2OI9B 4M3KB 4DGVH 5EC1B 5C0BB 3H9YA 3GSQB 1KBGH 2OP4L 3BPOC 3BHBA 2XA8L 5AWNH 5ESVB 4MAUH 4DKFL 3MCLL 4YFEA 4H5SB 1MIML 1MRCL 4JG0H 5IT2H 1K2DA 5IKCA 3VU2A 1HQ4B 1F3JB 5JIKA 3BP7B 4G9FB 4L3EB 4FXLA 1ZLWK 3PWUB 1WK0A 2XFXB 4P2OC 3RDTB 4PP1D 1EUUA 4ZNCD 3BMWA 2VQ1B 4Q58C 3TNMB 3JV6B 1U95B 3BPLB 4K3DH 4AH2B 5GGRA 3CDCA 2YBRB 4Z7VE 1ES0B 2XKNB 2CKBH 3DURB 2EH7L 3MRBA 4Y0GA 2M1KA 2IPUK 1RURH 4D9QD 3ZKND 3BRGC 3KYMB 3FKUS 1NCNA 2Q8BL 5E8DH 1U8KB 1FAIL 4M1GH 5B3NA 3DV4B 3TBYB 5TDOB 3EW3B 3U2SA 5ECJE 3B6SB 2UWEF 4ZPTB 1RK1B 2ED8A 1AE6L 4KK6D 1NCCL 2NPLX 3WIHA 4OLZH 4J4PA 5HDOA 1OGAB 4RBPH 1SM3L 4WWKD 3TBVB 1BHGA 1GGCL 2QQQA 5DMKB 3FRUB 1CGWA 4RFOL 2Q87A 2QQLL 4KRPD 5J7CC 5DK3A 4HIHA 3GMQA 3MRHA 1A7PL 4WI6A 4PGDB 3LEXB 4RGND 1CZ8H 1KJMA 3WUWG 2KDGA 4HXAL 4PB0L 4HPOL 2EO1A 1E4JA 1PX3A 1Y18B 4Z7UE 3FRPA 5EU4A 2F74A 4HWNA 1VADA 3DV6B 4LU5L 1NSNH 1Z6JT 4FQ1L 4MQTB 4OKVA 2NY5H 4BJLA 2FR4B 2HTLD 4LIQH 5CLTA 3O0RH 4HKXB 4PJHF 2VJXA 4NP4L 2IAMA 5IB1B 1NGQH 4LL9A 4IRSC 4HFWA 2CLVB 4DUVA 3OAZH 1TTUA 2GAZA 3K1KC 3MODH 3VXRE 4GUPA 3ULVH 1T89A 5ALCH 1CE6B 4XC3L 1L4IA 2JCCF 3A67H 5A2FA 1AFVL 2YSSA 2Z31D 2WP3O 4ODHL 2X4PB 4UTBH 2NW2B 3HZYB 2MPAH 2PO6B 5I1IH 3EGSB 3IRZA 5BS0D 1JFQH 4NKMB 3CLEL 2I26N 3RHWK 1QYGH 5D4QA 5HYJD 5DRXA 2EKSA 4IJ3B 4HEPG 3B4NA 3GSOB 4D0BA 4XMPL 1FDLH 4YHKH 5KS9E 3LH2H 3IDNB 3TIEA 2ZUVA 2AKRA 1QRNE 2GJZA 2EEBA 5T1KA 1JGEB 3ARDD 2QV2A 2D3VA 5MHSD 5E8PA 3RWJB 2E6PA 1M6OA 1J1XL 5D2LE 8FABA 1Y6KR 3QNYA 1ITBB 3U4EA 3LV3B 5GS0D 1T0MA 4P9HC 4ALAL 3VD4A 4OQTH 3WHXB 2P5WD 4YDJA 4X83A 4FP8H 4RX4D 4X98A 3KPLA 2BCKB 3OKKB 1MVFA 3OR6B 1U8OA 4XNZB 4EDXB 1XCTA 3VDCA 4M6NH 1IAII 4PS4L 1LNUA 3V6FA 1CGXA 3U4AA 2DQFA 4GH7B 4OCWL 5FCSH 1AH1A 5C0IA 3VH8B 5JTWA 1UACL 5T3XL 4M93B 1MREL 3C6LC 4L8BA 1T1WA 2BSTB 4QRRD 3JBG7 3T0EE 3VMPA 2AJ3B 1X7QB 2H6PB 3SE4A 4AJ0A 2UVEA 3QBTB 3QUXB 1KCVL 5CJQL 2QL1A 3GDBA 2ZPKH 3L5XH 1SQ2N 2AK4E 5FOBA 2AGJL 3OXRA 4PJDA 5FAAA 2PXYA 4LSVL 3U0TB 2H41A 2MQ0A 3OAYH 3SCMA 1D9KC 2D4FA 2C3GA 4POZD 1ZEAH 3L95A 1S9XA 4Z7VB 3WJJA 4KTDL 5D1ZA 3TFKC 4TSBH 3QHZL 5D1QA 1MWAL 1BQHA 1NGYA 4G9DB 2QADD 1IAKA 1OP5H 3TN0D 4BH7A 2EDWA 3MRJA 3BIBX 1CDCA 2BY0A 4GS7C 2JJWA 2WUCL 3ROOB 1FZMB 4LSTL 1RJYB 2N56A 4I0CC 3KLDA 4ZFGL 4JGJA 3WUWB 4P2RD 4MXQD 4XP5L 2DQDL 1NANH 1R3IL 4N0CD 5HHOE 3VFOA 5AZEH 3U36A 3MZTA 4ZFFB 1JNHA 1WCBA 1NFDF 2M8XA 4OZ4B 1OP9A 4P4KA 1E28A 5I9QC 4Z7QF 2RAMA 1EXUB 1XIWD 1NCDH 4DTGL 4L4TA 3T2PA 2LU3A 1FZKA 4MA7L 5E4IA 3KR3L 2HFGL 1KIPA 5IVNA 2R4RH 4S1RL 1AKJD 5IMLA 1RZKL 3O11A 5M94B 4HWUA 4MQ7A 5AG8A 4CW1A 3G9AB 4Z95L 3IFPB 2DWDA 4O02H 4F58L 4Z7UB 4XMKL 2ZOLB 1ED3A 2F53A 1NBQA 1KXVC 4LLVB 4K8RH 4RFNB 2EIZA 5DEZA 4KAQH 4QXGH 5DJ2A 1J0YA 1MIEH 3U9PL 3S37H 4LVNC 2NY4C 3QUZB 3RWDB 4G8EB 2X7LA 2EDYA 3DBXA 1HEZA 3IYLW 1MLCA 3J8F7 4ODXB 4LBEA 4BFGA 1BVKB 1AQKH 4PTTB 3QPXH 1CBVH 5I1JH 1JGUH 4S1DD 1BGXH 4LSSH 5I17B 1B4RA 3VXRB 4MA3A 1UA6L 4JDTL 3TVMD 3AXLA 5GGTA 3WFEH 2VIRA 4LVHB 4OAWA 4OFKA 2WV3A 3GKWL 4M61A 1UB5B 1R3JB 4HJGB 3HR5B 4RGMB 4MX7A 4X6DF 3HE7A 3OR7B 3ARFB 1KJ2A 1JGVL 3BVNA 3E8UH 1N64H 5I8OL 1H0DA 4KK8D 4LOUC 4ISVB 4F9LC 5FKAA 4ESKA 3W0WE 3WFBL 2EDTA 3H9HA 3MRIA 2R56L 1PLGL 2BY1A 5K9KA 5KS9B 1YDPB 5DA0B 3OKOA 1CF8H 3VI3E 2CD0A 3KYOB 3W9DA 3ULUH 1U2CA 4XPTH 1QRNB 1TCRB 1NUDA 5GGUB 5HVFB 4PJFA 2UVFA 4XI5D 2BVUA 3DYOA 5D2LB 2ESVB 2VDOH 1B0RB 1UWEH 4NSKA 4H0GA 4U1HA 1A7NL 1DN0B 2O5ZH 4OCYH 1MCNA 3RBSA 1U91B 2FX8H 4HWZB 5ID1A 4FOMA 2X1PA 5DRZB 1NLBL 5GQBA 4FZEL 1JV5B 5IQ7H 5K9JL 4EKXA 5DYOA 2XWBA 2BOCA 1KTRL 4E41E 4C4KO 2AQ3A 2V7NA 3O45A 4FTVD 1VHPA 1YEIL 1HYSD 5DZNA 1NLDH 5M7QA 3UDWC 2JKXA 4DUXA 3BYTA 4FFYL 4S11A 4NJAH 5AG9A 2Y36L 3QEHB 5BJTB 2J7LA 4PP1C 3IDIB 5GS1A 1HKFA 4PRHA 5DJ0B 4J23A 5B38A 4OGYH 1KELH 3AS3A 4YGVA 2CK0H 3DIFA 3SGDH 4PRDA 1I8IA 3LKPB 4M1DH 5HYSA 2QBWA 4Y7MA 2AK4B 4YFLI 2D7PA 2R23B 1TTFA 5I71B 3ZKNC 2K7QA 4YC2B 3RDTD 1KGCD 4YHIA 3OHXB 1YMHA 4JFYA 1F42A 1GC1C 4GAYB 4PYGA 4U1LA 3NAAL 3CFJB 5IB2A 1JPTH 1F4YH 2YA1A 1X4YA 5LGJA 5CIPH 1A9BB 2CIKB 3LHPH 4NZRL 4PP2A 1MI5E 1Q94A 3CIQA 3GK8L 4DCQB 1MCQA 5J06A 4I2XE 5EOTA 4XCEB 5IVZA 3V0WL 2GJ6D 3QHFH 4N0YH 3QQNA 1ORSB 1ZHBB 3STZA 1BMGA 5C0AA 4IM8A 5DGQA 3RWIA 3OXSB 2XTJE 1D6VH 3KJ4B 3KDMA 5B3JF 3TWCH 3CPLB 2YMXL 3NVQA 4NBXB 1OGAD 5CLWA 2VDLL 1LP9A 5CZVL 3LN4B 4XHQA 2AV1A 3HUJE 2GSIA 4R9HA 3CVHA 3VXMA 1FC1A 4KI5D 1QZ1A 2P48B 1LEGB 1U3ZA 1NBZB 5I15L 4K71B 2W92A 2MTPA 3MFFB 4RGOL 1ZLVH 3FOMB 3LQZB 5FHBH 4F8QA 1H3WM 3LN5A 5D93B 5I18L 1I9IL 2BP3A 4HDIB 2HTLC 1L0XA 2M26A 2F19H 3MCKB 4QRQA 1NGWA 1NMCC 3GB7B 1NDMB 5BVJA 1CGSL 2I60H 2YPLA 4OUUB 3CC5B 5I0ZA 5DHVH 3W9EB 1AR1D 3PF2A 4Z0BH 1M1SA 4HGWB 1UWGL 4IOFD 3W5NA 4LLYA 1AY1L 3LY6A 3D85A 2C1OA 3PNWA 4JPIA 2D9QB 2FJFB 4X6CE 1BPVA 2CDFB 4G8FA 4KMLB 4CMHC 1HNFA 1X5ZA 2YC1A 5D70H 1CDBA 1NBVH 2BVEA 2F5BL 3QFDA 3IDYB 4P2QA 3ARVA 4KHXH 3WO4B 1FLTX 4X9FA 5MP6H 1UEYA 1U6AL 3QO1B 2IADB 3F58H 5F1KC 1N5YH 4MYWB 5KSVB 3RZCB 2FL5B 4DFHA 4L3CB 4AG4L 2PO6D 1U8IA 1JIBA 4OLVL 4WEBH 4PLJD 4X4XB 1B88A 2UYLA 3W0WB 3S35X 3ARDC 9CGTA 5KJRL 1QSFD 1IEBA 1A21A 1WITA 1YPZF 4OD2A 1P2CA 4P23D 3IJSB 1VGEH 5CEXA 2VO5A 4XWGH 1F3DJ 3EFDH 2KZWA 4OBSA 3IKCB 3OAUH 3NIFE 5FHAL 4JANA 4HK3J 5I66B 5DDHB 5GGSY 4QNPF 5CSGA 4QTHB 1QACA 4NO5B 4JQIL 4AQOA 1MF2L 2XNAB 3OSKA 4BZYA 4WUUE 5CD3A 5FGBC 4RMUA 4GW4A 4NKIH 3IDGA 4NRZB 1XGQB 1AGCA 3VDAA 3QULB 4GXVL 4IS6A 4TPRL 3F7YA 1OAXH 1G0YR 4ENED 4UNUA 2HJLA 2VXTL 1HK6A 5J89A 5E1AB 5TF1H 2OJZH 2X42A 3RBGA 1R5IB 5HHNB 3IDJA 2YS4A 5AZ2L 1OGTA 4E41B 3ZDYF 4X8JA 2OTUA 3HZMB 1A1NB 1DSFL 1NFIA 5EO1A 5FYJE 3NMEA 1MHEA 2FH8A 3HAEG 5AD0A 2APBA 4PJ9A 2AP2A 2IBZX 1ZANH 4YPGA 5CD5D 2QSQA 4UU9B 4YBQD 3MRLA 4JFQA 1RJLA 1U2HA 4R97C 4ZFZB 4YHNB 4NO2A 5KAQG 3MRFB 3CXHK 1DL7H 4POZC 2CXGA 4F37K 1AP2A 3QUXD 2CR6A 1FL5B 2VC2H 1R3HA 4ODSL 1MUJA 2BNQD 5K59E 3WYRA 2GK0B 3SJVA 2QADC 4ZNEA 2HT3C 4I18C 1EIBA 4E0RB 2E7CA 1DBMH 3VFNB 2F58H 2V9QA 4PY8J 2ERJB 1AD9B 3PL6A 1XGUB 3ZDZF 3BEVB 3B8YA 2AXGA 4WFEE 4PJDF 4NUGH 3DMMB 1MI5B 4IMLA 5EC2A 1NDGA 1TJHH 2FJGB 3DX7B 5FUZL 4I2XB 5BV7L 4FQXB 1TJGH 4WHYG 3RIFK 4PJ8B 4LVOC 4C55A 5T3ZE 3AY4A 1JF1A 2R2HB 1Q9OA 1IFHH 2G2RB 3WD5H 3ILPB 2I5YH 1Z2KA 2EYSA 3I2CH 1TCMA 4DGVL 1JZ5A 4PJIA 4R6UA 2XTJB 3TV3H 5IVOA 1OL0A 3DGGB 5DJXA 4PY8I 1P9MC 3HN3A 5AWNL 4NQTA 3UP1A 4MAUL 3SY0B 2XN9D 5L88H 1TZGH 3HUJB 1MWAA 4JG0L 5IT2L 3P4LA 1P7QA 2GFBA 2VRAA 1PG7H 4F9PC 4NN6B 3T4AB 1A9EA 3V6OA 3EZJB 2ZUQB 2A73A 1RJZA 1WSST 2RFXA 4HS3B 2OJEA 4JJ5B 5DRNA 1MH5A 4YAQB 4K3DL 1CYGA 3NCBB 2RJMA 3HC0A 3MLPA 1BX2A 4WTXA 1KLUA 4H26B 4L8DA 3CSYA 3GHBH 1RURL 2LQRA 4WU7A 5MEOA 5CJOH 2GT9B 2YD4A 4CGTA 5HXMA 5MI0B 3WCYA 1C08A 5E8DL 4GRLD 3WHE1 4CMMA 5IEKA 4M1GL 4JFZL 4P49A 3MJ6A 1AGEA 4JRYE 1A1OA 3MJ8B 3G5ZA 5KVMC 4ODUB 1TZIB 2FEEI 1HHKA 3Q1SH 3QUZD 3QYCA 4U6XA 3BYYA 5E5MB 3MRCA 4OLZL 3O8XB 4J3WA 2ZG2A 4OLWH 1AJ7H 4Y2OA 3NGBC 2ITCB 4X6CB 1Z0NA 2G5RA 1J0ZA 3TPUA 5IJKA 1TVHB 4BK5A 4BQCA 3QJFB 5HDQH 3VXRD 5CCKH 5D1XA 1MCRA 4KK8C 3EO9L 3BN9D 5KSBA 4MAYB 4OZHA 4U0RC 4FQPA 1A02N 5MERB 1CZ8L 5LAXB 4JQVA 2X1QA 4JO4H 4LMQI 4LRIA 1RULL 2P8PA 1LO3H 1S9VB 2Y07H 3VFUB 4EQ2A 2C4XA 1HWHB 1DQJA 4Y5VB 1VKXB 1NSNL 1DUYA 4MLSA 2NY5L 1VGKA 4UT9H 1A7RH 1HH6B 4HWBH 4LIQL 4NQXA 3EOAB 3LKNA 5DK0B 3BP5A 4EI6B 4GKOA 3O0RL 1RUMH 1J0HA 4BUHA 3V4VH 4HJ0C 1G7IA 4JHWH 3PHQA 5SV4A 4AY0A 5EZOH 2BSED 3ZHDA 4ZO7A 1NGQL 1TNMA 3HAEB 3LB6C 5BZDB 4OCXH 1EAPA 2E9JA 3LEVL 4WUUB 2E3VA 3VWJD 3S3SA 1I1FB 3FQRB 1K5NB 3VWKC 3MODL 3N0PB 3ULVL 1FG2B 4PRBA 5CZKA 1DTUA 5ALCL 4WFHD 1MCWM 2Y06L 3WS6C 3SOBH 2OI9C 1HYSC 2X09A 2CRMA 1EPFA 4UNTA 2IALB 1INEL 2VTFA 5I1CH 5DMJB 2MPAL 5IWLC 3LSOB 3V0VA 5I1IL 3TO4B 2CUMA 3IS1X 5D7JB 1JFQL 4NBZB 4PG9B 1AGDB 1H3PH 3MLVL 3JTTA 2Z0BA 1G9MH 3FMGH 1FDLL 1J87A 4YHKL 2HRLA 2BXZA 3RDTC 1ZVSB 1IARB 4EBQH 2CGRH 3T0ED 3LH2L 3BPLC 4KROD 1F58H 4GMTH 1KC5H 2A0LD 3SDCD 3MFGB 3EFFB 3OQ3B 4PV9B 3GMNA 1DBAL 1KENH 2XQYG 3L7EB 3L7FA 1XR8A 1HZHH 1G6RH 5JOFA 1VFAA 1JN6B 2WLYA 5IW1B 4JFED 4KDTC 5DLMH 1J1PH 4QHNA 4UUJA 4JFOB 4JHBA 4TSAH 4KWUA 1B0GB 4IHOB 1CDJA 1BF8A 1JL8A 4I9WD 1AIFA 3IJYB 3HMXA 2DI8A 4ONHA 1ZA3A 4OIBA 5F7FA 2XG5A 4PJXA 1PKOA 5HHOD 2GIYA 4TSCH 5J1AB 3AB0B 3VJ6A 3HNVH 3VFGL 4WO4A 2OX5A 1FVDA 2EKJA 2CR3A 4GKSA 1HKLH 1DUZB 5F3HB 2UV3A 4QXUH 4F7TA 3SKOA 3MNZB 4MNQD 1K4CB 3MLTA 1YN6B 2ZPKL 3ULVE 3L5XL 4PJGE 5HHPB 3W11C 1JK8A 1S7WB 1MVUB 3QUMH 1ZS8B 1BFSA 2ATKA 3VGHA 4DUWA 3DROB 3CX2A 1U92B 3KPOB 2DQTH 4QRSA 1ZEAL 5T1LD 4KFZC 3G08B 1AR1C 3KPRA 4TSBL 3I3EA 5FDWA 1PDKA 3KPSD 1XF3B 4G6JH 1KF9B 1HE7A 2V7HA 3AC0A 3AS0A 4NT6B 3C5ZB 3DTXA 3RVXC 1E4XH 2FZ3A 5BO1H 2DKMA 2WINA 4JRYB 1ZV5A 4QY8A 3AM8C 1T7XA 4K7FA 4WHTA 3I50H 5I8EB 5AZEL 1T0NA 4ZPVB 3K80A 4J8RB 3MA9H 3TA3B 3JXAA 3O2DA 1MNUH 1NCDL 4BSJA 3B9KD 3FONA 5SX4I 2EDXA 2J3SA 3OJMB 2PO6C 4P57A 1WZ1H 2R4RL 2BOBB 3S96A 2HRPH 5DVMA 4HGKC 4MWFA 2A6IB 4W68A 4IJ3C 4RA0C 3ARGA 4D0DB 5HGHB 4EQ3A 1KYOJ 3ARYA 4NRXA 3ZDZE 1DR9A 3EYOA 1HHGB 1JGLH 4O02L 4ZAKA 1D5BB 4M9OA 5CEZH 2BHUA 3DUSA 4ZD3H 2JTDA 1G1CA 1LWRA 4K8RL 3TCLB 2Z93A 4U6HA 4EZMA 4X0KA 3MGAA 2WNGA 4JREB 2QJDA 1CT8A 3GIVA 2J8UE 3PQYA 1MIEL 1U8JA 5IMOB 1KPVB 1FSKB 4DK3A 4OF7A 1N6QL 1ADQL 1A4KA 1ZA6A 1IQWH 3QCUH 5D5MA 3CXDH 4XNZC 4E42A 3V5KB 1AQKL 3QPXL 1CBVL 4X7EC 1JGUL 5I1JL 4LSSL 5B39G 1I9EA 1INQB 1V05A 4NZUH 5D72H 1UQSB 4U2ZA 2FO4B 2CKBB 2W38A 3QFJA 4ZO9A 2HH0H 5IHUH 3WFEL 4BKLA 1GVIA 3THMH 2CDGA 4M93C 4APQD 5CD5C 3CK0L 4YBQC 4L4TE 3CZFA 5T5FH 1BQHG 1N64L 5E00A 3UPRB 5F9JA 5HVWA 1JWSA 2EDFA 3QUXC 2CQVA 1JMXA 3GMQB 3MRHB 2HVJA 2KQNA 4LGPB 3B2UD 1K8DA 4MDJA 4UIKH 4F7EB 4NRYA 5JDJA 1KEGL 3LKSB 5T1DL 3ZL4H 1D6EB 1CF8L 1KJMB 3DRQB 3RWGB 5E94B 4PGZA 2RHEA 1X5KA 4XPTL 3ZDXE 1A5FH 1D5XB 2D0HA 3C2SA 1K6QH 4G42A 5JOPE 5DQJA 5BQ7B 2RBLA 3ZKMD 1VADB 4QYOB 4OKVB 2VDOL 1UWEL 2XWTA 2VLKA 3FN3A 4NQSA 2O5ZL 4MJIE 2FX8L 3EJZC 2KPNA 3BGMA 1P6AB 5IW6A 2F8OA 2IF7A 4Y2DB 4FQXD 4PJ8D 2NCMA 3ARWA 3QDJD 2GYSA 4GUPB 2DLIA 1KNOA 4L8SA 4JZJA 2YOCA 4CN6A 4LEXH 1MQKH 1AD0A 4OM1H 2JIXB 2ICWA 5IGXH 1DVFA 1T03L 4OGYL 1KELL 4I0PD 3EYFA 4NNYB 3TP4A 4FABH 3W2DH 2CK0L 4PJIF 4DGYL 1S5IH 4M1DL 5DRXB 1DE4A 4PJGB 5IMKA 1Q9KA 4XPFH 1VSCA 3TIEB 1C12B 4RFNC 4O51B 1ZLWH 2AKRB 4AEEA 3QIWA 2R15A 4LCUA 5T1KB 4JO2H 2I25N 4DKEH 5CWSB 3LHPL 5LVEA 2ADGA 2GITB 2IPTH 4PJFE 2MHAA 5F7MC 1VENA 1T21A 5FYKE 1MAMH 1YC8A 4H0HB 5EIIB 1S7XA 3DVGA 3QUZC 2VITB 1WUNT 2W9LA 2Y25A 4R7NA 1Q0YH 3QHFL 1YMMD 4FFWD 5IM7B 1P84J 4F2MA 4L5FH 4PRID 3F7VA 4K23H 1D6VL 3PG2A 3U7YH 1JMZA 1U8OB 4NQDE 3ULUE 1ETZA 1XCTB 2OZ4L 4NHCH 3TWCL 4PBVC 1YYLH 1J86A 1LNUB 4LVHC 2BVYA 5DJ6B 1FFNA 5C0IB 3V52H 3O4OC 1I7UA 4RGMC 2O93L 3C8KA 5KVEH 3ARFC 2KH2B 2Z8SA 5BMFH 2F54A 5I16A 3LAFA 4YPJA 3X14A 3VFPA 3FB5A 5E6ID 1CLCA 2EYTB 2DQHH 5DUPL 1FJ1A 5E8OA 2F19L 3GBMH 5B39B 3F7PC 5C0GA 3PP4H 4X9IA 3ZMRA 1AC0A 1MHPH 4O2CA 2ENSA 3C87A 1CGVA 5KSBF 2YZ8A 2FHFA 2X4QA 5KOMC 4RMQA 4Q9BA 5F1OB 4M62L 1DANT 5IB3A 1GOGA 3LRSA 4L4VA 2VZUA 3IRPX 4GO6B 2J8UB 3KPQA 3VWJC 2FGWH 5D1QB 1BQHB 1NGYB 1L0QA 1A6ZA 2XZQH 3T2NH 1FVCB 3T8XB 3MRKA 5DEFA 4LDLB 2VLJD 4RMWA 3DXAB 4XTRD 4AMKH 5C0AE 5FYLE 2V2XB 4JLRB 1NBVL 5HYSG 4OCRH 2A2QT 3O3EA 3UTQA 4JFHE 4HGMA 3WIIL 2BHZA 1CGTA 1JPSH 1JNHB 2NY6B 1CE1H 5EO0B 5EU5B 1LP9E 4MDIB 4P4KB 5I6XB 3WKNA 4HKJB 3U46A 1JZ2A 1ZT7A 1A7OH 1WZLA 3VFSA 4L4TB 3GMMA 4O2FA 3CDYA 3T0EC 3VXSD 4YXLH 4KROC 2C3VB 1FORH 1KIPB 3FQUA 4WEBL 1OM3H 1U8LB 1WICA 3FFCA 5I1GH 3O11B 1ZLSH 5I71C 4JFXB 4CW1B 1Z9OA 4YC2C 3EKCA 1HXMB 3HG1D 4V1DE 4XWGL 3EFDL 2DWDB 3KWWB 3OAUL 1BZ9A 3QIUB 2WZPD 2Z92A 4NM8H 32C2A 1BD2D 4EI5B 2Y5TA 4HUUA 1FVEA 2GI7A 4MHHI 1VFBB 2NX5B 4NKIL 1T7YA 3PDOA 5C07D 1JZ3A 4MJIB 4UI2A 1I7TB 1PYWA 4ZOCA 5EIQA 4Z7OF 4WFED 1OAXL 4XVJL 3T0BA 3U0WH 3V5HB 3TBWB 3DBXB 1MLCB 3KJ4C 1NGXB 5HTSA 1G7MA 3ZE0E 2OJZL 2X4NA 5MEPA 3AGVA 4EOWH 1FO0H 1S9WA 3UTZB 5HHVL 4QTIH 4LSQH 4OAWB 4CDGC 1ZANL 3P4OB 3MBXH 3PGDB 4J7RA 4K71C 3DX6A 4MX7B 4Y4KD 4H88H 5FV1L 2FWOB 3CCHA 2FBOJ 1DL7L 4PJXF 3UJIL 1CD1A 4LEOA 1DLHA 3WEXA 2VC2L 2AEIT 4KVCH 5KZCB 1IM9B 2VLLA 3BQUD 3VRIB 3TIDA 4ODTL 2Q8AL 1DBML 4KQ3H 2Q86B 1OW0A 3RL1B 3HNSH 4PRAB 3B5TA 4PV8B 2R1WA 5GS3A 1T83A 2P1YA 3TBSB 5L2KD 1HCFX 2FIKA 1JPGA 4NUGL 2WP3T 5MENA 4JM2A 5EULV 1M7DB 4PJFB 1TJHL 4YHPA 4ORGA 1YEDA 4NSKB 1TJGL 5C86A 4MD0A 2A6DB 5M95B 4JDZA 2YUXA 5HI4D 2DLEA 1N26A 2I5YL 3I2CL 1UVQB 4JRYD 2VDPH 5L9DH 3ZT5A 5FO9B 2EDOA 4FMFA 3TV3L 4NQDB 4PLOB 4YO0A 1BAFL 4K55A 4ELMA 3M17A 1H15A 3WO4C 5AEAA 2EEAA 3SE8L 1P5UA 5L88L 3O45B 2V7NB 1TZGL 1H9VA 1PG7L 2KUTA 2HG5A 3RZCC 2I9LA 4UQ3B 1NKRA 2KZ1B 4NYLB 5GRZA 5JA9A 2DD8H 3GSNL 5ITFA 3BESR 3RA7H 4JKPL 1HCVA 5ANME 3D69B 5E2TH 3VFTA 1I8IB 3GHBL 4IRJB 1NBYA 4OD1H 4PR5A 5IB5B 5CJOL 5GGSA 3TYFB 4JFYB 4HMCA 3AU1A 4K7PY 3PHSA 2VZVA 2ARJA 4HH9A 5FA3B 1G9NC 3MV8A 3S3PA 1ZGLM 4U1JB 5KANG 5C09A 4H8WC 4LLUA 1BQSA 3MLRH 3JTSB 4PP2B 1Q94B 1YN7B 3MRRB 3Q1SL 3ZYZA 2ZUWA 5IVZB 4YZFE 4OLWL 1AJ7L 3LPFA 5CZXC 4BFBD 5GIRB 1A6TA 1B4JH 2IWGA 3AS2A 4Y1AA 5C0AB 5EZIH 3MUJA 5DEGA 5DF0A 3D6GA 1GZQA 2A9MH 5HDQL 5CCKL 3GI9L 4PGBB 3KDMB 3WFDH 3VW3H 4G5ZH 4J4PD 5CIPB 3V79C 4M03A 4I3RL 1S8DB 5D5MF 5ABDE 5I19H 1LP9B 1CIDA 2AV1B 3MYJA 5C0FB 4LCIL 4BFEA 2V2TA 2WWMD 2GSIB 1PKQA 3CVHB 4Y5YC 4JO4L 3DHMA 3V6OE 1ADQA 3BZDA 3QG6A 4D3CH 3GRWA 3I02A 1LO3L 1CFSA 5EN2B 1C8PA 5CGTA 3ZKMC 4OZIA 3H8NA 5F7LB 2GCYB 1A7RL 1UJ3A 4HUWA 4LPTA 1RUML 4QRQB 4ZOBA 3V4VL 4V1DB 1S7SA 3ZHKA 5T33L 2XKSA 2ERJC 5BVJB 4WW1B 5H37H 3K8MA 1R0AH 4NGHH 2VR9A 3ARUA 3QQ4A 3DMMC 3BD5A 3L3GA 3MUHL 2DI7A 4J3SA 3QDGA 4FQXC 3GI8L 4PJ8C 3MROB 1GGIH 3D18A 2IAMD 1VEMA 3ZTNL 5J0BA 4JQXC 5AUMB 2XTJC 3ZYJA 3KXFA 2O26U 2YC1B 5I1CL 3EYVB 3QFDB 3HPLA 1KJ3H 4AT6B 5JQ6H 1P6FA 2XYCA 3DECA 1H3PL 5I1EH 5DS8B 4LDOB 4Y5XA 4OZHE 4M7LT 3IGAA 5GGVY 1JHKH 2AJUL 1G9ML 3FMGL 4GAGL 3UTTB 5JQHC 5JXEA 2HAZA 1JHLL 2DLFL 4LASH 3NFSH 2CGRL 2DDQL 5GRWA 2X05A 3FO0H 1U8IB 1F58L 5IEHA 3HLAB 2Z91A 1KC5L 1J11A 1XFPA 2ARJQ 2DM3A 5GXBB 3I6GB 1VPOH 1IEBB 1IQDB 1KENL 3V4PH 3O6KH 4F7CB 1HZHL 4D0CB 4OV5B 1G6RL 4FXGA 3WN5A 5CEXB 4G8GA 5DLML 1J1PL 4B7LA 1ZHKA 2DJ4A 5JIHA 3D2UA 5T1KD 4FFWC 2VE6A 1CDIA 5J56B 4JZNB 1IAOA 5IJVB 5CD3B 2Z31A 3RWCA 1FH5H 4HD9A 1SEQH 4YHZH 1XH3A 4V2CB 3O8XC 1AQDB 4IIQB 3S5LA 3VMNA 3DX8B 3FHQA 3QUYB 5D7LD 2AJZA 4WNQA 4TSCL 1LK3L 2BVOB 4G6KH 4DKDC 4HLZH 3RPIB 3IDJB 1ZT1A 4CVZA 4QRPA 4XZUB 5IHZA 1HKLL 4X8JB 4QXUL 1LGVA 4MAYC 1S9YA 4D2NA 3NOIA 5EO1B 1MHEB 4YDIH 2AXFB 5D96B 5GRYA 3MQIA 1MOEA 3MRLB 4JFQB 1RJLB 3QUML 4YIQB 1DCLA 3AROA 5TDNB 3BW9A 4KY1H 3NFPA 1QPXA 2FGZA 3MOAL 4Y5VC 2DQTL 1JPFA 1WGOA 3MMEA 5ANMB 4M43H 3DETC 2OZ4A 5IG7B 2ZJSH 3MPCA 4EUPH 1TJIL 4RX4A 2VUOA 2PXYD 2DYPB 2L7UA 4G6JL 2APTA 3SCMD 1A0QH 5IVXA 5TDPA 1ZGLB 2QR0A 3OTTA 1RVFL 2R1XA 3PL6B 2NY0B 3Q5OA 5BO1L 5D1ZD 5C0JA 4EN3A 1BFVH 4ONGH 5D1QD 3STBA 3I50L 1NCWL 5GISH 3OB8A 4NHUA 4HMEA 2ITDB 1FGNL 4ZUSB 1JF1B 3FT3B 3LD8B 5KSUA 2DLTA 2WQRA 3PJSB 4RDQG 1PQZA 1MNUL 2WBJA 5F9OH 2DM7A 3RU8H 2KL6A 5DJXB 3JVGC 3L3IB 5DHVA 2NY6D 1WZ1L 5D7JC 3M07A 5DUBB 4LCCA 1N59A 4QHUB 4P4KD 3IXAA 2E6JA 3V8CA 3QEQA 1ZXQA 4MD4B 3LVEA 3X3FH 2H2SD 2GFBB 4L4TD 1A9EB 2FRGP 1CFTA 4HSQA 1JGLL 1RJZB 3FFDA 3O4LA 2X4RA 5DK2A 2OJEB 5DRNB 3OKDA 3MRPB 4ZD3L 3TN0A 2H3NB 4QGYA 3WFCH 4F7PB 2DIBA 4N0FA 5DRWA 3CSYB 5K9OA 3KPRE 2DRUA 3EYUH 4X4YA 2ARWA 5CHNB 1QFOA 2OR8A 3MYZA 1NH6A 4UBDD 5JOPD 2F53D 3ARBA 3UCRA 3D87B 2Q7NA 4CMMB 5IEKB 3TLRA 1IQWL 4KKAC 3QCUL 3TZVB 3CXDL 3OJ2C 5IK3A 3FZUD 2B1AH 1A1OB 3D9AH 5EOCH 5KSAA 5EBLB 1Q9WB 5I74B 4GW1B 4M48H 2HH0L 5IHUL 3O6MH 1MAJA 4OF6A 5EZJA 4PJAA 5GSVB 4X80H 3GSWA 5DHYB 1DQDL 5D6DC 3DVFA 5T5FL 3AB0C 4ELKA 1SJXA 3BISA 1U42A 5D1XB 1KXTB 4NOFA 3TBTA 1IC4H 4X5WB 5IOPB 3S97C 4OZHB 3R06A 1QFWI 2XQYK 4UIKL 4Z0XA 3ET9F 3BQUC 1BOGA 3ZL4L 3HE7D 5F1IB 5CILL 1TZHB 1K6QL 3FTGA 1DQJB 2GTZA 1A6UH 4PPTA 5KZCD 1D3CA 1DUYB 4L9LA 3SKMA 3MR9B 4AZ8A 1Y0LB 2PETA 4NQXB 3LKNB 5A3ID 3PQYE 3C60B 1G7IB 3PHQB 5HI4C 3RVWD 1ZHLA 2EE3A 4LKCA 3C5ZC 5H2BB 4YK4B 4H25A 1VERA 3T1WA 5FYKD 5CEZE 4Y4FB 2DJSA 4BQ8A 1QTYT 1HH9A 4J3UA 1FYTA 3TA3C 4G7VH 4JM2F 4LEXL 1IEHA 3FN0H 2W0LA 4WU5A 4OM1L 3FOLA 4ZTOH 1EO5A 1XGYL 4I48A 3O9WA 1MPAL 3S88H 5B4MD 4PLNC 4U1NA 1ZVYA 1H8NA 3BEWB 3V0VB 3KLAA 3LKQA 3MREA 5HHQB 4FABL 1S5IL 3MV9B 4MA8H 1REIA 2HFTA 1HXYA 4P2CG 4ELMF 5TH2A 1WWAX 1SJHA 1T4KB 1BBJA 4XPFL 3RKDD 2EDBA 3FQNB 1I3UA 2D7OA 4PRHD 4JVUA 5BZWA 5ICXA 4YBLB 3ISWA 2ICEA 5A40E 4JO2L 3DOSA 2BDNH 1WBXA 4DKEL 1IBGH 1QSEA 3HZKA 2IPTL 3GMNB 3PABA 3H9SA 3WE6A 3PGCA 1T3FA 1MCSA 2VLKE 4MZ2A 3RTQA 1Q72H 1FSKC 1Q0YL 4JM4H 4U7KA 3P11H 3OX8A 4QHNB 1LK2B 3KYNA 5ETUA 4AENA 3A6CL 4L5FL 1KTLA 4PJ7E 1BJ8A 4FXKA 1XF2B 3EDFA 5DHXB 1RZJC 4Y4HB 1EEYB 1BM3L 3GSNA 1G0XA 4O9HH 4GSDH 3U7YL 3ILQD 3DX9A 4NHCL 3C5JA 3I84A 2HLAB 2FX9H 4J4PC 5LGKA 1F00I 3SDDB 2BHYA 4WHCA 4PY7B 4G6ML 2WWMC 1ZA3B 4P9HL 5FYLD 2QQNL 3W81A 4H1LA 4U05A 5KVEL 4OZFH 2Q76B 4JFHD 5BMFL 1F11A 5BW7C 1QHOA 4MS8D 1KPUA 3ARZA 1EHXA 4MCZB 4N1EA 4N5ED 2C4FU 2DQHL 3NZ8B 4PJEA 4BSWA 3VXMD 2OR9H 2P24A 1U3JA 2LABA 3GBML 1HN1A 3PP4L 1MHPL 4OCLC 3HR6A 1AHWB 3GM0A 4TTDD 3S34H 3ES6A 1YC7A 2ATKB 4RA3A 1F6LL 4R7DB 2E9BA 4OLEA 5GGVL 2FJHA 4QRUB 3WDHA 3CX5J 4UOW0 4RMVA 3KPRB 2FGWL 4IDLA 5C7XH 1I1CA 1UZ6E 5I73B 2XZQL 1ZK9A 4OFDA 4TVPH 4KK5D 2IAMC 4TTGA 4OZIF 2YPLD 1VFMA 2P42B 2YRZA 4Q7DA 2FZ3B 1P1ZB 4AMKL 4GOSA 5K9QG 4Y2DC 5C0DB 1JNJA 1R24B 3HFMH 4QT5B 3WFZA 1FRGH 1TQBB 3OZ9H 4OCRL 2BNRE 2JB6A 3CGTA 3IVKB 1QLEL 2YHGA 3FO1B 1T0NB 1T89C 4KTEL 3E6HA 3D85D 3RNQB 1JPSL 5JW4Q 1NJ9A 2DBJA 5C8JB 3FB7A 4P4RA 4XCNA 3HI1A 4JCLA 3FAWA 2VXSL 1A7OL 3F8UB 3TM6A 4HKBA 1CG9B 1A4JB 4A6YA 3BIKA 4XPGL 1CICB 4P2QD 2VAJA 4YXLL 5FF6A 5HHME 2BVPA 1FORL 4M1CC 1OM3L 4ZUWB 4JVWA 1UM6L 1IGJB 3VFVB 4MWFB 3V0AC 4Y19E 4MCYB 1ZLSL 5I1GL 2H8PB 2ZSVB 4RAUA 2IMNA 1LE9B 3C8HA 3EYOB 4AL8H 2VLRB 4JEGB 4EJ1C 2O5XL 3AREA 4WCYH 5JPMA 4NM8L 1YA5A 1RUKH 1GYAA 4GRMA 4J1UA 2NY1D 2Z93B 4PYHA 3QIBA 5LGHH 2GUOB 1A7BA 2A74A 3PQYB 1OHQA 1HINH 3PP3K 3NZHL 3QH3A 2X4UA 3NFNA 5IQ9A 3QI9D 1DDHB 5D8JH 1CLYL 4HUKB 3N50A 4RMTA 5EUKA 4UTAH 4E42B 3OJDA 4BSVB 3F12B 5JIIA 3MO1B 1XCQA 2J6EH 1ZWIA 3WUZA 4EOWL 1T2JA 1FO0L 5F89A 4NQUA 2BMKA 4KJPD 1FFOB 3CMOH 4KMQA 3RIAF 1A6PA 1YECH 4QTIL 4BKLB 4HZLB 3L3JB 5FKPA 1YUHA 4QKXB 3DO7B 4ZSOA 1XAUA 4QXWA 3MRMA 4Q9RH 5TE4H 4NUJB 4KVCL 4PJ9D 3MGTB 1QO3B 3EDKA 3FFCE 4CADB 2K9UA 3CSGA 2VUYA 3LS4L 4BH8A 5IB4A 3SCMC 3MLUL 4MA1C 4LARH 5LXGH 3HNSL 5L8KB 5DQJB 1XGTB 4LNRA 3D25B 1S7RB 1CD9B 1UM4H 5D1QC 3RVTD 3SJVD 2VLKB 1F6FB 3WJLA 3Q3GB 3HS0B 4ZUTA 2OL3A 1LEIB 3PL6D 4XRCA 3CDFA 3BGMB 1PFCA 1JTTA 2HTKC 4PJ7B 5IW6B 5L9DL 3HI5H 5DZOA 2LFGA 1OB1B 1WF5A 3P9LA 1N3NA 5HSFA 3G9VA 1TFHA 3BWAA 3ABZA 3CVIL 4WUKH 5IVXF 4XP4H 4OIAA 2NY6C 2P47B 3RGVA 4L8SB 5I6XC 4P4KC 2A77H 3MOBH 1CDUA 1KB5A 3VCLA 2DB8A 1KN2L 4NO3A 3LS5H 4H0IA 5BRZE 5JNYB 3SO3B 2MOVA 2IEPA 2ICWB 4XBPA 4U33A 2NXZB 3RA7L 3H6JA 3EYFB 3QXAA 4TN9A 5E2TL 3L1OL 1P7QD 2NXYB 2D31B 1WAAA 1DE4B 1P4LB 4LRNH 1DQMH 3QIUC 2IBZY 4UBDC 2ZUXA 5GJTH 3BAEH 4EI5C 4U6VH 4GRWE 3CU1A 4KTYA 4LCUB 3V6ZA 2W0PA 2Y1VA 3MLRL 3C2AH 4IRSB 2ADGB 3PWJB 2MHAB 3L5WA 1WBZA 1T21B 1J0IA 3D0VA 4C56D 4P5TB 3DVGB 5D7IA 4R7NB 2VN4A 2VXQH 1U8PA 1BREA 3BPCB 5CP3A 2R4SH 4X5LA 3DSFH 3EOYG 1B4JL 2IG2H 3FQXA 5CEYA 3QWOB 4CJ0A 3N1MC 5EZIL 2EZ0D 2YRPA 2JJTA 3LN9A 3CX5K 2A9ML 1GC1L 3GSXA 3VRLE 2BNRB 5JORB 3L9RA 3UZQA 3WFDL 1OWWA 4ELME 4RIRB 3H7BA 2BSSB 1O7SA 4GKZA 5I19L 4YR6A 4XNQA 2BJMH 4QCIA 4X7CC 1I7UB 2VDRH 3FQTB 2BRQA 4LSRL 5IESH 3C8KB 4D3CL 1F8TL 2PTVA 1FG9C 5HHMB 1U8MA 1RIUH 2E7BA 3F62A 4P2OA 3LPWA 5EPMA 3WLBA 4GRLA 5E2WL 3CD4A 1AO7E 4Y19B 2PTUA 2PYFA 3RWHA 5EFIA 2O5YH 1F4AA 1X44A 4O2CB 5HDBF 3ALPA 2EICA 4YX2L 2X4QB 3VGFA 1C1EH 3GKZA 4MQXC 3C9NB 3CFEA 3QQ3A 3QWQB 1R0AL 4NGHL 3QZWB 3MV8E 3UYPA 2GTWA 4U3CA 5IB3B 5C09E 3LRSB 3KPQB 5DMGD 4X99A 1CGYA 2HFFA 1HHJA 3SDYH 1GGIL 2ADJA 5HY9B 1NGZA 2J8OA 4WI8A 4Y89A 4JGUA 5JOEA 3NACH 2X6MA 4RRPG 2IH1A 2HN7B 3U4BL 5TPWH 3ULUC 1RZ7H 2VB5A 1T6WA 1PY4A 1QVOA 4XWOD 2ATPB 4JKKA 3CNKA 3QAZB 5GZOD 2IC2A 2OSLA 5JQ6L 3TJHC 3LKRB 3FO9A 3ZE2F 1JHKL 3JZ7A 3DO3A 3K8LA 1NCBH 5FO7A 1E27A 4YFLF 1N5AA 3NFSL 2A6JB 3GMMB 3RKDC 3ROLB 4KV5F 5IFHH 4D9QE 3PWPA 1RUQL 3FO0L 1I1AB 3H3BC 1IVLA 4NC2B 3M45A 4P3DA 3FQUB 1PAMA 1G7JA 5ITBH 2AI0H 4ONOA 1D9KB 4HF5L 4U1MA 4XGZB 1VPOL 3FFCB 3SDXE 1EHLH 4D9LH 3O6KL 3P0VH 2X4SA 3ALWA 1JUFB 1G7LA 1KUMA 3KS0J 1FNLA 1RSFA 1A47A 2YRLA 3ESUF 2IPKA 5DVNA 4QF1A 2AJXL 3RUGA 4Z76B 1FVEB 3ILQC 1FH5L 2YKLH 2WIMA 1SEQL 3QDGE 4YHZL 5J3HD 4AEIH 1QQDA 1ZGLP 2AS5M 3TGXA 5GSRB 4M6OL 2BY2A 1UH4A 2C7UB 3HB3D 3MRGA 5C0EA 2JJSC 4F8TA 4G6KL 3DUUB 3PXHA 2WK2A 4YQXH 1W72L 4RGNE 4MS8C 2YPKA 5HDLA 2ORBH 2Q3ZA 5DI8A 1URLA 5F3BB 4N5EC 1AC6A 4N8VG 1KPRB 3Q5YA 3QEUA 1J1OH 4YDIL 2RCSH 5I1HH 4X7FC 5BRZB 4TTDC 3QXVA 1YEHH 5LQBH 2PTTB 4KY1L 3TT3H 4WO4D 5KTEL 2OM5A 4M43L 1CD1B 4LEOB 1K4DA 5DD6A 4YHYB 2ZJSL 4R3SB 1FO0B 1IAIM 4PJBA 3BDBA 3CFCH 2EXYC 4KK5C 4JKMA 4LQFL 2NY4B 4JFDB 4GRWB 4KXZI 3VI4F 4FFVD 3G6JF 4XVUD 3VXUA 1JPGB 3KPRD 2GSGA 5KG9B 1BFVL 4ONGL 4DZBB 5GISL 4ORGB 5E8EB 1YEDB 1D5ZB 4N90D 4JDZB 2CPCA 4N0UE 2CLRA 5L6YL 1J8KA 1I8MA 1MLBA 1MFNA 1RZIB 5HYJE 2P5EA 3EDEA 2Q6WA 3BH9A 3M17B 1XT5A 4HC1L 4QRPE 2AQ1A 5L2JB 3X3FL 3NN8B 2QHLA 1MY7A 1T1YA 4HK3N 3NIGE 1IEAA 2HG5B 2YD9A 3B8SA 3HRZB 1LVEA 5GHWH 3UTSA 4NIKB 1UKTA 1H5BA 1EZVX 5SWZA 2R2BA 1AXTH 2HJKA 4I4WB 1PG7X 4NDMA 5FO8A 1AO7B 4XB7A 3S5LG 1CR9H 3ARGD 2NY1C 2P5WE 1EGJH 4L8CA 5E8NB 1NBYB 4ORZC 5IBLC 3CU7A 4ZQKA 5FGCE 5D7SH 1S7VA 4ZAKD 5GGSB 4TULH 3B9AA 4ETYA 1KN4H 4AYFA 4MSWA 3OKEA 1TVBB 1DLFH 5ACZB 1GGUA 1ND0A 3OV6A 4JZOB 2WM0A 1G7HB 5I1AA 3NIDF 1XF5B 3KLHC 3PQYD 3D9AL 2APWA 5DJDA 1PSKH 4G80A 5EOCL 2X4OB 1WLHA 4IIQC 4KVNH 4M48L 3BZFA 3O6ML 1FHGA 5HI5D 3BZ4B 1P5VA 1WV7T 1ACZA 4QRRE 4HIJB 4X80L 2XY2A 3KVQA 4NQEA 1BEYH 3INUH 2Q1EA 1KLGB 5F9WB 5E24E 3C6SB 1GZQB 3FT4B 1PZ5A 1YY9C 4IDJH 3QFJD 1GL4B 3PV6B 1IC4L 4NFDA 4NFBA 4J6RH 4H8WH 5D96C 1B9ZA 4E5XA 2K7PA 1DFBH 3X12B 3UZEA 1VCAA 3O4LE 3FT2A 3I02B 5E56A 2NY2D 4LK4A 4P9MH 1A6UL 4EUPG 5DO2D 4U1IB 2GHWB 3BO8B 3SDXB 5GRUH 4HUWB 3VXOA 5IR1B 5I75B 5AYQA 1FL3A 5ICZA 3DRTA 1IGFL 5DJZB 5I2IA 4I8DA 3RVVC 1S7SB 4P2RE 4NKDB 3SPVA 4N8VB 3PL6C 2NY0C 3E0GA 4L1HA 4WWKB 2HT2D 4FZ8H 3TNNA 4ZO8A 4XP1H 3QDGB 2VLKD 4APQA 1GOFA 3GSRA 4JY6B 2R8SH 3AY4C 1W0VA 5IIEB 1XF4A 3RY5A 3D18B 1OAUH 4JPVH 4KRPB 3MBED 2IQ9L 3FN0L 4PJAE 4M6MH 1NGPH 5SWQA 4ZTOL 2D0FA 4KGLA 1A7QL 2Y6SD 3HCVB 2W9DH 3S88L 3GBNH 3R1GH 4RGNB 3T4YA 3QNXB 5F7DB 5HDBE 1II4E 1IC1A 4NQCA 4F9LA 2OTWB 4LHUA 4OCNC 3V6OC 1M7XA 2XV6B 4FQCH 1OSPH 1FLRH 1DVFD 1EBPA 4AM0B 5ICYA 1OARH 5IEHB 2VLME 4TRPH 2Z91B 3RVUD 2NXYD 3UAJD 1YEEH 2BDNL 1JWUA 1IBGL 2CRIA 1MFDH 2K1MA 5A2KH 1U8QB 3ELAT 1BLNA 4CU8A 4ZXBA 3MJ9L 3IU3B 4LF3B 5IFJA 2A83B 3BP6A 1Q72L 4XXDB 4JM4L 1ZHKB 1TVDA 3P11L 3VE0A 3QIWD 1WAAF 2GKIA 4K3GA 2ADIA 5BVPL 4F33B 4ZUUB 4XH2A 2EZ0C 5CSZB 4O9HL 1Z3GH 1AGFA 2Z31B 5I74C 1FL6A 3RRQA 4U6YA 1BFOA 3MLWH 4C83A 4XNMB 4N0UB 1FYTE 3IF1A 3KAAA 3S5LB 1KTDB 2UZXB 5FB8A 3W39A 1OAZH 4MJ5A 2F8VA 3DSNA 3WXVL 2ZG3A 5IJKC 1JNNL 1NEZA 5HYJB 4GQ9L 4LLQA 4WNQB 2UUDK 1J0JA 2B4CC 5GS2D 3UDWA 3U9UA 3AMLA 5D1XC 3SE3C 3MUY1 2DQEH 3OKLA 4QRPB 5IHZB 1A64A 4R8WH 1A14H 4NO0A 3K2UH 4ZODA 2OR9L 1BIIB 1ODAA 2AEQH 1KIRB 3ARDB 4JQVC 1K8IA 3S34L 4LRIC 5CP7A 2F54D 1ONQA 3KPNA 4JO3L 4HIEB 4OD3L 43CAA 5H94A 4EVNA 1M71A 1JPFB 4IEFB 3OGOE 3PWVA 3UYRH 2P5WB 4PRIA 1QSEE 3FB8A 3C60C 4TOYL 5C7XL 4TUKH 5FGCB 3ZE1E 1SY6H 3E2HB 1EEQA 4AQ1B 4TVPL 5EA0H 1CTNA 1I9JH 1KCUH 1HILB 2OTPA 2ZNWA 4GBXA 3S7GA 4NKOB 4YK4C 2QR0B 1A6VH 3HPJB 4L4VD 5C0JB 5HYQA 4FTVE 4HFUH 4Y4FC 4HUVA 3HFML 2FEDD 3EO0A 5JDSA 5HJ3A 1PG7W 3OZ9L 3WLWD 1SYVB 3UBXA 1CFQB 4XWOC 1FFQA 4QOKD 1WC7A 1SJEB 4EUPB 4K94C 3N06B 4QRRB 4KGJA 4UINL 3RNKA 4QWWC 4ETQB 4GKNA 5JW5A 4IOIA 1A6WH 1OF2A 4OV6F 1X5XA 4G7YL 1MJJB 3QXDB 4GXUN 2QHRH 1N59B 1SEBA 3SBWA 1P4IH 1QLFA 2D7QA 4PJEE 2MFNA 4UDTB 1NAMH 3QDMA 3U6RB 3UTPE 4AL8L 1CFTB 4XXCC 1DZBA 3O4LB 4YBLC 1W0YT 4WCYL 2QADB 4NCDA 3TN0B 2NZIA 1RUKL 3C5SB 2GJ6E 4OZGA 1JE6A 5LGHL 1NFDA 1X3DA 3KPMA 5IF0A 5ADOL 5L8LB 1HINL 2H9GA 4HK0A 1NCAH 1YEKH 5J3HC 4X4YB 2DTML 2YUWA 4P2RB 1NC2A 3WIFA 3CZJA 2AV7B 3HB3C 3MV01 1MCOL 4WHYH 4FQLH 2W0FB 4HV8B 2PR4H 5DJYA 4Y4HC 4P3WA 1OLZA 1VACB 3OL2A 4XVTH 1XIWB 4KI5E 2J6EL 5E9DA 1MCHA 5EO9B 4ZTPL 4Z7WE 1QLRA 3D0LB 4HKZA 3SDDC 2EIEA 2ADFH 1IGIH 3CMOL 3VXSA 1YECL 1PBYA 3L3OB 1HQRA 3KGRA 4PJAB 2YEZA 3CFDB 4OJFH 3G5VB 4RNRA 3U83A 1GCFA 1MHCA 2DM2A 3QO0A 2OCFD 4WO4C 3TO2B 3T3PF 2HMID 2JELH 3E6FA 4Q9RL 3P2TA 5TE4L 3VRJA 3O6FD 2V17H 4MMZC 4R4BA 5ESAA 1GHFH 1T5XA 4JVPA 3ME0A 1AHWC 4Z0XB 1CXHA 5A16B 5HGDA 4LARL 5LXGL 4DAGH 1FNEB 4ZUVA 1PW3A 4BZ1H 3FTGB 5ENWB 1WTLA 1W72A 1UM4L 2XA3A 1IE5A 3JWOC 5I73C 3MGOA 5FGBA 2XZAH 1L7TH 2GY5A 2MQ3A 5TF0A 1QFUH 1ZHLB 3TVMB 4X6DA 3OKYA 4PJBF 5MEND 4JM2D 3HI5L 4Q97A 1JGDA 4P5KA 1TQBC 4U1SA 2AEPH 2MJWA 2AJVH 4WUKL 4XP4L 4K3HA 4UIMA 1G7QB 1SYSB 1KFAH 1FYTB 4DVRH 1YEJL 4M5ZH 2A77L 1V8HA 3MOBL 1N8ZB 5C2BH 4P5MB 3HE6A 3LS5L 4U0RB 1IGYA 3GJEA 1QSFE 4YNYA 1CICC 5LWYH 5E6YA 3L3KA 1KXQE 3K0WA 4U1NB 4LPWA 1I1YA 1ZKAA 4DQOL 1MCJA 5KN5A 1EEZA 3ARGC 1B3JA 1HHHB 4HCRA 1WFTA 3OWEA 5MEQB 2AABL 4LRNL 1FV1A 4YWGH 1SJHB 3MZGB 1FPTH 1DQML 1IC5H 4YEEA 1R6VA 4M8QA 4I18A 3BAEL 4WTWA 4LLMB 4U6VL 1R5VA 2B39A 3RJQB 4LSPH 2P8MA 1QSEB 3FB6A 3HZKB 2NMSA 5EU3B 4EDWH 4UT6L 4Z5RB 4HC1A 3WE6B 3PGCB 4LCYB 5J6GA 5FV2A 1E6JH 1ZSDB 1MELA 1S7QA 2Q20A 4KJWC 5DJCA 3I75B 3VFWB 5HI5C 2VXQL 4FQ2H 3REVA 3T77A 2R4SL 3OX8B 4GLRH 3MV8D 4G8IB 3KYNB 2IG2L 4WDIA 5C09D 2ED9A 3P9MB 4FTVB 4O58H 4Y88A 4BFIA 4N68A 2NW3B 1F45A 1BJ1J 4Q6IB 2YN5A 2P7TB 3C5JB 1UC6A 4XNYL 5ERWB 4CAGA 1JBJA 2G9HA 1P9MA 1A1MA 2CO6B 2EC9T 4NWUL 1FNSL 3GMPB 2VISA 1MHHA 4GQPH 2DOCA 2X2YA 4Y1AD 1DN2A 4MD5A 2VDRL 4HG4K 5DD1H 2HLFD 2Q7YB 1LMKA 5ISZA 2AJYH 5TQ2H 5IESL 2BNQE 3S35H 3VFRA 3QG7H 4LPYA 1RIUL 1WBYA 1QFPA 3RHWF 1RZJH 3BGFC 3MV7A 3ETBF 5DO2C 5EBWA 4PJEB 5IFAL 2O5YL 2VABA 2OQJA 3WIHH 4X5XA 5ESQB 1QBLL 3SDAD 1FNFA 1KT2B 1R5WA 1C1EL 2GJ6B 4OZFB 1AI1H 2FJHB 3RY4A 5F1NA 4DN4H 5JW3H 4F15C 2BC4A 4KPHH 2C3HA 2H2PD 4PRNB 5C70A 4Z77B 5FECA 4FN0A 5D7IE 2Z35A 5FM8A 3RWEA 5KVFL 4DZ8A 3NACL 4LMQE 4G6AD 4PTUA 5TPWL 2XN9E 3T1FA 5FUCE 1OTUC 5DVOA 3QDGD 1S7UA 1RIHH 2Y6SC 4RQQA 4BZ2H 3HC4H 4Z7WB 1FNGB 4L8SC 43C9B 2V5TA 4FQHB 1NJ9B 3ULSA 3GUTA 4KHTH 5E08H 1CXFA 4C54A 3FB7B 4HBCH 5DT1H 2B0SH 2DS4A 1NCBL 3ARTA 2NLJB 3KXFD 2R69H 3SO3C 3GMOA 3X13A 1D5MA 4ZYKB 1EAJA 4UQ2A 4PG2A 5IFHL 1F3RB 2NXZC 1AXSA 3AAZB 3FO2B 5CMAA 3KYKH 4Z7NF 5ITBL 4YXHH 2AI0L 1YQ2A 2NXYC 3RVUC 1BVLA 3CFBB 4F3FA 5JXED 5T5NG 1S7TA 2FSEA 1EHLL 4D9LL 1RFDH 3P0VL 3PIQA 5EUOB 5C9JB 1BZ7B 2E7HA 4PD4K 3RFZC 4J1UB 4Y16A 1JRHH 1DBJL 1LO0H 5INCA 3T3MF 1IL1A 2EDHA 4NC1E 4AEIL 2HT4D 2X1WL 4JKWA 4P5TC 4WW2A 3FCTB 4G8GD 4JY4A 3V8OA 1QR1A 3VWKA 3D2UD 1L9NA 4YEFA 4GG6E 1RUPL 2EO9A 2CK2A 4Z8FH 5EC1A 1T7ZA 3OJDB 3GSQA 1OWRM 4ERSH 4K9EC 2YUZA 3WNOA 3O81A 4YQXL 2F8XC 1YPZA 1RZGB 2ORBL 4J3TA 5ESVA 3MJ9A 5JHLH 3P30H 1J1OL 3T65B 1N2RB 4H5SA 4ODWB 1KEMH 2RCSL 3QXWA 5TFSH 2BX5A 5I1HL 4NJ9L 1QSFB 1F3JA 1YEHL 4G9FA 4L3EA 5LQBL 3PWUA 2XFXA 4P23B 2CMRL 4OFYA 4QRPD 3LCYA 2NNAB 3I9GH 3PWPE 3MRMB 4XNUH 5LG1A 2VQ1A 3TNMA 3JV6A 4QXTA 2DBLH 5CBAA 2XKNA 4S1QH 4PJCF 3DURA 5JUEH 5DJ8B 5DWUH 4XCCH 2WMPA 3CFCL 3TF7C 1JCKA 1I7RB 4BH8B 3KYMA 4GXUM 2Y9RT 1WJ3A 4XCYB 1I9RH 1ORQB 1O0VA 3P73B 1QNZH 4WFHE 4LNRB 3DV4A 4XAKE 5D7LA 3RUGE 2FEDC 3O2VH 2W65B 3TBYA 1J5OH 5TDOA 3QUKB 3B3IA 3B6SA 4ZPTA 1RK1A 3IDXH 3WFHB 4ZUTB 2F5AL 2OL3B 5JHDA 5H35B 1XGPB 5FYKU 1BZQK 2DAVA 1LD9A 3TBVA 4EN3D 3N1PC 2BVQB 3P9LB 1N3NB 3DI3B 3FRUA 3QAZC 2PW1B 3DNKA 1UB6A 1GRWA 2HFEB 3S36H 4OT1H 8CGTA 1KB5B 5GZND 3U7AA 2WBJD 4GFTB 4TYUA 4NO3B 4N5UA 4KKCD 4PGDA 2BNQB 5GHWL 1WQVT 2VXUH 1I1AC 3OKNB 5HI3D 5E99L 4XBPB 1FGVH 4YE4L 1AXTL 2HVKA 3GM8A 5J57B 1Y18A 4JFEE 3QEQD 1IKFH 2E6QA 1CR9L 2XTLA 5A1AA 3QXAB 3ZTJH 1BQUA 2C3XA 1EGJL 2FR4A 5D7SL 3O4LD 3U0PB 1KN4L 4XB8A 5E2VL 3EOBB 4I9WE 3DVNB 1DLFL 4HKXA 4NWTH 5DURB 4POYA 4FQJH 5D7KE 1OT2A 5IB1A 4D8PA 4LQ1A 1EMTH 2YXFA 3QWRA 2CLVA 1PSKL 1U8HB 1I8LC 2E27L 3L5WB 1A3LL 1WBZB 4MNGE 4KVNL 3ARBD 5D7IB 4RCAA 4OZGF 3IETB 4XP6H 4HHAB 4WJ5B 3WXWH 3PP3H 1CE6A 4KJQD 3FJTA 3FQXB 2XN9B 3INUL 1CVRA 1N7MH 4MNQE 5EZLB 1BIHA 3QB7C 5KSAD 1MFEL 4CNIB 2NW2A 2P5EE 1ZT4B 4IDJL 4LLAA 3QJHB 1G9NL 3HZYA 3SGJC 2CJUH 3H7BB 4H8WL 5BXFB 3EGSA 5BOZG 3CJJA 4YR6B 4XNQB 4NKMA 4QCIB 3IFOB 1U0QA 5ID0B 3PV7A 1DFBL 2J88L 3GSOA 5D9SB 4JRXA 4XC1H 4HPYH 5HPOA 2F9BT 3KPSE 4P9ML 2XICA 5DQ9B 4NM4H 4YHYC 4GRLB 4ZFOA 1G9EA 1T1XB 1JGEA 5GRUL 3RWJA 4OSUL 5GGTH 3JV5A 1MJ8H 4XHJC 3LV3A 3NPZB 4K3EL 2YN3A 2VLMD 4G6FD 2BRRH