2IBZD

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2ibzD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2ibzD02
1IZL0 3A0HV 3HQ8A 1VYDA 1YEBA 3ORVA 2C1DB 2C1VA 3L4MA 2K9JB 2V08A 2BCCD 3WFCC 3VMAA 1H9YA 1ZRTD 2Y0DA 4FB1A 1DW3A 3VRDA 1IO3A 4FAVA 2D0WA 3C2CA 1ZZHA 5CIGB 3PRJA 2ZXYA 2GIWA 1LMSA 1I8OA 2Y0CA 2Q3EA 3OCDB 3SLEA 3WUIA 5CIBB 2CE0A 1FI9A 1CSUA 1CORA 1FI7A 1R0QA 1S6VB 2C1DA 1C6SA 4UB8V 1I6EA 1CXCA 1P84D 1KIBA 2C1UA 2C8SA 4RSZA 3NWVA 1I55A 2ZZS1 3O5CA 3CXHW 1EZVD 4QAOA 1J3SA 1GDVA 3TF5A 1FI3A 4O1QA 4LJIA 4DY9A 1KYOD 3DMIA 1CYCA 2C2CA 3GG2A 1B7VA 3WC8A 2A06D 2BPBB 1NNOA 5AURA 3VYMA 3HQ7A 2FYNB 2ZOOA 3A0BV 2HV4A 3CU4A 1CO6A 3H1KD 2JQRA 4NFGB 2YK3A 1K3HA 1OAEA 5CIEB 3ZOXA 2QG4A 2RN0A 3DP5A 5KAIV 4WQ7A 5IY51 2CE1A 2FYUD 3PXTA 3PTZA 3ZBMA 1KB0A 3CP5A 1A8CA 1H31A 3WFDC 2KS1A 1YCCA 4WQCA 1YIQA 351CA 1YFCA 1I8PA 2BH4X 4EIEA 1M70A 1F1FA 1IRWA 1AKKA 3MK7B 3SXTA 1LC1A 1DIIC 3PHLA 1CIGA 1U75B 2BCNB 2AI5A 4EICA 1C6OA 3RLMA 1CTYA 2BGVX 5CICB 1CCHA 2JWAA 3TYIA 1CRHA 1OCDA 4JCGA 5DFSA 1DVVA 3OA8A 3L71D 2ZBOA 1I54A 4AANA 1HJ3A 3PXSA 1S5LV 2D0SA 3CYTI 2GC7D 1L9BC 5TJHA 2N3YA 3ZCFA 4AAOA 2QJKB 4P4QB 5CIDB 3RMZA 4WQEA 4PWAA 3PXWA 1I6DA 1H33B 3FWLA 1NU1D 1SQVD 3NBTA 4GEDB 2LITA 4L3HA 1YTCA 1AYGA 4V2KA 4O1WA 1HJ5A 3RN0A 5KLIB 4YE1A 1YNRA 1IQCA 2MHMA 1FOCA 2ORLA 2VHDA 4D6TD 2N18B 4MU8A 1DIQC 1HRCA 2LIRA 1N50A 3WFBC 5KAFV 3KHUA 2IBZD 2QJPB 4PD4D 5KLVD 5B66V 3L73D 1CSWA 1H1OA 1EB7A 3RN1A 4WQBA 1GKSA 1DW2A 2BH5X 2B0ZB 3ZIYA 1IRVA 1H31B 3H1JD 1H33A 1W2LA 1H32B 3L4OA 2PCBB 1YICA 3O20A 1KV9A 5H2FV 1MG2D 5CIHB 3O1YA 4FA5A 1JDLA 4IL6V 1CYJA 4GYDA 1N15A 3L72D 1DT1A 1C6RA 4RJTA 1KX7A 2FWLA 3X39A 2MTAC 5DJQC 1CSVA 2GB8B 3H1ID 5C0ZA 3SVWA 4AAMA 1I5TA 1MG3D 1DW1A 1WEJF 3TDKA 4FA1A 3OA8B 1SQPD 2B11B 4L1QA 4FA4A 451CA 3SWSA 4FANA 1AOQA 1BE3D 1H32A 2DVHA 3JBTB 1GQ1A 2CA3B 1KB9D 1CRCA 3MK7C 1LC2A 3WFEC 5B6QA 5KKZB 1CEDA 1CC5A 2YCCA 2XTSB 1HZVA 1RAQA 3TGUD 3M97X 3O0RC 2BLFB 2PACA 4WQ9A 4A7PA 1C2NA 1HH7A 3L74D 1M6ZA 4XXLA 2QJYB 1QN2A 4EIFA 1A2SA 1GIWA 1CNOA 2RMZA 5EXQA 1E29A 1CSXA 1NMLA 1CYIA 1YEAA 4XYDB 1QKSA 1GJQA 1QL4A 1AOFA 2Y0EA 3CX5W 1CRYA 1BGYD 2L91A 1PP9D 1L0ND 2GC4D 4WQ8A 2O3JA 5B5EV 5E79V 2B12B 4AX3A 3CXHD 2YIUB 4J20A 1RZ6A 4FA9A 1QYZA 2N9JA 2AIUA 4Y5RA 1CHIA 1LS9A 1RAPA 2I8FA 2N9YB 1COTA 1HCMA 2B10B 2N18C 3H1LD 4H0JA 1QL3A 2C9XB 3PH2B 4PW9B 5CYTR 2JTIB 2DGEA 2OZ1A 1CXAA 1NTKD 1CCRA 2N9IA 3ZOWA 3NBSA 1C2RA 1CHHA 3PLNA 1FJ0A 2PCCB 1FCDC 1LFMA 3A9FA 2EXVA 5TISV 1L9JC 1C7MA 2CXBA 3ZOYA 1N90A 5C9MA 1HZUA 1CRGA 4H0KA 3CWBD 3SJLA 1F1CA 1CIFA 3GW6A 1W5CT 1CIEA 3H1HD 3DR0A 5GTHV 5CIFB 4PJ0V 2L4DA 1NIRA 1RZ5A 1M60A 2KNCB 1N9CA 1CHJA 1C75A 1NTMD 3L70D 4AALA 4WQDA 3OCDA 1KYOW 2N3BA 3KZIV 155CA 1FHBA 1HROA 1WVEC 1HJ4A 1A56A 4EDFA 4U3FD 1BCCD 1SQXD 1MZ4A 3WU2V 3VNWA 3HQ6A 1K3GA 1KX2A 4KMGA 2YQBA 4EIDA 4UB6V 1BL9A 4K3IA 3ZOOA 1C52A 2FRCA 4L3GA 1CIHA 3BCCD 1CTZA 1E8EA 3ITKA 1CRJA 5DJQB 3L75D 1CTJA 2AXTV 4Q5PA 5DF5A 5GTIV 1NMIA 4N0KA 1E2RA 1H9XA 2B4ZA 1CRIA 2ZONG 1L0LD 4WQAA 2CA4B 1ETPA 1U74B 3CX5D 1PPJD 1DW0A 2OZ1B 3HQ9A 1NTZD 1DVHA 1SQQD 2V07A 1GU2A 1SQBD
chains in the Genus database with same CATH superfamily
1KYOH 3E7KA 1RE3A 1VYDA 2LXBA 2OTJP 4HJGH 2K9JB 2V08A 1YQ4C 4UB6H 2BCCD 5KJ7C 3WFCC 1KILD 2KLVA 1M1JA 3HE5A 4YPCA 2IBZG 2D2CC 3L73G 4FAVA 3GF7A 1ZZHA 5CIGB 3IFMA 2ZT9B 2QIWA 3H1JG 3PRJA 1KB9E 1KFMA 4GT1A 3N4XA 2WPVB 2J5UA 1I8OA 2WITA 3OCDB 2WVRA 5CIBB 4W7YA 2H7HA 1CORA 3NMDA 1S6VB 2C1DA 3GF3A 1C6SA 4UB8V 1I6EA 2C1UA 1KIBA 2C8SA 4K3AA 2XKMA 3CXHW 1L0LE 4QAOA 1GDVA 1PPJE 4O1QA 2YMKA 4O9BA 5E79H 4I7ZC 3L71J 1FU1A 3RK3B 4UB8E 2PP6A 1JCCA 1OZHA 3MZWB 1N7SB 1VPCA 2A06D 1GL2A 3OAKA 5AW7B 5C39A 4GOFA 3BASA 5CCGC 2K9YA 4YXDC 1NNOA 1L0NE 3VYMA 1JY3P 2P10A 3RBXA 1ZRTE 5CMZA 3P8MC 1LT1A 1LTIC 2OQQA 2A45H 2YK3A 2QG4A 2RN0A 1NU1J 1SQVJ 5TISH 1N86A 2NPSB 3GHGA 4WB4A 2IX7C 4JF7A 3VMXA 1L0LG 3Q3DA 1PPJG 1Q86Q 1LTAC 3OJAB 1FZBA 2QJYC 3PXTA 3PTZA 4D6TJ 4PJ0H 3CP5A 1J2JB 1Y47A 3SWFA 1H31A 4JPZB 3HUSB 1M1JB 1YIQA 4OVNF 1YYCA 1I8PA 2WMMA 1PP9G 1L0NG 4EIEA 3D6ZA 1QVGO 3RL0C 1BDDA 3V6IA 1LC1A 1DIIC 1CSBA 2Q6QA 1CIGA 1SQXK 3A7OA 2AI5A 4I2LC 1C6OA 1HBWA 3RLMA 3MP7B 5KAIH 1OCDA 4JCGA 3OA8A 3G71P 2ZBOA 1I54A 4AANA 3LW5J 3Q5SA 3H1IJ 1BCCE 2J58A 3RK2C 3EWKA 3M9QA 2OYOA 1JCDA 3LW5H 2B87A 4PWAA 1BE3J 1I6DA 1AQ5A 4B86A 1LWUA 1VQNP 3I5CA 2ZVOB 4O1WA 1KQLA 1HJ5A 3RN0A 3TGUJ 3EFGA 2YKQA 3SWYA 1IQCA 2MHMA 5DJTB 2E42A 3GHGB 2P7JA 1W2BO 1PGPA 1HRCA 3RK3C 2LIRA 1N50A 1S5LH 5L8RJ 1KILB 3IR9A 2IBZD 2CPSA 3VMZA 1N7SC 1BCCG 5KLVD 5B66V 3L73D 1H1OA 3RN1A 1GKSA 2B0ZB 1IRVA 1H31B 3H1JD 5AVXB 5CJ0A 1FZGA 4DOJA 2PCBB 2QE7H 3L71E 1YICA 1DD3A 3O20A 3AE4C 1OVVA 5CIHB 2NPSC 3P7KA 3LIDA 5K5GB 1CYJA 1RE3C 2WZ7A 4L76A 1KX7A 1G2CB 1OIPA 4WWIA 2XZRA 5DJQC 1L4AA 5C0ZA 3H1LJ 2ITAA 1AA0A 2IDBA 4BRYA 3OA8B 1NTKJ 1G1JA 1M1JC 2XDJA 1SQVE 2XNDH 2NRGA 2QA4P 1AOQA 2XNXA 1H32A 1BDCA 3CCEP 1KB9D 2WT7B 5APWA 1JY3O 4C46A 5KKZB 1FZFA 1EZVE 4D6TE 2YCCA 3CWBJ 3L71G 3GLMA 1HZVA 2W83C 2BLFB 3H1HJ 4A7PA 1M6ZA 3U59A 2R5BA 2IYOA 1PGQA 1LNQA 1NGMB 2QM8A 5CCHC 1DD4A 1VQ6P 1MZ9A 2WSCJ 3L70J 1SQVG 1YEAA 4LLHA 3MIWA 3FGAD 2M3BA 4XYDB 1S9KE 1IFIA 1HVVA 3HE4A 4N78E 1PP9D 3CC2P 1L0ND 2WSCH 1EZVG 3NXSA 5M1BA 3AE3C 2R3SA 3CC4P 4AX3A 3D0WA 3H25A 3CXHD 2YIUB 1RZ6A 1QYZA 1M56D 3L75J 3GHGC 1QL3A 2POHA 4PW9B 5CYTR 1BE3E 2JTIB 2OZ1A 2YXQB 1CCRA 2DW3A 1KILC 1L4AB 1FJ0A 1NH4A 2AXCA 1VQ5P 1M90Q 3A9FA 2EXVA 3CLQA 3W68A 1C7MA 3S9OA 1ZN5A 1N90A 1JTHA 5C9MA 4H0KA 3W67A 3WUUA 3K5BA 1F1CA 2M0BA 2WSFJ 1W5CT 3G4SP 3C1LA 5CIFB 3CX5H 2FYUG 2Y9YA 1SFCA 2E76B 2E75C 1RZ5A 1NU1K 5AW0B 5AVQB 2LKMA 2WSFH 4U7JA 3L35A 1GU5A 4K35A 3WUTA 1HWTC 3KZIV 2GUSA 4EOTA 4EI2A 1BCCD 1ZXGA 1MZ4A 3VNWA 3H32A 2M5AB 2B89A 3LIEA 5KKZC 3USSA 1BSNA 3H1LE 1BL9A 3JC22 2HFED 1T3UA 1NTKE 3HE4B 4BWNA 1KORA 3QH9A 3A0BE 1KTMA 1CTJA 5DF5A 2R44A 4PD4E 2NZ2A 3HRNA 1E2RA 1ZR2A 1H9XA 2B4ZA 1CRIA 2YO2A 3V2QA 1ETPA 1NTMK 5CCGA 1DW0A 4L75A 3SFDC 4H0LD 2OZ1B 3HQ9A 1DVHA 4KT0J 2R5DA 4P4QB 1UIIA 3A0HV 2MJZA 1M57D 2N1TD 4WY4D 1R5LA 3NFQA 3ORVA 3H1KJ 3H1LG 3L72E 3L4MA 2YNYA 1NTKG 5AW3B 2AEMA 3A5TA 4FB1A 1DW3A 3CX5I 2AXTH 1IO3A 1SFCB 1MFTA 1OFCX 2ZXXA 1L4AC 1H0TA 3AEAC 2O01J 3F89A 1JY3N 2HYNA 3WUIA 3CC7P 1FI9A 1CSUA 1OMIA 3L75E 1R0QA 3PP5A 4Y99B 1SQQK 2K9JA 1NKZB 1CXCA 3L72G 1SLQA 3O6QB 4H13D 1I55A 2K37A 3O5CA 1EZVD 2E76C 1J3SA 1JO5A 1FI3A 1IZNB 3CCVP 4LJIA 1VDFA 1VF5D 3IF4A 3HTKB 2LR2A 2C2CA 3GG2A 2H8PD 1U57A 1ZP0C 2KS1B 2FYNB 2ZOOA 2O1KA 3CU4A 3L75G 3WUVA 1IFPA 3ZOXA 3DP5A 1Q2NA 4N78D 4WQ7A 1OVUA 3RL0g 4QMAA 2FYUD 1UIXA 4PV1D 3N7NA 3I56P 3CXHH 1N7SA 2E74C 4ZKUA 3WFDC 1P84E 351CA 1WRGA 1YFCA 2WSSH 2AEFA 1A02J 1IJDB 1YTZI 2N9BA 1NHLA 2GM4A 3MK7B 3PHLA 1K04A 2NPSA 2KZIA 3JSVC 3A3YB 5CICB 2JWAA 3TYIA 1CRHA 1GL2D 1DVVA 1KB9I 4IFFA 4L74A 1SFCC 2IYPA 4N6JA 4I6MC 3F5HA 3HUSA 4U3FE 1GW4A 1FZEA 3H1KE 5TJHA 1LP1A 1SQXE 3ZCFA 1KZUB 1URQA 1FAVA 4AAOA 4ASWA 1H33B 4Y99C 4BXLA 3TYYA 4GEDB 4H0LB 2LITA 1AYGA 3O8ZA 3VP9A 1VQKP 1HH0A 5KLIB 2XV5A 5DJUB 2N1TB 2YXRB 3MUDC 2VHDA 5CCHA 4MU8A 1DEBA 1DIQC 4OGQD 2JR8A 5B5EE 4U3FG 5KAFV 3KHUA 4PD4D 1HTLC 3H1KG 1SQXG 1CSWA 5AVRB 1X9VA 3CXHI 1VL2A 4OH8B 3TSIA 1DW2A 2BH5X 2FYNC 3JCUE 1PZQA 2PRRA 4Y28J 1BGYJ 5H2FV 2W90A 2QEXP 5KAFE 3O1YA 1GK6A 1FDMA 1JDLA 1IC2A 3L72D 1DT1A 2E43A 1LT9A 2P67A 1AJYA 3AEBC 1TU3F 1MG3D 2SPZA 1KILA 1T6AA 5GTHE 4FA1A 1SQPD 2B11B 4L1QA 5H2FE 3PJSK 1VQ7P 451CA 3SWSA 3HD7D 3L37A 2WTYA 5B66H 5KLVK 1LP1B 1URQB 4C7NB 1CRCA 1SP4A 3MK7C 3WFEC 4ASVA 2QM7A 4AYCA 2PACA 4WQ9A 1KYOE 1G2CA 2W8ZA 1QN2A 3L36A 1OW6A 1X22A 2K1AA 4UB6E 2ZYGA 1CNOA 1USEA 1QL2A 4XA4A 3B5ND 5EXQA 1NTMJ 5AW8B 2FYZA 2JEEA 1E29A 1CSXA 1NMLA 1CYIA 2ZT9C 4PV1B 1GJQA 1AOFA 1IFNA 2WT7A 3M9BA 3SSUA 1FBMA 1QL1A 4JQ0D 1H88A 4KHXA 5E79V 4FA9A 1A02F 5KLIC 1QLED 3BCCJ 2AIUA 1T8ZA 3SFEC 1RF1B 2JKVA 1LS9A 1ZOYC 2N9YB 1COTA 2B10B 1VQ9P 1NVOA 1RY3A 3L74J 3PH2B 2OYHA 2DGEA 1RQUA 1J1EB 1CXAA 1LT9B 2HODB 2N9IA 1JM0A 4RESB 1GZLA 2KOGA 5E79E 1LJ2A 1S1CX 3BVHA 1EC5A 3P32A 5TISV 1L9JC 2Z5HA 2CXBA 3MTUE 1HZUA 1CRGA 1SQQJ 1SQBJ 2Y9ZA 1T3JA 5AW2B 4PJ0V 2L4DA 2BCCJ 5TISE 1KC8Q 2WWWA 3AE2C 1N7LA 4YTPC 1FC2C 1BGYE 4AALA 4WQDA 2FBWC 1ZW0A 1FDOA 1NAYA 4PJ0E 1EZVI 3MGNA 3M0AA 2I1KA 4U3FD 4EDFA 3HUSC 3WMM0 1NU1E 3RK3E 1SQXD 1URQC 3T97A 2R3CA 3HQ6A 3U1AA 1K3GA 4K3IA 2FRCA 2KI7B 1LTBC 3MHVA 3AEGC 2A45G 1NAFA 2OGUA 1NMIA 4IL6H 3V4QA 3EFFK 3QWOC 4XE5B 5KAIE 3RBZA 2VRSA 1YJ9P 3FX0A 1YJNP 4AUWA 1BGYG 1L0LD 3FXEA 2CA4B 1PPJD 2KYVA 2JP3A 3Q5RA 5KJ7D 2R32A 2OYHB 3KZIH 3L4FA 4R4MA 2M5AA 1NU1G 2ZFCA 2RKLA 3HD7B 2P1JA 1KD1Q 2D2CD 3H6PA 3FWNA 2C1VA 1VQLP 4JYCA 1NTME 4D6TG 3H1IE 1ZRTD 1OW8A 1RF1C 3D6YA 3AEDC 2FXMA 1J1EC 2D0WA 1LT9C 3C2CA 1DH3A 2PFXA 3KDPB 2JJLA 2O1JA 4MN4C 1LMSA 3BCCE 2Y0CA 1S5LE 3SLEA 2G3AA 2CE0A 3TGUE 2J59M 3I55P 4ZKPA 1FI7A 1WT6A 3L74E 1YBKA 3A0HH 1GW3A 1XTGB 2FY8A 3T97B 1NTMG 2Q9IA 1HGVA 1D7MA 3H1IG 5CCGD 3TF5A 1LGHB 4DY9A 1KYOD 3M9HA 1SQQE 1AVYA 2Q5UA 4M3LA 3S1KA 2OYIB 4GDOA 1BE3G 3WC8A 1MUUA 1KQFB 3G9RA 3BCCG 3A0BV 3AE9C 1KILE 3TGUG 1CO6A 5CIEB 4NFGB 2ZAEB 1OAEA 2I8DA 3L74G 3O6QA 3M91A 4PD4I 1FZCA 1SVFA 2YMYA 3MUDA 1GU4A 1MFZA 1NWQA 3CCSP 3HTKA 3ZBMA 1RH5B 2W6AA 2HLOA 3IAOA 3RL0D 1KB0A 1SQQG 1ZLLA 4IL6E 1YQ3C 1A8CA 2KS1A 3G6EP 1YCCA 3G3ZA 2MKVA 1CI6B 2ZXEB 5KLVJ 3L73J 2OYHC 1S3JA 3CWBE 1PFIA 3IN6A 3H1HE 3H1JJ 2QRXA 5BVZA 1AKKA 3HD7C 3SXTA 2BEQD 2JO1A 1JMBA 1U75B 2BCNB 2P2UA 1EXIA 3WU2H 3RK2D 1CTYA 1CCHA 3L70E 5APYA 2YIUC 5DFSA 2GA1A 3L71D 1HJ3A 2FXOA 2D0SA 1FDIA 3CYTI 2CK3H 3S4RA 1CW5A 1JOCA 1L9BC 2FFDB 5GTIH 3VOPA 3GMAA 2QJKB 3B8EB 3CWBG 3UIAA 2XU6A 2BASA 1VQOP 2PAJA 3RMZA 2OARA 3AEEC 3H1HG 3PXWA 4H44D 1NU1D 1SQVD 3NBTA 5AVSB 3BRVB 3II6A 1NTZK 1YTCA 2YO3A 4V2KA 1SQBK 1N7SD 1YNRA 5APXA 3L70G 1VQ8P 4D6TD 1FZCB 1XTCC 1NJIQ 1KB9H 1PV3A 3CX5E 1Y8AA 4TLFA 3Q5PA 2QJPB 2IFMA 2OYIC 2WSEJ 2C0WA 2JWDA 3P8CE 3AE8C 2KSEA 1H33A 1DEEG 2P58A 4YXWH 1W2LA 1LTJB 1PP9J 1L0NJ 3AE1C 1MG2D 2WSEH 1S5LX 4FA5A 2N1TA 1S9KD 1KMIZ 4GYDA 1GK4A 4IFDK 4UB8H 2IBZI 3VYIA 4RJTA 2V4HA 2FWLA 2MTAC 1CSVA 3SVWA 3H1ID 4AAMA 1I5TA 1WEJF 1YJWP 4LC1A 4FA4A 1EDKA 2IZ0A 1E5WA 2LXCB 1BE3D 5AW6B 1GQ1A 2CA3B 4XFJA 1LC2A 1RF0A 5CCHD 2XTSB 2Q1KA 1JMMA 3TGUD 3E1RA 1GMJA 3O0RC 1AFOA 1HH7A 3L74D 4GODA 2QJYB 5KLVE 3L73E 5CHXA 1LTTC 1A2SA 5APUA 1RHZB 3PH0A 3H1JE 5AVTB 4NPDA 1R5SA 2Z4EA 5AVZB 2ZJSE 4WVZA 3B71A 2AXTE 1S4XA 2Q3IA 1NKNA 2QJKC 3ZDMA 1L2PA 1SQPK 5GTIE 1AV1A 1QKSA 3RL0B 3TNUA 3V4WA 1QL4A 2Y0EA 4C7NA 3V2NA 4IL6X 1MKMA 1BCCJ 1CRYA 2L91A 2WPQA 1VQPP 1ZV8A 2GC4D 4DCKA 5B5EV 5EFWB 4DJGA 4Y5RA 1PGJA 1K9MQ 2HPCA 5KLVG 3H1LD 1OVRA 1FZCC 1N8RQ 4RKUJ 4WY4B 3RK2B 1NTKD 1JY2P 1USDA 3VP8A 1NYHA 2QJPC 1DIPA 3NBSA 1C2RA 1CHHA 3PLNA 2QVAA 2PCCB 2B88A 1M8OB 4HB1A 2E75D 1OXZA 1LFMA 4KJMA 1HJBA 1K73Q 2KLUA 3ZOYA 1ZR4A 3CWBD 1LTJC 1CIFA 1LTGC 3GW6A 1CIEA 3H1HD 3DR0A 4RO0A 5APVA 1RF1A 5GTHV 3U1CA 2L5GB 4LGDE 5AVYB 2KIKA 5AW4B 4H44B 1M60A 3E1IA 1EDJA 5APSA 1N73A 2KNCB 1IFDA 1N9CA 2HODA 1CHJA 3L70D 2ZYAA 4H13B 1PP9E 1KYOW 1Z56A 155CA 1RQVA 1HROA 1AQTA 1A56A 1G1IA 3CXHE 1JNMA 1EQ7A 4CPGA 2RH0A 1VF5B 2AEJA 1M7LA 4EIJA 1KYOI 1Y9BA 4KMGA 2M3EA 3TNUB 4EIDA 4UB6V 3ZOOA 4JYBA 3OA7A 4L3GA 5CBOA 1IO4A 1CTZA 3ITKA 5DJQB 2Z5IA 3KQGA 3L75D 4N0KA 5AW9B 3R2PA 2H89C 4IFMA 3HE5B 4HYTB 2HPCB 3CCJP 3MD0A 2JDIH 3CD6P 4JBZA 4WQAA 1U74B 3AECC 3CX5D 1OWAA 3VN0A 1FE6A 4C7RA 3TK1A 1GU2A 3NTNA 1IZL0 3AE7C 3HQ8A 3P8CD 1K05A 1YEBA 3EQ2A 2C1DB 1AVOA 4NPFX 1JEKA 1HUCA 4H0LC 1L4AD 3VMAA 1H9YA 3C8VA 1KV4A 2Y0DA 1KFNA 3C9IA 3VRDA 2N1TC 4WY4C 1PL5A 1NO4A 2FYUJ 3A2AA 5APQA 1N73B 5APTA 1K8AQ 2ZXYA 3M0DA 2GIWA 1L0LK 1GL2B 4DT0A 2E76D 2Q3EA 3V2RA 3HD7A 4GKGA 2A45I 1QVFO 4TT3H 3CL3D 1QEXA 1NTZJ 1JUNA 1P84D 4RSZA 3NWVA 2KP8A 2ZZS1 3OW2O 3SWKA 1RF0C 4H44C 3KYQA 1L0NK 1NOHA 2H88C 3CI9A 1Q7YQ 3KXDA 1LTSC 3DMIA 1CYCA 4H13C 4OWFA 1B7VA 1JY2O 3BRTB 2BPBB 3B5NA 5AURA 3HQ7A 1R8EA 1HGZA 1VF5C 4OGQB 3BATA 3B4SA 2HV4A 2IZ1A 3H1KD 2JQRA 1YI2P 1K3HA 5B66E 5AVWB 1JB0J 4WBAA 2E75B 5KAIV 2E74D 3R4YA 2B9BA 3VTPC 1QX8A 5IY51 2CE1A 2FKWB 5AW1B 1T2KD 2OYIA 4WQCA 1Q90D 4GIFA 1FZAA 2BH4X 3CCMP 1J1DB 3V5BA 1M70A 4PV1C 1F1FA 1IRWA 1N2DC 2OTKE 2B87B 2HR3A 3A0BH 1SFCD 4DZOA 1LWUB 2CPBA 4EICA 4PD4H 2G8YA 2ZVNB 2BGVX 2C0XA 4ZNCA 1GDTA 3L72J 3PXSA 3ABVC 1S5LV 1YIJP 1RE4A 3AEFC 2GC7D 1N73C 1IFJA 2N3YA 1H8AA 1CI6A 1S72P 1SQPJ 1KQGB 4L73A 4HH2A 1GL2C 1YHQP 5CIDB 4WQEA 1ZMEC 3B5NB 3FWLA 1QGKB 2FYUE 2PGDA 2O01N 4L3HA 1X8YA 1E79H 2W6BA 2HG5D 4W7ZA 3FXDA 2KSJA 4YE1A 1FOCA 1KN7A 2ORLA 1X79B 2N18B 4Z1MH 3CMAP 1OX3A 3WFBC 2FFDA 1M1KQ 1NTZE 4BRYB 1SQBE 3Q2YA 2K3RA 3AE6C 1EB7A 4WQBA 3ZIYA 1DX7A 4OGQC 5KJ7A 1H32B 3L4OA 1WMKA 2BCCE 3CCRP 2WPSA 2K88A 1KV9A 2UWJE 1SQVK 4IL6V 1H89A 1N15A 1Q82Q 1C6RA 2E5TA 3X39A 2GB8B 1PIXA 1DW1A 1HF9A 3TDKA 1NTZG 2E5YA 3D71A 5AW5B 1SQBG 1OW7A 2KK7A 2KXPB 1Q81Q 2W6JH 4FANA 1J1DC 2DVHA 3JBTB 1LTJA 3M0DC 5B6QA 1CEDA 2BCCG 4ZMDA 1CC5A 3KZIE 1LWUC 2C9LY 4AQRD 1RAQA 3M97X 1C2NA 4XXLA 3CCLP 2H43A 1KQSO 4EYYQ 2ZT9D 4EIFA 3AE5C 3D70A 2GUVA 4IOIH 1MV8A 1GIWA 2E74B 1P84H 5KTBA 2A06E 2RMZA 3Q1MA 1U7JA 1JY2N 2WPRA 3V2PA 2Q7CA 2FYUK 1VQMP 1FJKA 4R4LA 1PGOA 4U3FJ 1YITP 3CX5W 1EXJA 1SQXJ 2C9NY 1FS0E 1BGYD 1IK9A 1JTHB 3B5NC 1S2EA 4WQ8A 2O3JA 2YKPA 2B12B 2KZJA 4J20A 3RK3D 3CMEP 5AVVB 2N9JA 1SQPE 2IPPA 1CHIA 1YTZT 3A0HE 1RAPA 2I8FA 1HCMA 4N3YB 5BU5A 2N18C 3CCUP 3CCQP 4H0JA 2D2CB 2C9XB 2A06G 2YKOA 3ZOWA 2V7QJ 1L0LJ 2IFNA 5AVUB 2I1JA 2OTLP 1FJPA 1FCDC 1HJ0A 1GTWA 4I1LA 2NPSD 1W5CE 2KUBA 3H32B 3SJLA 2O01H 1IK7A 2V7QH 4HKZH 2ZYDA 3VMYA 1NIRA 5B5EH 1SQPG 5BU8B 2M8RA 4WY4A 1CZQA 4W80A 1URQD 1FOSE 4I7ZB 3M06A 1C75A 1NTMD 1P84I 3OCDA 5CJ4A 2N3BA 3JCUH 1NTKK 1FHBA 1WVEC 1HJ4A 1RE4C 1IFMA 3WU2V 5KAFH 2KB7P 3CPWO 1BSHA 1KX2A 1VQ4P 2YQBA 2BEZF 5CBNA 2FXPA 1C52A 2W27A 1X0TA 1CIHA 3BCCD 1SS1A 3KPEA 1E8EA 1CRJA 4NPEA 1FOSF 5GTHH 2QSIA 2KNCA 2AXTV 4Q5PA 5H2FH 5GTIV 3WU2E 3RGUA 2IBZE 4GOEA 1EDLA 1EDIA 1U7MA 2ZONG 1GD2E 2WQYC 1H0TB 2FFDC 1NTZD 1T2KC 1W2EA 1SQQD 2V07A 1SQBD
chains in the Genus database with same CATH topology
1IZL0 3A0HV 3HQ8A 1VYDA 1YEBA 3ORVA 2C1DB 2C1VA 3L4MA 2K9JB 2V08A 2BCCD 3WFCC 3VMAA 1H9YA 1ZRTD 2Y0DA 4FB1A 1DW3A 3VRDA 1IO3A 4FAVA 2D0WA 3C2CA 1ZZHA 5CIGB 3PRJA 2ZXYA 2GIWA 1LMSA 1I8OA 2Y0CA 2Q3EA 3OCDB 3SLEA 3WUIA 5CIBB 2CE0A 1FI9A 1CSUA 1CORA 1FI7A 1R0QA 1S6VB 2C1DA 1C6SA 4UB8V 1I6EA 1CXCA 1P84D 1KIBA 2C1UA 2C8SA 4RSZA 3NWVA 1I55A 2ZZS1 3O5CA 3CXHW 1EZVD 4QAOA 1J3SA 1GDVA 3TF5A 1FI3A 4O1QA 4LJIA 4DY9A 1KYOD 3DMIA 1CYCA 2C2CA 3GG2A 1B7VA 3WC8A 2A06D 2BPBB 1NNOA 5AURA 3VYMA 3HQ7A 2FYNB 2ZOOA 3A0BV 2HV4A 3CU4A 1CO6A 3H1KD 2JQRA 4NFGB 2YK3A 1K3HA 1OAEA 5CIEB 3ZOXA 2QG4A 2RN0A 3DP5A 5KAIV 4WQ7A 5IY51 2CE1A 2FYUD 3PXTA 3PTZA 3ZBMA 1KB0A 3CP5A 1A8CA 1H31A 3WFDC 2KS1A 1YCCA 4WQCA 1YIQA 351CA 1YFCA 1I8PA 2BH4X 4EIEA 1M70A 1F1FA 1IRWA 1AKKA 3MK7B 3SXTA 1LC1A 1DIIC 3PHLA 1CIGA 1U75B 2BCNB 2AI5A 4EICA 1C6OA 3RLMA 1CTYA 2BGVX 5CICB 1CCHA 2JWAA 3TYIA 1CRHA 1OCDA 4JCGA 5DFSA 1DVVA 3OA8A 3L71D 2ZBOA 1I54A 4AANA 1HJ3A 3PXSA 1S5LV 2D0SA 3CYTI 2GC7D 1L9BC 5TJHA 2N3YA 3ZCFA 4AAOA 2QJKB 4P4QB 5CIDB 3RMZA 4WQEA 4PWAA 3PXWA 1I6DA 1H33B 3FWLA 1NU1D 1SQVD 3NBTA 4GEDB 2LITA 4L3HA 1YTCA 1AYGA 4V2KA 4O1WA 1HJ5A 3RN0A 5KLIB 4YE1A 1YNRA 1IQCA 2MHMA 1FOCA 2ORLA 2VHDA 4D6TD 2N18B 4MU8A 1DIQC 1HRCA 2LIRA 1N50A 3WFBC 5KAFV 3KHUA 2IBZD 2QJPB 4PD4D 5KLVD 5B66V 3L73D 1CSWA 1H1OA 1EB7A 3RN1A 4WQBA 1GKSA 1DW2A 2BH5X 2B0ZB 3ZIYA 1IRVA 1H31B 3H1JD 1H33A 1W2LA 1H32B 3L4OA 2PCBB 1YICA 3O20A 1KV9A 5H2FV 1MG2D 5CIHB 3O1YA 4FA5A 1JDLA 4IL6V 1CYJA 4GYDA 1N15A 3L72D 1DT1A 1C6RA 4RJTA 1KX7A 2FWLA 3X39A 2MTAC 5DJQC 1CSVA 2GB8B 3H1ID 5C0ZA 3SVWA 4AAMA 1I5TA 1MG3D 1DW1A 1WEJF 3TDKA 4FA1A 3OA8B 1SQPD 2B11B 4L1QA 4FA4A 451CA 3SWSA 4FANA 1AOQA 1BE3D 1H32A 2DVHA 3JBTB 1GQ1A 2CA3B 1KB9D 1CRCA 3MK7C 1LC2A 3WFEC 5B6QA 5KKZB 1CEDA 1CC5A 2YCCA 2XTSB 1HZVA 1RAQA 3TGUD 3M97X 3O0RC 2BLFB 2PACA 4WQ9A 4A7PA 1C2NA 1HH7A 3L74D 1M6ZA 4XXLA 2QJYB 1QN2A 4EIFA 1A2SA 1GIWA 1CNOA 2RMZA 5EXQA 1E29A 1CSXA 1NMLA 1CYIA 1YEAA 4XYDB 1QKSA 1GJQA 1QL4A 1AOFA 2Y0EA 3CX5W 1CRYA 1BGYD 2L91A 1PP9D 1L0ND 2GC4D 4WQ8A 2O3JA 5B5EV 5E79V 2B12B 4AX3A 3CXHD 2YIUB 4J20A 1RZ6A 4FA9A 1QYZA 2N9JA 2AIUA 4Y5RA 1CHIA 1LS9A 1RAPA 2I8FA 2N9YB 1COTA 1HCMA 2B10B 2N18C 3H1LD 4H0JA 1QL3A 2C9XB 3PH2B 4PW9B 5CYTR 2JTIB 2DGEA 2OZ1A 1CXAA 1NTKD 1CCRA 2N9IA 3ZOWA 3NBSA 1C2RA 1CHHA 3PLNA 1FJ0A 2PCCB 1FCDC 1LFMA 3A9FA 2EXVA 5TISV 1L9JC 1C7MA 2CXBA 3ZOYA 1N90A 5C9MA 1HZUA 1CRGA 4H0KA 3CWBD 3SJLA 1F1CA 1CIFA 3GW6A 1W5CT 1CIEA 3H1HD 3DR0A 5GTHV 5CIFB 4PJ0V 2L4DA 1NIRA 1RZ5A 1M60A 2KNCB 1N9CA 1CHJA 1C75A 1NTMD 3L70D 4AALA 4WQDA 3OCDA 1KYOW 2N3BA 3KZIV 155CA 1FHBA 1HROA 1WVEC 1HJ4A 1A56A 4EDFA 4U3FD 1BCCD 1SQXD 1MZ4A 3WU2V 3VNWA 3HQ6A 1K3GA 1KX2A 4KMGA 2YQBA 4EIDA 4UB6V 1BL9A 4K3IA 3ZOOA 1C52A 2FRCA 4L3GA 1CIHA 3BCCD 1CTZA 1E8EA 3ITKA 1CRJA 5DJQB 3L75D 1CTJA 2AXTV 4Q5PA 5DF5A 5GTIV 1NMIA 4N0KA 1E2RA 1H9XA 2B4ZA 1CRIA 2ZONG 1L0LD 4WQAA 2CA4B 1ETPA 1U74B 3CX5D 1PPJD 1DW0A 2OZ1B 3HQ9A 1NTZD 1DVHA 1SQQD 2V07A 1GU2A 1SQBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZL 0;  3A0H V;  3HQ8 A;  1VYD A;  1YEB A;  3ORV A;  2C1D B;  2C1V A;  3L4M A;  2K9J B;  2V08 A;  2BCC D;  3WFC C;  3VMA A;  1H9Y A;  1ZRT D;  2Y0D A;  4FB1 A;  1DW3 A;  3VRD A;  1IO3 A;  4FAV A;  2D0W A;  3C2C A;  1ZZH A;  5CIG B;  3PRJ A;  2ZXY A;  2GIW A;  1LMS A;  1I8O A;  2Y0C A;  2Q3E A;  3OCD B;  3SLE A;  3WUI A;  5CIB B;  2CE0 A;  1FI9 A;  1CSU A;  1COR A;  1FI7 A;  1R0Q A;  1S6V B;  2C1D A;  1C6S A;  4UB8 V;  1I6E A;  1CXC A;  1P84 D;  1KIB A;  2C1U A;  2C8S A;  4RSZ A;  3NWV A;  1I55 A;  2ZZS 1;  3O5C A;  3CXH W;  1EZV D;  4QAO A;  1J3S A;  1GDV A;  3TF5 A;  1FI3 A;  4O1Q A;  4LJI A;  4DY9 A;  1KYO D;  3DMI A;  1CYC A;  2C2C A;  3GG2 A;  1B7V A;  3WC8 A;  2A06 D;  2BPB B;  1NNO A;  5AUR A;  3VYM A;  3HQ7 A;  2FYN B;  2ZOO A;  3A0B V;  2HV4 A;  3CU4 A;  1CO6 A;  3H1K D;  2JQR A;  4NFG B;  2YK3 A;  1K3H A;  1OAE A;  5CIE B;  3ZOX A;  2QG4 A;  2RN0 A;  3DP5 A;  5KAI V;  4WQ7 A;  5IY5 1;  2CE1 A;  2FYU D;  3PXT A;  3PTZ A;  3ZBM A;  1KB0 A;  3CP5 A;  1A8C A;  1H31 A;  3WFD C;  2KS1 A;  1YCC A;  4WQC A;  1YIQ A;  351C A;  1YFC A;  1I8P A;  2BH4 X;  4EIE A;  1M70 A;  1F1F A;  1IRW A;  1AKK A;  3MK7 B;  3SXT A;  1LC1 A;  1DII C;  3PHL A;  1CIG A;  1U75 B;  2BCN B;  2AI5 A;  4EIC A;  1C6O A;  3RLM A;  1CTY A;  2BGV X;  5CIC B;  1CCH A;  2JWA A;  3TYI A;  1CRH A;  1OCD A;  4JCG A;  5DFS A;  1DVV A;  3OA8 A;  3L71 D;  2ZBO A;  1I54 A;  4AAN A;  1HJ3 A;  3PXS A;  1S5L V;  2D0S A;  3CYT I;  2GC7 D;  1L9B C;  5TJH A;  2N3Y A;  3ZCF A;  4AAO A;  2QJK B;  4P4Q B;  5CID B;  3RMZ A;  4WQE A;  4PWA A;  3PXW A;  1I6D A;  1H33 B;  3FWL A;  1NU1 D;  1SQV D;  3NBT A;  4GED B;  2LIT A;  4L3H A;  1YTC A;  1AYG A;  4V2K A;  4O1W A;  1HJ5 A;  3RN0 A;  5KLI B;  4YE1 A;  1YNR A;  1IQC A;  2MHM A;  1FOC A;  2ORL A;  2VHD A;  4D6T D;  2N18 B;  4MU8 A;  1DIQ C;  1HRC A;  2LIR A;  1N50 A;  3WFB C;  5KAF V;  3KHU A;  2IBZ D;  2QJP B;  4PD4 D;  5KLV D;  5B66 V;  3L73 D;  1CSW A;  1H1O A;  1EB7 A;  3RN1 A;  4WQB A;  1GKS A;  1DW2 A;  2BH5 X;  2B0Z B;  3ZIY A;  1IRV A;  1H31 B;  3H1J D;  1H33 A;  1W2L A;  1H32 B;  3L4O A;  2PCB B;  1YIC A;  3O20 A;  1KV9 A;  5H2F V;  1MG2 D;  5CIH B;  3O1Y A;  4FA5 A;  1JDL A;  4IL6 V;  1CYJ A;  4GYD A;  1N15 A;  3L72 D;  1DT1 A;  1C6R A;  4RJT A;  1KX7 A;  2FWL A;  3X39 A;  2MTA C;  5DJQ C;  1CSV A;  2GB8 B;  3H1I D;  5C0Z A;  3SVW A;  4AAM A;  1I5T A;  1MG3 D;  1DW1 A;  1WEJ F;  3TDK A;  4FA1 A;  3OA8 B;  1SQP D;  2B11 B;  4L1Q A;  4FA4 A;  451C A;  3SWS A;  4FAN A;  1AOQ A;  1BE3 D;  1H32 A;  2DVH A;  3JBT B;  1GQ1 A;  2CA3 B;  1KB9 D;  1CRC A;  3MK7 C;  1LC2 A;  3WFE C;  5B6Q A;  5KKZ B;  1CED A;  1CC5 A;  2YCC A;  2XTS B;  1HZV A;  1RAQ A;  3TGU D;  3M97 X;  3O0R C;  2BLF B;  2PAC A;  4WQ9 A;  4A7P A;  1C2N A;  1HH7 A;  3L74 D;  1M6Z A;  4XXL A;  2QJY B;  1QN2 A;  4EIF A;  1A2S A;  1GIW A;  1CNO A;  2RMZ A;  5EXQ A;  1E29 A;  1CSX A;  1NML A;  1CYI A;  1YEA A;  4XYD B;  1QKS A;  1GJQ A;  1QL4 A;  1AOF A;  2Y0E A;  3CX5 W;  1CRY A;  1BGY D;  2L91 A;  1PP9 D;  1L0N D;  2GC4 D;  4WQ8 A;  2O3J A;  5B5E V;  5E79 V;  2B12 B;  4AX3 A;  3CXH D;  2YIU B;  4J20 A;  1RZ6 A;  4FA9 A;  1QYZ A;  2N9J A;  2AIU A;  4Y5R A;  1CHI A;  1LS9 A;  1RAP A;  2I8F A;  2N9Y B;  1COT A;  1HCM A;  2B10 B;  2N18 C;  3H1L D;  4H0J A;  1QL3 A;  2C9X B;  3PH2 B;  4PW9 B;  5CYT R;  2JTI B;  2DGE A;  2OZ1 A;  1CXA A;  1NTK D;  1CCR A;  2N9I A;  3ZOW A;  3NBS A;  1C2R A;  1CHH A;  3PLN A;  1FJ0 A;  2PCC B;  1FCD C;  1LFM A;  3A9F A;  2EXV A;  5TIS V;  1L9J C;  1C7M A;  2CXB A;  3ZOY A;  1N90 A;  5C9M A;  1HZU A;  1CRG A;  4H0K A;  3CWB D;  3SJL A;  1F1C A;  1CIF A;  3GW6 A;  1W5C T;  1CIE A;  3H1H D;  3DR0 A;  5GTH V;  5CIF B;  4PJ0 V;  2L4D A;  1NIR A;  1RZ5 A;  1M60 A;  2KNC B;  1N9C A;  1CHJ A;  1C75 A;  1NTM D;  3L70 D;  4AAL A;  4WQD A;  3OCD A;  1KYO W;  2N3B A;  3KZI V;  155C A;  1FHB A;  1HRO A;  1WVE C;  1HJ4 A;  1A56 A;  4EDF A;  4U3F D;  1BCC D;  1SQX D;  1MZ4 A;  3WU2 V;  3VNW A;  3HQ6 A;  1K3G A;  1KX2 A;  4KMG A;  2YQB A;  4EID A;  4UB6 V;  1BL9 A;  4K3I A;  3ZOO A;  1C52 A;  2FRC A;  4L3G A;  1CIH A;  3BCC D;  1CTZ A;  1E8E A;  3ITK A;  1CRJ A;  5DJQ B;  3L75 D;  1CTJ A;  2AXT V;  4Q5P A;  5DF5 A;  5GTI V;  1NMI A;  4N0K A;  1E2R A;  1H9X A;  2B4Z A;  1CRI A;  2ZON G;  1L0L D;  4WQA A;  2CA4 B;  1ETP A;  1U74 B;  3CX5 D;  1PPJ D;  1DW0 A;  2OZ1 B;  3HQ9 A;  1NTZ D;  1DVH A;  1SQQ D;  2V07 A;  1GU2 A;  1SQB D; 
#chains in the Genus database with same CATH topology
 1KYO H;  3E7K A;  1RE3 A;  1VYD A;  2LXB A;  2OTJ P;  4HJG H;  2K9J B;  2V08 A;  1YQ4 C;  4UB6 H;  2BCC D;  5KJ7 C;  3WFC C;  1KIL D;  2KLV A;  1M1J A;  3HE5 A;  4YPC A;  2IBZ G;  2D2C C;  3L73 G;  4FAV A;  3GF7 A;  1ZZH A;  5CIG B;  3IFM A;  2ZT9 B;  2QIW A;  3H1J G;  3PRJ A;  1KB9 E;  1KFM A;  4GT1 A;  3N4X A;  2WPV B;  2J5U A;  1I8O A;  2WIT A;  3OCD B;  2WVR A;  5CIB B;  4W7Y A;  2H7H A;  1COR A;  3NMD A;  1S6V B;  2C1D A;  3GF3 A;  1C6S A;  4UB8 V;  1I6E A;  2C1U A;  1KIB A;  2C8S A;  4K3A A;  2XKM A;  3CXH W;  1L0L E;  4QAO A;  1GDV A;  1PPJ E;  4O1Q A;  2YMK A;  4O9B A;  5E79 H;  4I7Z C;  3L71 J;  1FU1 A;  3RK3 B;  4UB8 E;  2PP6 A;  1JCC A;  1OZH A;  3MZW B;  1N7S B;  1VPC A;  2A06 D;  1GL2 A;  3OAK A;  5AW7 B;  5C39 A;  4GOF A;  3BAS A;  5CCG C;  2K9Y A;  4YXD C;  1NNO A;  1L0N E;  3VYM A;  1JY3 P;  2P10 A;  3RBX A;  1ZRT E;  5CMZ A;  3P8M C;  1LT1 A;  1LTI C;  2OQQ A;  2A45 H;  2YK3 A;  2QG4 A;  2RN0 A;  1NU1 J;  1SQV J;  5TIS H;  1N86 A;  2NPS B;  3GHG A;  4WB4 A;  2IX7 C;  4JF7 A;  3VMX A;  1L0L G;  3Q3D A;  1PPJ G;  1Q86 Q;  1LTA C;  3OJA B;  1FZB A;  2QJY C;  3PXT A;  3PTZ A;  4D6T J;  4PJ0 H;  3CP5 A;  1J2J B;  1Y47 A;  3SWF A;  1H31 A;  4JPZ B;  3HUS B;  1M1J B;  1YIQ A;  4OVN F;  1YYC A;  1I8P A;  2WMM A;  1PP9 G;  1L0N G;  4EIE A;  3D6Z A;  1QVG O;  3RL0 C;  1BDD A;  3V6I A;  1LC1 A;  1DII C;  1CSB A;  2Q6Q A;  1CIG A;  1SQX K;  3A7O A;  2AI5 A;  4I2L C;  1C6O A;  1HBW A;  3RLM A;  3MP7 B;  5KAI H;  1OCD A;  4JCG A;  3OA8 A;  3G71 P;  2ZBO A;  1I54 A;  4AAN A;  3LW5 J;  3Q5S A;  3H1I J;  1BCC E;  2J58 A;  3RK2 C;  3EWK A;  3M9Q A;  2OYO A;  1JCD A;  3LW5 H;  2B87 A;  4PWA A;  1BE3 J;  1I6D A;  1AQ5 A;  4B86 A;  1LWU A;  1VQN P;  3I5C A;  2ZVO B;  4O1W A;  1KQL A;  1HJ5 A;  3RN0 A;  3TGU J;  3EFG A;  2YKQ A;  3SWY A;  1IQC A;  2MHM A;  5DJT B;  2E42 A;  3GHG B;  2P7J A;  1W2B O;  1PGP A;  1HRC A;  3RK3 C;  2LIR A;  1N50 A;  1S5L H;  5L8R J;  1KIL B;  3IR9 A;  2IBZ D;  2CPS A;  3VMZ A;  1N7S C;  1BCC G;  5KLV D;  5B66 V;  3L73 D;  1H1O A;  3RN1 A;  1GKS A;  2B0Z B;  1IRV A;  1H31 B;  3H1J D;  5AVX B;  5CJ0 A;  1FZG A;  4DOJ A;  2PCB B;  2QE7 H;  3L71 E;  1YIC A;  1DD3 A;  3O20 A;  3AE4 C;  1OVV A;  5CIH B;  2NPS C;  3P7K A;  3LID A;  5K5G B;  1CYJ A;  1RE3 C;  2WZ7 A;  4L76 A;  1KX7 A;  1G2C B;  1OIP A;  4WWI A;  2XZR A;  5DJQ C;  1L4A A;  5C0Z A;  3H1L J;  2ITA A;  1AA0 A;  2IDB A;  4BRY A;  3OA8 B;  1NTK J;  1G1J A;  1M1J C;  2XDJ A;  1SQV E;  2XND H;  2NRG A;  2QA4 P;  1AOQ A;  2XNX A;  1H32 A;  1BDC A;  3CCE P;  1KB9 D;  2WT7 B;  5APW A;  1JY3 O;  4C46 A;  5KKZ B;  1FZF A;  1EZV E;  4D6T E;  2YCC A;  3CWB J;  3L71 G;  3GLM A;  1HZV A;  2W83 C;  2BLF B;  3H1H J;  4A7P A;  1M6Z A;  3U59 A;  2R5B A;  2IYO A;  1PGQ A;  1LNQ A;  1NGM B;  2QM8 A;  5CCH C;  1DD4 A;  1VQ6 P;  1MZ9 A;  2WSC J;  3L70 J;  1SQV G;  1YEA A;  4LLH A;  3MIW A;  3FGA D;  2M3B A;  4XYD B;  1S9K E;  1IFI A;  1HVV A;  3HE4 A;  4N78 E;  1PP9 D;  3CC2 P;  1L0N D;  2WSC H;  1EZV G;  3NXS A;  5M1B A;  3AE3 C;  2R3S A;  3CC4 P;  4AX3 A;  3D0W A;  3H25 A;  3CXH D;  2YIU B;  1RZ6 A;  1QYZ A;  1M56 D;  3L75 J;  3GHG C;  1QL3 A;  2POH A;  4PW9 B;  5CYT R;  1BE3 E;  2JTI B;  2OZ1 A;  2YXQ B;  1CCR A;  2DW3 A;  1KIL C;  1L4A B;  1FJ0 A;  1NH4 A;  2AXC A;  1VQ5 P;  1M90 Q;  3A9F A;  2EXV A;  3CLQ A;  3W68 A;  1C7M A;  3S9O A;  1ZN5 A;  1N90 A;  1JTH A;  5C9M A;  4H0K A;  3W67 A;  3WUU A;  3K5B A;  1F1C A;  2M0B A;  2WSF J;  1W5C T;  3G4S P;  3C1L A;  5CIF B;  3CX5 H;  2FYU G;  2Y9Y A;  1SFC A;  2E76 B;  2E75 C;  1RZ5 A;  1NU1 K;  5AW0 B;  5AVQ B;  2LKM A;  2WSF H;  4U7J A;  3L35 A;  1GU5 A;  4K35 A;  3WUT A;  1HWT C;  3KZI V;  2GUS A;  4EOT A;  4EI2 A;  1BCC D;  1ZXG A;  1MZ4 A;  3VNW A;  3H32 A;  2M5A B;  2B89 A;  3LIE A;  5KKZ C;  3USS A;  1BSN A;  3H1L E;  1BL9 A;  3JC2 2;  2HFE D;  1T3U A;  1NTK E;  3HE4 B;  4BWN A;  1KOR A;  3QH9 A;  3A0B E;  1KTM A;  1CTJ A;  5DF5 A;  2R44 A;  4PD4 E;  2NZ2 A;  3HRN A;  1E2R A;  1ZR2 A;  1H9X A;  2B4Z A;  1CRI A;  2YO2 A;  3V2Q A;  1ETP A;  1NTM K;  5CCG A;  1DW0 A;  4L75 A;  3SFD C;  4H0L D;  2OZ1 B;  3HQ9 A;  1DVH A;  4KT0 J;  2R5D A;  4P4Q B;  1UII A;  3A0H V;  2MJZ A;  1M57 D;  2N1T D;  4WY4 D;  1R5L A;  3NFQ A;  3ORV A;  3H1K J;  3H1L G;  3L72 E;  3L4M A;  2YNY A;  1NTK G;  5AW3 B;  2AEM A;  3A5T A;  4FB1 A;  1DW3 A;  3CX5 I;  2AXT H;  1IO3 A;  1SFC B;  1MFT A;  1OFC X;  2ZXX A;  1L4A C;  1H0T A;  3AEA C;  2O01 J;  3F89 A;  1JY3 N;  2HYN A;  3WUI A;  3CC7 P;  1FI9 A;  1CSU A;  1OMI A;  3L75 E;  1R0Q A;  3PP5 A;  4Y99 B;  1SQQ K;  2K9J A;  1NKZ B;  1CXC A;  3L72 G;  1SLQ A;  3O6Q B;  4H13 D;  1I55 A;  2K37 A;  3O5C A;  1EZV D;  2E76 C;  1J3S A;  1JO5 A;  1FI3 A;  1IZN B;  3CCV P;  4LJI A;  1VDF A;  1VF5 D;  3IF4 A;  3HTK B;  2LR2 A;  2C2C A;  3GG2 A;  2H8P D;  1U57 A;  1ZP0 C;  2KS1 B;  2FYN B;  2ZOO A;  2O1K A;  3CU4 A;  3L75 G;  3WUV A;  1IFP A;  3ZOX A;  3DP5 A;  1Q2N A;  4N78 D;  4WQ7 A;  1OVU A;  3RL0 g;  4QMA A;  2FYU D;  1UIX A;  4PV1 D;  3N7N A;  3I56 P;  3CXH H;  1N7S A;  2E74 C;  4ZKU A;  3WFD C;  1P84 E;  351C A;  1WRG A;  1YFC A;  2WSS H;  2AEF A;  1A02 J;  1IJD B;  1YTZ I;  2N9B A;  1NHL A;  2GM4 A;  3MK7 B;  3PHL A;  1K04 A;  2NPS A;  2KZI A;  3JSV C;  3A3Y B;  5CIC B;  2JWA A;  3TYI A;  1CRH A;  1GL2 D;  1DVV A;  1KB9 I;  4IFF A;  4L74 A;  1SFC C;  2IYP A;  4N6J A;  4I6M C;  3F5H A;  3HUS A;  4U3F E;  1GW4 A;  1FZE A;  3H1K E;  5TJH A;  1LP1 A;  1SQX E;  3ZCF A;  1KZU B;  1URQ A;  1FAV A;  4AAO A;  4ASW A;  1H33 B;  4Y99 C;  4BXL A;  3TYY A;  4GED B;  4H0L B;  2LIT A;  1AYG A;  3O8Z A;  3VP9 A;  1VQK P;  1HH0 A;  5KLI B;  2XV5 A;  5DJU B;  2N1T B;  2YXR B;  3MUD C;  2VHD A;  5CCH A;  4MU8 A;  1DEB A;  1DIQ C;  4OGQ D;  2JR8 A;  5B5E E;  4U3F G;  5KAF V;  3KHU A;  4PD4 D;  1HTL C;  3H1K G;  1SQX G;  1CSW A;  5AVR B;  1X9V A;  3CXH I;  1VL2 A;  4OH8 B;  3TSI A;  1DW2 A;  2BH5 X;  2FYN C;  3JCU E;  1PZQ A;  2PRR A;  4Y28 J;  1BGY J;  5H2F V;  2W90 A;  2QEX P;  5KAF E;  3O1Y A;  1GK6 A;  1FDM A;  1JDL A;  1IC2 A;  3L72 D;  1DT1 A;  2E43 A;  1LT9 A;  2P67 A;  1AJY A;  3AEB C;  1TU3 F;  1MG3 D;  2SPZ A;  1KIL A;  1T6A A;  5GTH E;  4FA1 A;  1SQP D;  2B11 B;  4L1Q A;  5H2F E;  3PJS K;  1VQ7 P;  451C A;  3SWS A;  3HD7 D;  3L37 A;  2WTY A;  5B66 H;  5KLV K;  1LP1 B;  1URQ B;  4C7N B;  1CRC A;  1SP4 A;  3MK7 C;  3WFE C;  4ASV A;  2QM7 A;  4AYC A;  2PAC A;  4WQ9 A;  1KYO E;  1G2C A;  2W8Z A;  1QN2 A;  3L36 A;  1OW6 A;  1X22 A;  2K1A A;  4UB6 E;  2ZYG A;  1CNO A;  1USE A;  1QL2 A;  4XA4 A;  3B5N D;  5EXQ A;  1NTM J;  5AW8 B;  2FYZ A;  2JEE A;  1E29 A;  1CSX A;  1NML A;  1CYI A;  2ZT9 C;  4PV1 B;  1GJQ A;  1AOF A;  1IFN A;  2WT7 A;  3M9B A;  3SSU A;  1FBM A;  1QL1 A;  4JQ0 D;  1H88 A;  4KHX A;  5E79 V;  4FA9 A;  1A02 F;  5KLI C;  1QLE D;  3BCC J;  2AIU A;  1T8Z A;  3SFE C;  1RF1 B;  2JKV A;  1LS9 A;  1ZOY C;  2N9Y B;  1COT A;  2B10 B;  1VQ9 P;  1NVO A;  1RY3 A;  3L74 J;  3PH2 B;  2OYH A;  2DGE A;  1RQU A;  1J1E B;  1CXA A;  1LT9 B;  2HOD B;  2N9I A;  1JM0 A;  4RES B;  1GZL A;  2KOG A;  5E79 E;  1LJ2 A;  1S1C X;  3BVH A;  1EC5 A;  3P32 A;  5TIS V;  1L9J C;  2Z5H A;  2CXB A;  3MTU E;  1HZU A;  1CRG A;  1SQQ J;  1SQB J;  2Y9Z A;  1T3J A;  5AW2 B;  4PJ0 V;  2L4D A;  2BCC J;  5TIS E;  1KC8 Q;  2WWW A;  3AE2 C;  1N7L A;  4YTP C;  1FC2 C;  1BGY E;  4AAL A;  4WQD A;  2FBW C;  1ZW0 A;  1FDO A;  1NAY A;  4PJ0 E;  1EZV I;  3MGN A;  3M0A A;  2I1K A;  4U3F D;  4EDF A;  3HUS C;  3WMM 0;  1NU1 E;  3RK3 E;  1SQX D;  1URQ C;  3T97 A;  2R3C A;  3HQ6 A;  3U1A A;  1K3G A;  4K3I A;  2FRC A;  2KI7 B;  1LTB C;  3MHV A;  3AEG C;  2A45 G;  1NAF A;  2OGU A;  1NMI A;  4IL6 H;  3V4Q A;  3EFF K;  3QWO C;  4XE5 B;  5KAI E;  3RBZ A;  2VRS A;  1YJ9 P;  3FX0 A;  1YJN P;  4AUW A;  1BGY G;  1L0L D;  3FXE A;  2CA4 B;  1PPJ D;  2KYV A;  2JP3 A;  3Q5R A;  5KJ7 D;  2R32 A;  2OYH B;  3KZI H;  3L4F A;  4R4M A;  2M5A A;  1NU1 G;  2ZFC A;  2RKL A;  3HD7 B;  2P1J A;  1KD1 Q;  2D2C D;  3H6P A;  3FWN A;  2C1V A;  1VQL P;  4JYC A;  1NTM E;  4D6T G;  3H1I E;  1ZRT D;  1OW8 A;  1RF1 C;  3D6Y A;  3AED C;  2FXM A;  1J1E C;  2D0W A;  1LT9 C;  3C2C A;  1DH3 A;  2PFX A;  3KDP B;  2JJL A;  2O1J A;  4MN4 C;  1LMS A;  3BCC E;  2Y0C A;  1S5L E;  3SLE A;  2G3A A;  2CE0 A;  3TGU E;  2J59 M;  3I55 P;  4ZKP A;  1FI7 A;  1WT6 A;  3L74 E;  1YBK A;  3A0H H;  1GW3 A;  1XTG B;  2FY8 A;  3T97 B;  1NTM G;  2Q9I A;  1HGV A;  1D7M A;  3H1I G;  5CCG D;  3TF5 A;  1LGH B;  4DY9 A;  1KYO D;  3M9H A;  1SQQ E;  1AVY A;  2Q5U A;  4M3L A;  3S1K A;  2OYI B;  4GDO A;  1BE3 G;  3WC8 A;  1MUU A;  1KQF B;  3G9R A;  3BCC G;  3A0B V;  3AE9 C;  1KIL E;  3TGU G;  1CO6 A;  5CIE B;  4NFG B;  2ZAE B;  1OAE A;  2I8D A;  3L74 G;  3O6Q A;  3M91 A;  4PD4 I;  1FZC A;  1SVF A;  2YMY A;  3MUD A;  1GU4 A;  1MFZ A;  1NWQ A;  3CCS P;  3HTK A;  3ZBM A;  1RH5 B;  2W6A A;  2HLO A;  3IAO A;  3RL0 D;  1KB0 A;  1SQQ G;  1ZLL A;  4IL6 E;  1YQ3 C;  1A8C A;  2KS1 A;  3G6E P;  1YCC A;  3G3Z A;  2MKV A;  1CI6 B;  2ZXE B;  5KLV J;  3L73 J;  2OYH C;  1S3J A;  3CWB E;  1PFI A;  3IN6 A;  3H1H E;  3H1J J;  2QRX A;  5BVZ A;  1AKK A;  3HD7 C;  3SXT A;  2BEQ D;  2JO1 A;  1JMB A;  1U75 B;  2BCN B;  2P2U A;  1EXI A;  3WU2 H;  3RK2 D;  1CTY A;  1CCH A;  3L70 E;  5APY A;  2YIU C;  5DFS A;  2GA1 A;  3L71 D;  1HJ3 A;  2FXO A;  2D0S A;  1FDI A;  3CYT I;  2CK3 H;  3S4R A;  1CW5 A;  1JOC A;  1L9B C;  2FFD B;  5GTI H;  3VOP A;  3GMA A;  2QJK B;  3B8E B;  3CWB G;  3UIA A;  2XU6 A;  2BAS A;  1VQO P;  2PAJ A;  3RMZ A;  2OAR A;  3AEE C;  3H1H G;  3PXW A;  4H44 D;  1NU1 D;  1SQV D;  3NBT A;  5AVS B;  3BRV B;  3II6 A;  1NTZ K;  1YTC A;  2YO3 A;  4V2K A;  1SQB K;  1N7S D;  1YNR A;  5APX A;  3L70 G;  1VQ8 P;  4D6T D;  1FZC B;  1XTC C;  1NJI Q;  1KB9 H;  1PV3 A;  3CX5 E;  1Y8A A;  4TLF A;  3Q5P A;  2QJP B;  2IFM A;  2OYI C;  2WSE J;  2C0W A;  2JWD A;  3P8C E;  3AE8 C;  2KSE A;  1H33 A;  1DEE G;  2P58 A;  4YXW H;  1W2L A;  1LTJ B;  1PP9 J;  1L0N J;  3AE1 C;  1MG2 D;  2WSE H;  1S5L X;  4FA5 A;  2N1T A;  1S9K D;  1KMI Z;  4GYD A;  1GK4 A;  4IFD K;  4UB8 H;  2IBZ I;  3VYI A;  4RJT A;  2V4H A;  2FWL A;  2MTA C;  1CSV A;  3SVW A;  3H1I D;  4AAM A;  1I5T A;  1WEJ F;  1YJW P;  4LC1 A;  4FA4 A;  1EDK A;  2IZ0 A;  1E5W A;  2LXC B;  1BE3 D;  5AW6 B;  1GQ1 A;  2CA3 B;  4XFJ A;  1LC2 A;  1RF0 A;  5CCH D;  2XTS B;  2Q1K A;  1JMM A;  3TGU D;  3E1R A;  1GMJ A;  3O0R C;  1AFO A;  1HH7 A;  3L74 D;  4GOD A;  2QJY B;  5KLV E;  3L73 E;  5CHX A;  1LTT C;  1A2S A;  5APU A;  1RHZ B;  3PH0 A;  3H1J E;  5AVT B;  4NPD A;  1R5S A;  2Z4E A;  5AVZ B;  2ZJS E;  4WVZ A;  3B71 A;  2AXT E;  1S4X A;  2Q3I A;  1NKN A;  2QJK C;  3ZDM A;  1L2P A;  1SQP K;  5GTI E;  1AV1 A;  1QKS A;  3RL0 B;  3TNU A;  3V4W A;  1QL4 A;  2Y0E A;  4C7N A;  3V2N A;  4IL6 X;  1MKM A;  1BCC J;  1CRY A;  2L91 A;  2WPQ A;  1VQP P;  1ZV8 A;  2GC4 D;  4DCK A;  5B5E V;  5EFW B;  4DJG A;  4Y5R A;  1PGJ A;  1K9M Q;  2HPC A;  5KLV G;  3H1L D;  1OVR A;  1FZC C;  1N8R Q;  4RKU J;  4WY4 B;  3RK2 B;  1NTK D;  1JY2 P;  1USD A;  3VP8 A;  1NYH A;  2QJP C;  1DIP A;  3NBS A;  1C2R A;  1CHH A;  3PLN A;  2QVA A;  2PCC B;  2B88 A;  1M8O B;  4HB1 A;  2E75 D;  1OXZ A;  1LFM A;  4KJM A;  1HJB A;  1K73 Q;  2KLU A;  3ZOY A;  1ZR4 A;  3CWB D;  1LTJ C;  1CIF A;  1LTG C;  3GW6 A;  1CIE A;  3H1H D;  3DR0 A;  4RO0 A;  5APV A;  1RF1 A;  5GTH V;  3U1C A;  2L5G B;  4LGD E;  5AVY B;  2KIK A;  5AW4 B;  4H44 B;  1M60 A;  3E1I A;  1EDJ A;  5APS A;  1N73 A;  2KNC B;  1IFD A;  1N9C A;  2HOD A;  1CHJ A;  3L70 D;  2ZYA A;  4H13 B;  1PP9 E;  1KYO W;  1Z56 A;  155C A;  1RQV A;  1HRO A;  1AQT A;  1A56 A;  1G1I A;  3CXH E;  1JNM A;  1EQ7 A;  4CPG A;  2RH0 A;  1VF5 B;  2AEJ A;  1M7L A;  4EIJ A;  1KYO I;  1Y9B A;  4KMG A;  2M3E A;  3TNU B;  4EID A;  4UB6 V;  3ZOO A;  4JYB A;  3OA7 A;  4L3G A;  5CBO A;  1IO4 A;  1CTZ A;  3ITK A;  5DJQ B;  2Z5I A;  3KQG A;  3L75 D;  4N0K A;  5AW9 B;  3R2P A;  2H89 C;  4IFM A;  3HE5 B;  4HYT B;  2HPC B;  3CCJ P;  3MD0 A;  2JDI H;  3CD6 P;  4JBZ A;  4WQA A;  1U74 B;  3AEC C;  3CX5 D;  1OWA A;  3VN0 A;  1FE6 A;  4C7R A;  3TK1 A;  1GU2 A;  3NTN A;  1IZL 0;  3AE7 C;  3HQ8 A;  3P8C D;  1K05 A;  1YEB A;  3EQ2 A;  2C1D B;  1AVO A;  4NPF X;  1JEK A;  1HUC A;  4H0L C;  1L4A D;  3VMA A;  1H9Y A;  3C8V A;  1KV4 A;  2Y0D A;  1KFN A;  3C9I A;  3VRD A;  2N1T C;  4WY4 C;  1PL5 A;  1NO4 A;  2FYU J;  3A2A A;  5APQ A;  1N73 B;  5APT A;  1K8A Q;  2ZXY A;  3M0D A;  2GIW A;  1L0L K;  1GL2 B;  4DT0 A;  2E76 D;  2Q3E A;  3V2R A;  3HD7 A;  4GKG A;  2A45 I;  1QVF O;  4TT3 H;  3CL3 D;  1QEX A;  1NTZ J;  1JUN A;  1P84 D;  4RSZ A;  3NWV A;  2KP8 A;  2ZZS 1;  3OW2 O;  3SWK A;  1RF0 C;  4H44 C;  3KYQ A;  1L0N K;  1NOH A;  2H88 C;  3CI9 A;  1Q7Y Q;  3KXD A;  1LTS C;  3DMI A;  1CYC A;  4H13 C;  4OWF A;  1B7V A;  1JY2 O;  3BRT B;  2BPB B;  3B5N A;  5AUR A;  3HQ7 A;  1R8E A;  1HGZ A;  1VF5 C;  4OGQ B;  3BAT A;  3B4S A;  2HV4 A;  2IZ1 A;  3H1K D;  2JQR A;  1YI2 P;  1K3H A;  5B66 E;  5AVW B;  1JB0 J;  4WBA A;  2E75 B;  5KAI V;  2E74 D;  3R4Y A;  2B9B A;  3VTP C;  1QX8 A;  5IY5 1;  2CE1 A;  2FKW B;  5AW1 B;  1T2K D;  2OYI A;  4WQC A;  1Q90 D;  4GIF A;  1FZA A;  2BH4 X;  3CCM P;  1J1D B;  3V5B A;  1M70 A;  4PV1 C;  1F1F A;  1IRW A;  1N2D C;  2OTK E;  2B87 B;  2HR3 A;  3A0B H;  1SFC D;  4DZO A;  1LWU B;  2CPB A;  4EIC A;  4PD4 H;  2G8Y A;  2ZVN B;  2BGV X;  2C0X A;  4ZNC A;  1GDT A;  3L72 J;  3PXS A;  3ABV C;  1S5L V;  1YIJ P;  1RE4 A;  3AEF C;  2GC7 D;  1N73 C;  1IFJ A;  2N3Y A;  1H8A A;  1CI6 A;  1S72 P;  1SQP J;  1KQG B;  4L73 A;  4HH2 A;  1GL2 C;  1YHQ P;  5CID B;  4WQE A;  1ZME C;  3B5N B;  3FWL A;  1QGK B;  2FYU E;  2PGD A;  2O01 N;  4L3H A;  1X8Y A;  1E79 H;  2W6B A;  2HG5 D;  4W7Z A;  3FXD A;  2KSJ A;  4YE1 A;  1FOC A;  1KN7 A;  2ORL A;  1X79 B;  2N18 B;  4Z1M H;  3CMA P;  1OX3 A;  3WFB C;  2FFD A;  1M1K Q;  1NTZ E;  4BRY B;  1SQB E;  3Q2Y A;  2K3R A;  3AE6 C;  1EB7 A;  4WQB A;  3ZIY A;  1DX7 A;  4OGQ C;  5KJ7 A;  1H32 B;  3L4O A;  1WMK A;  2BCC E;  3CCR P;  2WPS A;  2K88 A;  1KV9 A;  2UWJ E;  1SQV K;  4IL6 V;  1H89 A;  1N15 A;  1Q82 Q;  1C6R A;  2E5T A;  3X39 A;  2GB8 B;  1PIX A;  1DW1 A;  1HF9 A;  3TDK A;  1NTZ G;  2E5Y A;  3D71 A;  5AW5 B;  1SQB G;  1OW7 A;  2KK7 A;  2KXP B;  1Q81 Q;  2W6J H;  4FAN A;  1J1D C;  2DVH A;  3JBT B;  1LTJ A;  3M0D C;  5B6Q A;  1CED A;  2BCC G;  4ZMD A;  1CC5 A;  3KZI E;  1LWU C;  2C9L Y;  4AQR D;  1RAQ A;  3M97 X;  1C2N A;  4XXL A;  3CCL P;  2H43 A;  1KQS O;  4EYY Q;  2ZT9 D;  4EIF A;  3AE5 C;  3D70 A;  2GUV A;  4IOI H;  1MV8 A;  1GIW A;  2E74 B;  1P84 H;  5KTB A;  2A06 E;  2RMZ A;  3Q1M A;  1U7J A;  1JY2 N;  2WPR A;  3V2P A;  2Q7C A;  2FYU K;  1VQM P;  1FJK A;  4R4L A;  1PGO A;  4U3F J;  1YIT P;  3CX5 W;  1EXJ A;  1SQX J;  2C9N Y;  1FS0 E;  1BGY D;  1IK9 A;  1JTH B;  3B5N C;  1S2E A;  4WQ8 A;  2O3J A;  2YKP A;  2B12 B;  2KZJ A;  4J20 A;  3RK3 D;  3CME P;  5AVV B;  2N9J A;  1SQP E;  2IPP A;  1CHI A;  1YTZ T;  3A0H E;  1RAP A;  2I8F A;  1HCM A;  4N3Y B;  5BU5 A;  2N18 C;  3CCU P;  3CCQ P;  4H0J A;  2D2C B;  2C9X B;  2A06 G;  2YKO A;  3ZOW A;  2V7Q J;  1L0L J;  2IFN A;  5AVU B;  2I1J A;  2OTL P;  1FJP A;  1FCD C;  1HJ0 A;  1GTW A;  4I1L A;  2NPS D;  1W5C E;  2KUB A;  3H32 B;  3SJL A;  2O01 H;  1IK7 A;  2V7Q H;  4HKZ H;  2ZYD A;  3VMY A;  1NIR A;  5B5E H;  1SQP G;  5BU8 B;  2M8R A;  4WY4 A;  1CZQ A;  4W80 A;  1URQ D;  1FOS E;  4I7Z B;  3M06 A;  1C75 A;  1NTM D;  1P84 I;  3OCD A;  5CJ4 A;  2N3B A;  3JCU H;  1NTK K;  1FHB A;  1WVE C;  1HJ4 A;  1RE4 C;  1IFM A;  3WU2 V;  5KAF H;  2KB7 P;  3CPW O;  1BSH A;  1KX2 A;  1VQ4 P;  2YQB A;  2BEZ F;  5CBN A;  2FXP A;  1C52 A;  2W27 A;  1X0T A;  1CIH A;  3BCC D;  1SS1 A;  3KPE A;  1E8E A;  1CRJ A;  4NPE A;  1FOS F;  5GTH H;  2QSI A;  2KNC A;  2AXT V;  4Q5P A;  5H2F H;  5GTI V;  3WU2 E;  3RGU A;  2IBZ E;  4GOE A;  1EDL A;  1EDI A;  1U7M A;  2ZON G;  1GD2 E;  2WQY C;  1H0T B;  2FFD C;  1NTZ D;  1T2K C;  1W2E A;  1SQQ D;  2V07 A;  1SQB D; 
#chains in the Genus database with same CATH homology
 1IZL 0;  3A0H V;  3HQ8 A;  1VYD A;  1YEB A;  3ORV A;  2C1D B;  2C1V A;  3L4M A;  2K9J B;  2V08 A;  2BCC D;  3WFC C;  3VMA A;  1H9Y A;  1ZRT D;  2Y0D A;  4FB1 A;  1DW3 A;  3VRD A;  1IO3 A;  4FAV A;  2D0W A;  3C2C A;  1ZZH A;  5CIG B;  3PRJ A;  2ZXY A;  2GIW A;  1LMS A;  1I8O A;  2Y0C A;  2Q3E A;  3OCD B;  3SLE A;  3WUI A;  5CIB B;  2CE0 A;  1FI9 A;  1CSU A;  1COR A;  1FI7 A;  1R0Q A;  1S6V B;  2C1D A;  1C6S A;  4UB8 V;  1I6E A;  1CXC A;  1P84 D;  1KIB A;  2C1U A;  2C8S A;  4RSZ A;  3NWV A;  1I55 A;  2ZZS 1;  3O5C A;  3CXH W;  1EZV D;  4QAO A;  1J3S A;  1GDV A;  3TF5 A;  1FI3 A;  4O1Q A;  4LJI A;  4DY9 A;  1KYO D;  3DMI A;  1CYC A;  2C2C A;  3GG2 A;  1B7V A;  3WC8 A;  2A06 D;  2BPB B;  1NNO A;  5AUR A;  3VYM A;  3HQ7 A;  2FYN B;  2ZOO A;  3A0B V;  2HV4 A;  3CU4 A;  1CO6 A;  3H1K D;  2JQR A;  4NFG B;  2YK3 A;  1K3H A;  1OAE A;  5CIE B;  3ZOX A;  2QG4 A;  2RN0 A;  3DP5 A;  5KAI V;  4WQ7 A;  5IY5 1;  2CE1 A;  2FYU D;  3PXT A;  3PTZ A;  3ZBM A;  1KB0 A;  3CP5 A;  1A8C A;  1H31 A;  3WFD C;  2KS1 A;  1YCC A;  4WQC A;  1YIQ A;  351C A;  1YFC A;  1I8P A;  2BH4 X;  4EIE A;  1M70 A;  1F1F A;  1IRW A;  1AKK A;  3MK7 B;  3SXT A;  1LC1 A;  1DII C;  3PHL A;  1CIG A;  1U75 B;  2BCN B;  2AI5 A;  4EIC A;  1C6O A;  3RLM A;  1CTY A;  2BGV X;  5CIC B;  1CCH A;  2JWA A;  3TYI A;  1CRH A;  1OCD A;  4JCG A;  5DFS A;  1DVV A;  3OA8 A;  3L71 D;  2ZBO A;  1I54 A;  4AAN A;  1HJ3 A;  3PXS A;  1S5L V;  2D0S A;  3CYT I;  2GC7 D;  1L9B C;  5TJH A;  2N3Y A;  3ZCF A;  4AAO A;  2QJK B;  4P4Q B;  5CID B;  3RMZ A;  4WQE A;  4PWA A;  3PXW A;  1I6D A;  1H33 B;  3FWL A;  1NU1 D;  1SQV D;  3NBT A;  4GED B;  2LIT A;  4L3H A;  1YTC A;  1AYG A;  4V2K A;  4O1W A;  1HJ5 A;  3RN0 A;  5KLI B;  4YE1 A;  1YNR A;  1IQC A;  2MHM A;  1FOC A;  2ORL A;  2VHD A;  4D6T D;  2N18 B;  4MU8 A;  1DIQ C;  1HRC A;  2LIR A;  1N50 A;  3WFB C;  5KAF V;  3KHU A;  2IBZ D;  2QJP B;  4PD4 D;  5KLV D;  5B66 V;  3L73 D;  1CSW A;  1H1O A;  1EB7 A;  3RN1 A;  4WQB A;  1GKS A;  1DW2 A;  2BH5 X;  2B0Z B;  3ZIY A;  1IRV A;  1H31 B;  3H1J D;  1H33 A;  1W2L A;  1H32 B;  3L4O A;  2PCB B;  1YIC A;  3O20 A;  1KV9 A;  5H2F V;  1MG2 D;  5CIH B;  3O1Y A;  4FA5 A;  1JDL A;  4IL6 V;  1CYJ A;  4GYD A;  1N15 A;  3L72 D;  1DT1 A;  1C6R A;  4RJT A;  1KX7 A;  2FWL A;  3X39 A;  2MTA C;  5DJQ C;  1CSV A;  2GB8 B;  3H1I D;  5C0Z A;  3SVW A;  4AAM A;  1I5T A;  1MG3 D;  1DW1 A;  1WEJ F;  3TDK A;  4FA1 A;  3OA8 B;  1SQP D;  2B11 B;  4L1Q A;  4FA4 A;  451C A;  3SWS A;  4FAN A;  1AOQ A;  1BE3 D;  1H32 A;  2DVH A;  3JBT B;  1GQ1 A;  2CA3 B;  1KB9 D;  1CRC A;  3MK7 C;  1LC2 A;  3WFE C;  5B6Q A;  5KKZ B;  1CED A;  1CC5 A;  2YCC A;  2XTS B;  1HZV A;  1RAQ A;  3TGU D;  3M97 X;  3O0R C;  2BLF B;  2PAC A;  4WQ9 A;  4A7P A;  1C2N A;  1HH7 A;  3L74 D;  1M6Z A;  4XXL A;  2QJY B;  1QN2 A;  4EIF A;  1A2S A;  1GIW A;  1CNO A;  2RMZ A;  5EXQ A;  1E29 A;  1CSX A;  1NML A;  1CYI A;  1YEA A;  4XYD B;  1QKS A;  1GJQ A;  1QL4 A;  1AOF A;  2Y0E A;  3CX5 W;  1CRY A;  1BGY D;  2L91 A;  1PP9 D;  1L0N D;  2GC4 D;  4WQ8 A;  2O3J A;  5B5E V;  5E79 V;  2B12 B;  4AX3 A;  3CXH D;  2YIU B;  4J20 A;  1RZ6 A;  4FA9 A;  1QYZ A;  2N9J A;  2AIU A;  4Y5R A;  1CHI A;  1LS9 A;  1RAP A;  2I8F A;  2N9Y B;  1COT A;  1HCM A;  2B10 B;  2N18 C;  3H1L D;  4H0J A;  1QL3 A;  2C9X B;  3PH2 B;  4PW9 B;  5CYT R;  2JTI B;  2DGE A;  2OZ1 A;  1CXA A;  1NTK D;  1CCR A;  2N9I A;  3ZOW A;  3NBS A;  1C2R A;  1CHH A;  3PLN A;  1FJ0 A;  2PCC B;  1FCD C;  1LFM A;  3A9F A;  2EXV A;  5TIS V;  1L9J C;  1C7M A;  2CXB A;  3ZOY A;  1N90 A;  5C9M A;  1HZU A;  1CRG A;  4H0K A;  3CWB D;  3SJL A;  1F1C A;  1CIF A;  3GW6 A;  1W5C T;  1CIE A;  3H1H D;  3DR0 A;  5GTH V;  5CIF B;  4PJ0 V;  2L4D A;  1NIR A;  1RZ5 A;  1M60 A;  2KNC B;  1N9C A;  1CHJ A;  1C75 A;  1NTM D;  3L70 D;  4AAL A;  4WQD A;  3OCD A;  1KYO W;  2N3B A;  3KZI V;  155C A;  1FHB A;  1HRO A;  1WVE C;  1HJ4 A;  1A56 A;  4EDF A;  4U3F D;  1BCC D;  1SQX D;  1MZ4 A;  3WU2 V;  3VNW A;  3HQ6 A;  1K3G A;  1KX2 A;  4KMG A;  2YQB A;  4EID A;  4UB6 V;  1BL9 A;  4K3I A;  3ZOO A;  1C52 A;  2FRC A;  4L3G A;  1CIH A;  3BCC D;  1CTZ A;  1E8E A;  3ITK A;  1CRJ A;  5DJQ B;  3L75 D;  1CTJ A;  2AXT V;  4Q5P A;  5DF5 A;  5GTI V;  1NMI A;  4N0K A;  1E2R A;  1H9X A;  2B4Z A;  1CRI A;  2ZON G;  1L0L D;  4WQA A;  2CA4 B;  1ETP A;  1U74 B;  3CX5 D;  1PPJ D;  1DW0 A;  2OZ1 B;  3HQ9 A;  1NTZ D;  1DVH A;  1SQQ D;  2V07 A;  1GU2 A;  1SQB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...