2IBZD

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2ibzD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2ibzD02
1CRJA 1NIRA 1CYJA 3PTZA 5B66V 2QJYB 1HH7A 2HV4A 3HQ7A 1LFMA 4MU8A 1KIBA 1EZVD 2BPBB 2RN0A 5H2FV 4QAOA 1C2RA 3MK7C 1CNOA 3KHUA 1S6VB 5CIFB 1YTCA 5E79V 1N15A 2B11B 1R0QA 3O5CA 4A7PA 2OZ1A 2DGEA 4YE1A 1DW2A 2V07A 1KB9D 1H9YA 2N9YB 4EICA 1E29A 2D0SA 1CIGA 2YK3A 5KAFV 1K3HA 2PCCB 1KYOD 2N18B 4V2KA 1QL4A 2CA3B 2BLFB 1I8OA 5TJHA 3DP5A 5B5EV 1CHIA 1K3GA 1ZZHA 4EIDA 2FYNB 2YCCA 1U74B 1DT1A 5KKZB 1I55A 3PHLA 1SQQD 1GJQA 3L71D 1LS9A 2FYUD 1QN2A 3VMAA 5KAIV 1DVHA 1NMIA 4LJIA 2Y0DA 2N3BA 1GU2A 1CIEA 3OA8B 1NMLA 3O0RC 1MZ4A 1KYOW 1SQBD 5GTIV 1H31A 1U75B 1H1OA 1N9CA 4PD4D 1HROA 1GKSA 1C75A 1FCDC 3ZOXA 4AAOA 5KLIB 3WFDC 3H1JD 3OCDA 3TDKA 2QJKB 155CA 4JCGA 1RAPA 1IRWA 1FOCA 2B12B 1I6EA 351CA 1IRVA 3H1HD 5B6QA 1YCCA 1MG3D 2ORLA 1GQ1A 2C8SA 3RLMA 2QJPB 3ZOOA 1AOQA 3GW6A 1SQPD 3NBTA 4WQBA 5EXQA 1FJ0A 2C2CA 1KB0A 2VHDA 3RN0A 1M60A 4H0KA 1LC2A 2PCBB 4Y5RA 1KX2A 3C2CA 3PLNA 2FRCA 1AOFA 1FI7A 3L74D 4FAVA 1NU1D 3VRDA 1C6SA 3CU4A 1CSWA 1QL3A 2GC7D 1CIFA 2C1VA 1BGYD 2AXTV 2ZONG 1DVVA 1HRCA 3CXHD 1YEBA 1E2RA 1M6ZA 1YICA 2Q3EA 4XXLA 3L72D 2BCCD 1PP9D 1FI9A 3M97X 1CCHA 1MG2D 5IY51 1FI3A 1N50A 3RMZA 4FB1A 3H1ID 1GDVA 3HQ8A 1HJ4A 1N90A 5CIDB 1C2NA 1QKSA 2B4ZA 3DR0A 2XTSB 3SWSA 3CX5W 2BGVX 1YFCA 3ITKA 2N18C 1P84D 2D0WA 1HJ3A 1CHJA 1CCRA 3VYMA 1RAQA 2Y0CA 2GIWA 1HZUA 1J3SA 4P4QB 4WQAA 1C52A 4N0KA 3SVWA 2PACA 2C1DA 1SQVD 1CEDA 1CRHA 4D6TD 4WQ7A 2FWLA 2MTAC 4FANA 1CXAA 1JDLA 1W5CT 3VNWA 4EIEA 1QYZA 1CSXA 1DIQC 1CRYA 1I8PA 4J20A 1I6DA 2RMZA 3PXWA 3TYIA 2LITA 1CSUA 3BCCD 3TGUD 2B10B 3SXTA 1BL9A 3ZOYA 2CXBA 1H33A 5CYTR 3SLEA 3CXHW 1CRIA 1IZL0 3ZBMA 2C1DB 4EDFA 2DVHA 1A56A 3OCDB 2AI5A 4O1WA 1AKKA 3ZCFA 3ZIYA 1H9XA 1CYCA 2JWAA 4AANA 1F1CA 5CIEB 2ZXYA 2QG4A 1IQCA 1LC1A 3OA8A 3L75D 5DJQB 4FA4A 4FA1A 1NNOA 1W2LA 4WQ8A 1PPJD 1BE3D 3HQ6A 2YIUB 3ORVA 1I5TA 3ZOWA 2N3YA 1CORA 3WFCC 2EXVA 1HJ5A 3CYTI 1C6OA 5KLVD 451CA 1DW0A 1VYDA 3HQ9A 2BCNB 5TISV 3PH2B 5DF5A 2C1UA 4UB8V 1CTJA 4FA9A 2GB8B 1CXCA 3CP5A 2L91A 1E8EA 4NFGB 1IO3A 5GTHV 4XYDB 1H32B 3KZIV 5C0ZA 1S5LV 3DMIA 2N9JA 1WVEC 1EB7A 1CYIA 2BH4X 2GC4D 4WQ9A 3O1YA 1L9BC 2AIUA 3WU2V 2ZOOA 5C9MA 3WFBC 4KMGA 4AAMA 3MK7B 4L1QA 4AX3A 3WFEC 5DFSA 1H33B 1ZRTD 1AYGA 2V08A 1CSVA 2KNCB 1HZVA 1M70A 3NWVA 1LMSA 4GYDA 4U3FD 4WQEA 3TF5A 4O1QA 1L0ND 1I54A 1YIQA 3L70D 2O3JA 1NTKD 2A06D 1DW3A 4DY9A 1YEAA 1SQXD 3A0BV 3O20A 4PW9B 3PXSA 3X39A 4UB6V 2JTIB 2N9IA 4RJTA 5CIGB 1CHHA 1FHBA 3H1LD 4H0JA 1HCMA 4Q5PA 1C7MA 4PWAA 3PRJA 1A2SA 1CRGA 2KS1A 2IBZD 1NTZD 2L4DA 3CX5D 2Y0EA 5CIBB 4L3HA 3H1KD 5DJQC 3L73D 3JBTB 4WQDA 1YNRA 2K9JB 4RSZA 2B0ZB 2CE0A 1OCDA 1H32A 1F1FA 2ZBOA 3GG2A 1OAEA 4WQCA 1CRCA 4EIFA 3A0HV 2CA4B 1RZ5A 2BH5X 1DW1A 3A9FA 1COTA 2YQBA 1ETPA 3PXTA 4K3IA 1CTYA 3WUIA 1NTMD 3CWBD 4GEDB 4FA5A 5CIHB 5CICB 4L3GA 5AURA 1A8CA 2LIRA 1BCCD 3RN1A 3FWLA 4IL6V 1GIWA 4AALA 1C6RA 1B7VA 3SJLA 1CTZA 2JQRA 1CC5A 2MHMA 3L4MA 1CIHA 1RZ6A 1CO6A 1H31B 3NBSA 1DIIC 3WC8A 4PJ0V 1KV9A 2CE1A 1L9JC 3L4OA 2C9XB 2ZZS1 2OZ1B 1L0LD 1WEJF 2I8FA 1KX7A
chains in the Genus database with same CATH superfamily
3H1KE 1CRJA 1GD2E 1NIRA 3B5NA 2ZYAA 3T97A 1KILB 4I7ZB 1SQQJ 1NTMG 2HV4A 5AW9B 3WUUA 1YTZI 2BPBB 1FZAA 2E74B 4UB6E 2M5AB 3HUSB 1C2RA 2N9BA 5CIFB 3A0BE 4I2LC 1N7SC 5KAFE 4YTPC 1L0LJ 1R0QA 1URQC 2WWWA 2OZ1A 2DGEA 4YE1A 1DW2A 1ZN5A 3H1KJ 2V07A 1KB9D 1AV1A 3V2PA 4EICA 5KLVK 3RK2D 5M1BA 1S9KE 3LIEA 4YXDC 1IO4A 4H13D 2IPPA 1JB0J 3M0DC 5B5EV 1K3GA 1ZZHA 4EIDA 2FYNB 2M8RA 3TK1A 1OVUA 1U74B 2L5GB 1CZQA 2FYUJ 4I1LA 3RL0B 1SQQD 5CCHA 1LS9A 2FYUD 1QVFO 5CBOA 5KAIV 1KILC 2QVAA 1VDFA 1OWAA 1LTAC 2IZ0A 1MZ4A 3L37A 1URQD 3QWOC 1NOHA 2QJPC 1NTKE 4PD4D 2D2CB 1HROA 3KZIH 3AECC 1N7SB 1R8EA 4DT0A 2R44A 3CX5I 1AVYA 1C75A 1FCDC 5AVSB 4WY4A 3TDKA 5KTBA 3M91A 155CA 2WPRA 1RE4A 4JCGA 1IRWA 2JKVA 1Y47A 1FOCA 1SQXK 2B89A 3EFFK 2K9JA 1AOQA 1H88A 1BE3E 3RGUA 1PL5A 1CI6B 2ZVNB 1ZR2A 1U7JA 1X22A 2A45G 2QE7H 5CBNA 1DEEG 2VHDA 3RN0A 3TGUJ 1EC5A 2PCBB 4Y5RA 1VQOP 3PLNA 3CCRP 1NAYA 3L74D 1NTZK 5AVVB 1NO4A 3A0HE 2WPQA 5AW2B 1QL3A 4YXWH 1L4AA 1M1KQ 1RY3A 4PV1B 1NTKG 3AE6C 4TLFA 3L70J 2OARA 3CXHD 1BGYE 3TYYA 1Y8AA 1CW5A 1YICA 2BCCD 3EWKA 1CCHA 1YJ9P 1T6AA 1N50A 1LT9C 1HWTC 1GDVA 3HQ8A 1GL2C 1ZRTE 1C2NA 2G8YA 2E43A 3DR0A 2XTSB 1JEKA 3Q5RA 1P84D 3P32A 1QX8A 1EXIA 3VP9A 1SQXG 1E79H 2B9BA 2NRGA 3CC7P 2Y0CA 4NPEA 2GIWA 4BWNA 2KYVA 3AEAC 5KLVJ 5KKZC 1NVOA 1S72P 2PACA 1CSBA 1IK9A 3BRTB 1CRHA 3D71A 2XV5A 1GU5A 1CXAA 3NTNA 1L0LE 2N1TA 5DJTB 1NTZE 1GL2B 3AE9C 3SFDC 4J20A 1NTKJ 3TYIA 2YXQB 2B10B 4W7YA 1BL9A 4HB1A 3A2AA 1WMKA 1SQQK 4IL6H 3FXDA 1IJDB 1AQTA 1RE3A 1SQPG 1H33A 5APXA 1IZL0 2QEXP 1H8AA 3ZBMA 5CHXA 2K1AA 4UB6H 1M57D 4BXLA 2DVHA 3WUTA 3LIDA 1VQPP 2P10A 1IFMA 1S3JA 2K3RA 3L70E 1G2CA 2C9NY 2KK7A 5KAIH 1KILA 3B5NC 2Y9ZA 2R32A 2E74C 3L75D 3AE5C 1NNOA 1PPJE 2C0XA 2LXBA 2QIWA 4WQ8A 3HE4A 2YKPA 3AE7C 3JSVC 4LGDE 2AEMA 1RQUA 1SFCD 3ZOWA 3H1IE 3U59A 1NKNA 2Y9YA 451CA 1DW0A 1DH3A 2AXTH 5CJ0A 2FYNC 4UB8V 3Q3DA 1CTJA 3CCQP 1CXCA 2D2CC 3H1JJ 4O9BA 2JP3A 1IO3A 5GTHV 1A02F 1SQVG 3GF7A 3VOPA 2JEEA 5KLVE 2FXPA 1JTHA 1OFCX 1YI2P 3SSUA 3O1YA 5APTA 1IFDA 4W7ZA 1ZW0A 5C9MA 2Z5HA 1YYCA 4NPDA 3WFEC 3HTKA 1CSVA 2KSJA 2IFNA 1T3UA 1USDA 1Q86Q 2KIKA 1M70A 4N6JA 3CCUP 3NWVA 4GYDA 5BU8B 1L0ND 3HD7C 1BSNA 2J58A 4BRYA 2WT7A 4RO0A 3B71A 1DW3A 3CMEP 4DY9A 1FDMA 1KILE 1SQXD 3A0BV 1IFNA 1KQGB 1RF0C 4PW9B 3L74J 2E76B 2NZ2A 5APSA 3PXSA 4OWFA 1SQVJ 2JTIB 5AVQB 2QSIA 1CHHA 3H1LD 4K35A 4N78E 4H0JA 1PIXA 3R4YA 1C7MA 3SFEC 5AW3B 3T97B 2IBZD 1Y9BA 4DJGA 1AFOA 1NTZD 2H88C 3PP5A 2H8PD 2HLOA 2ZT9B 3L73D 2W6AA 1W2EA 1RF1A 2JWDA 2B0ZB 1LP1A 4PJ0H 2A45H 2Q3IA 1H32A 1SQQG 4GOEA 3E7KA 1Q7YQ 4EIFA 3A9FA 1COTA 2MKVA 4OGQC 2OYHB 2WSCJ 1LGHB 2QJKC 2E5TA 3WUIA 1DD4A 2LKMA 2WTYA 2BASA 2LIRA 3FWLA 2RKLA 4AALA 1C6RA 4JYCA 1GZLA 3SJLA 3BATA 2MHMA 1IFJA 1CIHA 1RZ6A 4OVNF 3VN0A 4H13C 3NBSA 2DW3A 3VMYA 2O01H 4PJ0V 3K5BA 1WT6A 2IFMA 2W8ZA 3L4OA 2C9XB 2ZZS1 1AYGA 1WEJF 2FYUE 1JMMA 2ZT9D 3L71E 1L0NG 3D6YA 1FZCB 2QJYB 2IYPA 3PH0A 1HF9A 2B87A 4PV1C 3NXSA 1SFCB 3U1CA 2B87B 2YKQA 2M3BA 1JTHB 3G6EP 4QAOA 1KD1Q 1JCDA 1YTCA 2B11B 1GK6A 2NPSB 1PGJA 1SQXE 3R2PA 1H9YA 1BDCA 4OGQB 1LT9A 2A06E 1LNQA 1VPCA 1NTZG 2C0WA 1KB9I 5CCGC 2OYOA 2YK3A 5KAFV 1FZCC 1K3HA 4I6MC 4V2KA 1VF5B 5CCHD 3L73G 1Q90D 1CHIA 2IX7C 1VQ5P 3D70A 2QM7A 2AXTE 3CWBJ 1YHQP 5KKZB 1SLQA 1N8RQ 3PHLA 1T8ZA 4WVZA 2YIUC 3VMAA 1ZR4A 2NPSC 1X79B 1NMIA 3RBXA 2KOGA 4LJIA 2FKWB 1JO5A 4WB4A 3OA8B 3AEEC 1G1JA 1SVFA 2WQYC 1SQBD 1RF1B 1EDKA 1FS0E 3IN6A 1U75B 5GTHH 1H1OA 1FC2C 4N3YB 2LR2A 1BE3G 3L72G 1K9MQ 1GW3A 1G2CB 2W83C 1KYOE 2FXMA 5KLIB 1KQSO 1Z56A 1BDDA 3G4SP 5K5GB 3L73J 1QGKB 2B12B 3H1HD 2ZYGA 4HJGH 1GQ1A 2C8SA 2QJPB 3A5TA 3GW6A 1SQPD 1HUCA 4WQBA 3S4RA 3HE5B 1FJ0A 1KQLA 2WVRA 1K8AQ 1OMIA 3V2RA 1L4AD 3BCCJ 3CCJP 3AEFC 1OW7A 3MUDC 3CPWO 4FAVA 1NU1D 5KLIC 2Q1KA 3CU4A 1CSWA 5KLVG 3Q5PA 1DEBA 1SFCA 2KP8A 1BGYD 3VMXA 1NTKK 1HRCA 3KQGA 3EFGA 1E2RA 2WSFJ 1M6ZA 3HD7D 3L72J 3HUSC 1IFIA 3RK2B 3L72D 4D6TG 1HJ0A 1JMBA 3HE4B 3II6A 5IY51 2LXCB 2ZFCA 4FB1A 3H1ID 1NKZB 2OYHC 1HTLC 1NTMK 2ZJSE 1QKSA 1JY2O 3SWSA 3HRNA 5EFWB 1MFZA 3CWBE 2BGVX 1SQPJ 2N18C 1KMIZ 4H0LB 2XKMA 4R4LA 2ITAA 1CCRA 2E75D 1JY3O 3TNUA 1J3SA 4P4QB 4H13B 3O6QB 3G71P 1NAFA 2PAJA 1SQVD 1KB9H 4WQ7A 2WSEJ 1EDIA 2WPVB 4EIEA 1PV3A 1LT1A 4ZNCA 4DZOA 1JY2P 2I1KA 5KAIE 3FWNA 1DIQC 1CRYA 1IC2A 4KJMA 2LITA 3TGUD 3ZOYA 2H89C 2FYZA 3H32B 1PGQA 4ASWA 3Q5SA 3SLEA 4IL6E 3CXHW 1LTJA 1CRIA 2V7QH 3IAOA 5KJ7D 1UIXA 4K3AA 1A56A 1JY2N 4H44C 3JCUH 3ZCFA 1LTSC 1HBWA 3GHGC 2JWAA 2QJYC 4XA4A 1F1CA 1VQKP 2ZXYA 1IQCA 4H0LC 1NU1J 1BGYG 1KB9E 3CC2P 1R5SA 4LC1A 1SP4A 1JY3P 3OA8A 4R4MA 2ZT9C 4FA4A 3CXHI 2O01N 3B4SA 2AEJA 1PPJD 2YNYA 1BE3D 2YIUB 3HTKB 3M9BA 3ORVA 1CORA 2EXVA 1NHLA 1C6OA 2BEQD 3C9IA 2BCCE 1VYDA 3HQ9A 2BCNB 4KT0J 3L70G 5TISV 5APYA 5DF5A 2C1UA 2JJLA 1M90Q 4OGQD 5AW0B 2L91A 5CCGD 1JUNA 1NU1K 1H32B 5AW6B 3MIWA 3HE5A 1IZNB 1SQBJ 1BCCE 2ZVOB 1EB7A 1NU1G 1BGYJ 3G3ZA 2J59M 4WQ9A 1M7LA 1YITP 1L9BC 2GM4A 1VQ8P 2HODB 4IOIH 4C46A 2K37A 1KQFB 4AAMA 1VQMP 5BU5A 1VQ9P 2FBWC 1LP1B 1QVGO 2KNCB 4IL6X 2FFDA 1PP9E 1FZFA 1LTGC 5CCGA 4WQEA 3IF4A 3L70D 4UB8H 1S9KD 2O3JA 2FFDB 2SPZA 2A06D 3OAKA 3BASA 1YEAA 1N86A 3ZDMA 4UB6V 2BEZF 2HR3A 5APVA 1YQ4C 1AJYA 2HG5D 5CIGB 1VF5D 1VQNP 1FHBA 3BVHA 3GMAA 2E5YA 1JM0A 1KV4A 1A2SA 1CRGA 2KS1A 1KFNA 1KFMA 2YXRB 3CX5D 4RESB 4ZKUA 5CIBB 3RL0D 1E5WA 1VQ7P 3L75G 1S4XA 5DJQC 3WUVA 3JBTB 3LW5J 3B5ND 1RF1C 2E76C 3AE1C 4RSZA 1J1DB 1ZXGA 1DIPA 1L0NJ 1F1FA 4HKZH 4WQCA 2XDJA 3A0HV 1RZ5A 2R3CA 1ETPA 4EI2A 1NTMD 2OYIA 4GEDB 1QL2A 3CD6P 4IL6V 1B7VA 1JOCA 1SQBE 3M9HA 2OQQA 3TGUE 3L4MA 1J2JB 2V4HA 1H31B 4JPZB 1RHZB 3FXEA 4TT3H 4H44B 2QA4P 1PPJG 2OZ1B 2I8FA 3AE8C 3C8VA 2JDIH 5B66V 3CWBG 3HQ7A 1LFMA 2A06G 2KXPB 2MJZA 1EZVD 1JY3N 1SS1A 3A7OA 2PP6A 3I56P 4EOTA 5H2FV 1LWUB 1CNOA 3KHUA 1S6VB 3RK2C 3KPEA 5E79V 1VQ6P 1N15A 3L75E 2P58A 1FDIA 4GOFA 1A02J 1QL1A 3GHGB 2N9YB 1WRGA 1E29A 3HD7A 2D2CD 3HD7B 1CIGA 1FOSF 3IR9A 2XNDH 2N18B 1QL4A 2BLFB 3DP5A 3FGAD 4MN4C 4YPCA 3M06A 3H1KG 2YCCA 2ZXEB 1DT1A 2HODA 2OTLP 1I55A 1K73Q 1FDOA 1YQ3C 3H1LG 1Q81Q 1QN2A 4AQRD 2Q5UA 4C7RA 2HPCA 1TU3F 2IBZG 1PGOA 3M0DA 2Q9IA 3OW2O 2WSSH 3A3YB 1QLED 2OYIC 4DOJA 3CX5H 3F89A 3S1KA 1X9VA 1GL2D 3P8CD 5GTIV 1X8YA 2XNXA 3AE3C 1BCCJ 3RBZA 3O8ZA 3L71G 1GKSA 3H1JE 3ZOXA 1GK4A 2WPSA 3PJSK 4AAOA 3WFDC 3H1JD 3OCDA 4IFMA 4GT1A 1FZCA 2QJKB 3OJAB 1SQVE 3CCMP 1RAPA 3TGUG 1EZVG 1I6EA 2HFED 2Z4EA 1IRVA 5B6QA 2ORLA 2CPSA 1X0TA 3RLMA 3ZOOA 2YMYA 3NBTA 2PRRA 2C2CA 2BCCG 3H1LJ 1M60A 1LC2A 3C2CA 1FU1A 1AOFA 1FI7A 1LTIC 3VRDA 2FFDC 1NU1E 1IFPA 4IFDK 5B5EH 3BRVB 1N2DC 2OYIB 2C1VA 5AW4B 1DVVA 2ZONG 1G1IA 1DX7A 2P1JA 1OZHA 3P7KA 2NPSD 3OA7A 2PGDA 2YO2A 4XXLA 3AE2C 3VMZA 1SQXJ 1PZQA 1FI9A 1CI6A 3TSIA 2H43A 1MG2D 3KYQA 1FI3A 2ZXXA 4M3LA 5B66E 1HJ4A 1N90A 5CIDB 1NGMB 2B4ZA 3SWFA 3CX5W 2IDBA 1RH5B 2E42A 1FBMA 2D0WA 1HJ3A 1VF5C 1LWUA 1L0NK 4ZKPA 1C52A 4N0KA 2C1DA 1CEDA 3W67A 4FANA 1OIPA 2AEFA 2R3SA 1FE6A 4ASVA 1W5CT 1QYZA 4B86A 5TISH 1D7MA 1I8PA 1I6DA 1GU4A 2QM8A 3PXWA 3BCCD 5CJ4A 2PFXA 3RL0g 1OW8A 2R5DA 1YJNP 1EXJA 2IYOA 5CYTR 3MP7B 4EDFA 2UWJE 2AI5A 2WZ7A 1AKKA 3ZIYA 2FY8A 1GDTA 3MHVA 2C9LY 1CYCA 3D6ZA 1GMJA 2FXOA 3KZIE 2QG4A 1LC1A 1KORA 3SWYA 1AQ5A 5DJQB 5DJUB 4EYYQ 3HQ6A 4C7NB 5C39A 3H1LE 4N78D 4DCKA 4KHXA 3CCLP 1KN7A 2N3YA 3WFCC 3H1HE 2KZIA 5KLVD 1L0LK 5CMZA 3PH2B 1FZGA 3CXHE 4U3FJ 4FA9A 1K05A 2GB8B 3CP5A 3M0AA 1MUUA 3CI9A 1KTMA 4NFGB 4XYDB 5C0ZA 4L73A 1FZBA 1PGPA 1S5LV 1ZLLA 2K88A 2N9JA 1WVEC 4AUWA 1M56D 1CYIA 5KAFH 2BH4X 1KC8Q 2GC4D 2P7JA 5E79E 1H0TA 1FOSE 2XZRA 3WU2V 2ZOOA 4D6TE 2KLVA 5APWA 5GTIH 1VL2A 1NH4A 1URQB 1HVVA 4NPFX 4L75A 1L0LG 4U3FD 4BRYB 3L72E 3KDPB 1U57A 4O1QA 2M3EA 4QMAA 2IBZE 3TF5A 1MKMA 1KYOH 3E1IA 1EQ7A 1YIQA 4Z1MH 2KLUA 1NTKD 2WT7B 2KZJA 4H44D 5KJ7C 2XU6A 1USEA 3MD0A 1OX3A 3CC4P 1AA0A 1FJPA 2N9IA 4PD4H 3GLMA 3L74E 3AEDC 2FYUG 4JYBA 5AVZB 4Q5PA 3AEGC 4IFFA 2WSFH 5KJ7A 2Y0EA 1ZP0C 3H1KD 4U7JA 4WQDA 3V4QA 3WU2E 4WY4D 3GG2A 1R5LA 2E75C 1OAEA 5AVUB 1CRCA 1SQPK 2CA4B 2M5AA 1DW1A 3C1LA 2YQBA 3H1IG 2IZ1A 3PXTA 1CTYA 2GUSA 1T2KC 1M1JA 1S5LE 2KI7B 3W68A 1EDJA 5CIHB 5CICB 5AURA 1BCCD 3G9RA 1LJ2A 4AYCA 4GIFA 1CTZA 3BCCE 2JQRA 1CC5A 1CO6A 1KZUB 4OH8B 3WC8A 1PP9G 1EZVI 5B5EE 2CE1A 3M9QA 1L0LD 1GW4A 4EIJA 3MTUE 1CYJA 2KS1B 3PTZA 2P2UA 4WY4B 1HH7A 4MU8A 1N73A 1KIBA 1P84H 2Z5IA 5AW1B 3S9OA 1H0TB 4GODA 1M1JB 3O6QA 5L8RJ 3I5CA 2RN0A 1NTZJ 3FX0A 1LTJB 2WSCH 2POHA 3MK7C 1W5CE 2E75B 2O1JA 3O5CA 3H1IJ 3RL0C 4A7PA 1LT9B 1OW6A 3RK3D 3H25A 1Q82Q 3VP8A 4JBZA 1W2BO 2D0SA 4GDOA 3N4XA 3MGNA 2PCCB 1BCCG 2O01J 1KYOD 2CA3B 1JNMA 2R5BA 1I8OA 5TJHA 5GTHE 3CMAP 3QH9A 1S1CX 1NTMJ 3WU2H 1PP9J 3CX5E 5AVYB 2CPBA 3P8CE 1GJQA 3L71D 1M8OB 1NJIQ 1QEXA 1DVHA 1EDLA 4GKGA 2Y0DA 1BE3J 2N3BA 1GU2A 4ZMDA 1CIEA 1YTZT 2BCCJ 1S2EA 3CCSP 1U7MA 1NMLA 3O0RC 1GTWA 1KYOW 5H2FH 4PD4I 2VRSA 2B88A 3NFQA 1ZOYC 1H31A 3RK3B 1N9CA 1RE3C 1URQA 1T3JA 2I1JA 3E1RA 3JCUE 3WMM0 5AVWB 2Q7CA 3B5NB 1RE4C 1ZV8A 3BCCG 351CA 1YCCA 1MG3D 3L73E 4L74A 1K04A 3AE4C 3VTPC 5EXQA 1YBKA 5AVRB 5CCHC 2KSEA 1KB0A 1P84E 2O1KA 2M0BA 5TISE 4H0KA 3P8MC 3F5HA 1KX2A 3Q2YA 2HPCB 2FRCA 1VQLP 1OXZA 4LLHA 4CPGA 1C6SA 4D6TJ 2W6JH 2OYHA 1ZMEC 2OGUA 2GC7D 1CIFA 3V4WA 4JQ0D 1KILD 2AXTV 3VYIA 3CCEP 1YEBA 3L4FA 3RK3C 4PV1D 1YIJP 2Q3EA 1N7SA 1MFTA 3MUDA 1PP9D 3M97X 1S5LX 2P67A 4H0LD 3RMZA 1HJBA 3I55P 2KNCA 1GL2A 2NPSA 1NTME 2V7QJ 1YFCA 3ITKA 1J1EB 2JO1A 4U3FE 1BSHA 1CHJA 1SQPE 4PJ0E 3VYMA 3V5BA 2N1TD 4Y99B 1RAQA 1FJKA 1HZUA 1MV8A 2GUVA 3TNUB 4WQAA 2RH0A 3SVWA 3MZWB 4D6TD 5AW5B 1NYHA 2FWLA 2MTAC 1JDLA 3SWKA 2KUBA 3VNWA 1CSXA 1H89A 3IFMA 2RMZA 1DD3A 2WITA 1OVVA 1CSUA 1M1JC 3SXTA 3N7NA 5AW7B 1SQQE 2G3AA 3A0BH 2CXBA 3L71J 2HYNA 5APQA 2ZAEB 1KYOI 2C1DB 1OVRA 4UB8E 2Q6QA 2IBZI 2W6BA 3OCDB 4O1WA 1H9XA 4U3FG 3L36A 4WY4C 4AANA 1N7LA 5CIEB 5AVTB 2JR8A 3AEBC 1J1EC 2K9YA 4W80A 2WSEH 3H1HJ 2YO3A 2AXCA 1YJWP 1LTJC 5H2FE 1N7SD 1J1DC 3H32A 3KXDA 4FA1A 1W2LA 3B8EB 3GHGA 1NWQA 3HUSA 1I5TA 1HJ5A 3UIAA 3Q1MA 3CYTI 4WWIA 4XE5B 3JC22 2CK3H 1T2KD 1SQBG 1EZVE 3V2NA 4HYTB 1E8EA 4RKUJ 3L35A 3CL3D 3ABVC 3U1AA 3KZIV 2E74D 4WBAA 1LTTC 2N1TB 3DMIA 3A0HH 1RQVA 3H6PA 3H1HG 1HGZA 1SFCC 1N73B 5AVXB 2A45I 2J5UA 2AIUA 1LWUC 1SQBK 1AVOA 3WFBC 1LTBC 4KMGA 3GF3A 3NMDA 3MK7B 4L1QA 4AX3A 5DFSA 1H33B 1ZRTD 2V08A 4C7NA 4L76A 1P84I 3LW5H 1FAVA 2N1TC 1HZVA 1XTCC 1LMSA 3H1JG 3D0WA 1L4AC 3EQ2A 1I54A 2OTJP 2W27A 2FYUK 2WMMA 1L2PA 1UIIA 3RK3E 2KB7P 2ZYDA 3O20A 1HH0A 1XTGB 3CLQA 5GTIE 3X39A 4RJTA 1Q2NA 4HH2A 1S5LH 3L75J 1PFIA 5E79H 1HCMA 3PRJA 4PWAA 1JCCA 5AW8B 4I7ZC 2GA1A 2L4DA 1VQ4P 3V2QA 4L3HA 1N73C 1YNRA 2OTKE 2QRXA 2K9JB 2CE0A 1OCDA 2ZBOA 1L0NE 1MZ9A 2I8DA 3CXHH 2BH5X 1FZEA 3L74G 5B66H 4K3IA 2H7HA 3CWBD 2YKOA 1HGVA 4JF7A 1L4AB 4FA5A 2E76D 4PD4E 4L3GA 1A8CA 5BVZA 3RN1A 2W90A 1GIWA 4Y99C 1RF0A 2YMKA 3CCVP 4Y28J 1IK7A 4XFJA 1DIIC 1KV9A 1L9JC 3USSA 3V6IA 1KX7A 1SQVK 5APUA
chains in the Genus database with same CATH topology
1CRJA 1NIRA 1CYJA 3PTZA 5B66V 2QJYB 1HH7A 2HV4A 3HQ7A 1LFMA 4MU8A 1KIBA 1EZVD 2BPBB 2RN0A 5H2FV 4QAOA 1C2RA 3MK7C 1CNOA 3KHUA 1S6VB 5CIFB 1YTCA 5E79V 1N15A 2B11B 1R0QA 3O5CA 4A7PA 2OZ1A 2DGEA 4YE1A 1DW2A 2V07A 1KB9D 1H9YA 2N9YB 4EICA 1E29A 2D0SA 1CIGA 2YK3A 5KAFV 1K3HA 2PCCB 1KYOD 2N18B 4V2KA 1QL4A 2CA3B 2BLFB 1I8OA 5TJHA 3DP5A 5B5EV 1CHIA 1K3GA 1ZZHA 4EIDA 2FYNB 2YCCA 1U74B 1DT1A 5KKZB 1I55A 3PHLA 1SQQD 1GJQA 3L71D 1LS9A 2FYUD 1QN2A 3VMAA 5KAIV 1DVHA 1NMIA 4LJIA 2Y0DA 2N3BA 1GU2A 1CIEA 3OA8B 1NMLA 3O0RC 1MZ4A 1KYOW 1SQBD 5GTIV 1H31A 1U75B 1H1OA 1N9CA 4PD4D 1HROA 1GKSA 1C75A 1FCDC 3ZOXA 4AAOA 5KLIB 3WFDC 3H1JD 3OCDA 3TDKA 2QJKB 155CA 4JCGA 1RAPA 1IRWA 1FOCA 2B12B 1I6EA 351CA 1IRVA 3H1HD 5B6QA 1YCCA 1MG3D 2ORLA 1GQ1A 2C8SA 3RLMA 2QJPB 3ZOOA 1AOQA 3GW6A 1SQPD 3NBTA 4WQBA 5EXQA 1FJ0A 2C2CA 1KB0A 2VHDA 3RN0A 1M60A 4H0KA 1LC2A 2PCBB 4Y5RA 1KX2A 3C2CA 3PLNA 2FRCA 1AOFA 1FI7A 3L74D 4FAVA 1NU1D 3VRDA 1C6SA 3CU4A 1CSWA 1QL3A 2GC7D 1CIFA 2C1VA 1BGYD 2AXTV 2ZONG 1DVVA 1HRCA 3CXHD 1YEBA 1E2RA 1M6ZA 1YICA 2Q3EA 4XXLA 3L72D 2BCCD 1PP9D 1FI9A 3M97X 1CCHA 1MG2D 5IY51 1FI3A 1N50A 3RMZA 4FB1A 3H1ID 1GDVA 3HQ8A 1HJ4A 1N90A 5CIDB 1C2NA 1QKSA 2B4ZA 3DR0A 2XTSB 3SWSA 3CX5W 2BGVX 1YFCA 3ITKA 2N18C 1P84D 2D0WA 1HJ3A 1CHJA 1CCRA 3VYMA 1RAQA 2Y0CA 2GIWA 1HZUA 1J3SA 4P4QB 4WQAA 1C52A 4N0KA 3SVWA 2PACA 2C1DA 1SQVD 1CEDA 1CRHA 4D6TD 4WQ7A 2FWLA 2MTAC 4FANA 1CXAA 1JDLA 1W5CT 3VNWA 4EIEA 1QYZA 1CSXA 1DIQC 1CRYA 1I8PA 4J20A 1I6DA 2RMZA 3PXWA 3TYIA 2LITA 1CSUA 3BCCD 3TGUD 2B10B 3SXTA 1BL9A 3ZOYA 2CXBA 1H33A 5CYTR 3SLEA 3CXHW 1CRIA 1IZL0 3ZBMA 2C1DB 4EDFA 2DVHA 1A56A 3OCDB 2AI5A 4O1WA 1AKKA 3ZCFA 3ZIYA 1H9XA 1CYCA 2JWAA 4AANA 1F1CA 5CIEB 2ZXYA 2QG4A 1IQCA 1LC1A 3OA8A 3L75D 5DJQB 4FA4A 4FA1A 1NNOA 1W2LA 4WQ8A 1PPJD 1BE3D 3HQ6A 2YIUB 3ORVA 1I5TA 3ZOWA 2N3YA 1CORA 3WFCC 2EXVA 1HJ5A 3CYTI 1C6OA 5KLVD 451CA 1DW0A 1VYDA 3HQ9A 2BCNB 5TISV 3PH2B 5DF5A 2C1UA 4UB8V 1CTJA 4FA9A 2GB8B 1CXCA 3CP5A 2L91A 1E8EA 4NFGB 1IO3A 5GTHV 4XYDB 1H32B 3KZIV 5C0ZA 1S5LV 3DMIA 2N9JA 1WVEC 1EB7A 1CYIA 2BH4X 2GC4D 4WQ9A 3O1YA 1L9BC 2AIUA 3WU2V 2ZOOA 5C9MA 3WFBC 4KMGA 4AAMA 3MK7B 4L1QA 4AX3A 3WFEC 5DFSA 1H33B 1ZRTD 1AYGA 2V08A 1CSVA 2KNCB 1HZVA 1M70A 3NWVA 1LMSA 4GYDA 4U3FD 4WQEA 3TF5A 4O1QA 1L0ND 1I54A 1YIQA 3L70D 2O3JA 1NTKD 2A06D 1DW3A 4DY9A 1YEAA 1SQXD 3A0BV 3O20A 4PW9B 3PXSA 3X39A 4UB6V 2JTIB 2N9IA 4RJTA 5CIGB 1CHHA 1FHBA 3H1LD 4H0JA 1HCMA 4Q5PA 1C7MA 4PWAA 3PRJA 1A2SA 1CRGA 2KS1A 2IBZD 1NTZD 2L4DA 3CX5D 2Y0EA 5CIBB 4L3HA 3H1KD 5DJQC 3L73D 3JBTB 4WQDA 1YNRA 2K9JB 4RSZA 2B0ZB 2CE0A 1OCDA 1H32A 1F1FA 2ZBOA 3GG2A 1OAEA 4WQCA 1CRCA 4EIFA 3A0HV 2CA4B 1RZ5A 2BH5X 1DW1A 3A9FA 1COTA 2YQBA 1ETPA 3PXTA 4K3IA 1CTYA 3WUIA 1NTMD 3CWBD 4GEDB 4FA5A 5CIHB 5CICB 4L3GA 5AURA 1A8CA 2LIRA 1BCCD 3RN1A 3FWLA 4IL6V 1GIWA 4AALA 1C6RA 1B7VA 3SJLA 1CTZA 2JQRA 1CC5A 2MHMA 3L4MA 1CIHA 1RZ6A 1CO6A 1H31B 3NBSA 1DIIC 3WC8A 4PJ0V 1KV9A 2CE1A 1L9JC 3L4OA 2C9XB 2ZZS1 2OZ1B 1L0LD 1WEJF 2I8FA 1KX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRJ A;  1NIR A;  1CYJ A;  3PTZ A;  5B66 V;  2QJY B;  1HH7 A;  2HV4 A;  3HQ7 A;  1LFM A;  4MU8 A;  1KIB A;  1EZV D;  2BPB B;  2RN0 A;  5H2F V;  4QAO A;  1C2R A;  3MK7 C;  1CNO A;  3KHU A;  1S6V B;  5CIF B;  1YTC A;  5E79 V;  1N15 A;  2B11 B;  1R0Q A;  3O5C A;  4A7P A;  2OZ1 A;  2DGE A;  4YE1 A;  1DW2 A;  2V07 A;  1KB9 D;  1H9Y A;  2N9Y B;  4EIC A;  1E29 A;  2D0S A;  1CIG A;  2YK3 A;  5KAF V;  1K3H A;  2PCC B;  1KYO D;  2N18 B;  4V2K A;  1QL4 A;  2CA3 B;  2BLF B;  1I8O A;  5TJH A;  3DP5 A;  5B5E V;  1CHI A;  1K3G A;  1ZZH A;  4EID A;  2FYN B;  2YCC A;  1U74 B;  1DT1 A;  5KKZ B;  1I55 A;  3PHL A;  1SQQ D;  1GJQ A;  3L71 D;  1LS9 A;  2FYU D;  1QN2 A;  3VMA A;  5KAI V;  1DVH A;  1NMI A;  4LJI A;  2Y0D A;  2N3B A;  1GU2 A;  1CIE A;  3OA8 B;  1NML A;  3O0R C;  1MZ4 A;  1KYO W;  1SQB D;  5GTI V;  1H31 A;  1U75 B;  1H1O A;  1N9C A;  4PD4 D;  1HRO A;  1GKS A;  1C75 A;  1FCD C;  3ZOX A;  4AAO A;  5KLI B;  3WFD C;  3H1J D;  3OCD A;  3TDK A;  2QJK B;  155C A;  4JCG A;  1RAP A;  1IRW A;  1FOC A;  2B12 B;  1I6E A;  351C A;  1IRV A;  3H1H D;  5B6Q A;  1YCC A;  1MG3 D;  2ORL A;  1GQ1 A;  2C8S A;  3RLM A;  2QJP B;  3ZOO A;  1AOQ A;  3GW6 A;  1SQP D;  3NBT A;  4WQB A;  5EXQ A;  1FJ0 A;  2C2C A;  1KB0 A;  2VHD A;  3RN0 A;  1M60 A;  4H0K A;  1LC2 A;  2PCB B;  4Y5R A;  1KX2 A;  3C2C A;  3PLN A;  2FRC A;  1AOF A;  1FI7 A;  3L74 D;  4FAV A;  1NU1 D;  3VRD A;  1C6S A;  3CU4 A;  1CSW A;  1QL3 A;  2GC7 D;  1CIF A;  2C1V A;  1BGY D;  2AXT V;  2ZON G;  1DVV A;  1HRC A;  3CXH D;  1YEB A;  1E2R A;  1M6Z A;  1YIC A;  2Q3E A;  4XXL A;  3L72 D;  2BCC D;  1PP9 D;  1FI9 A;  3M97 X;  1CCH A;  1MG2 D;  5IY5 1;  1FI3 A;  1N50 A;  3RMZ A;  4FB1 A;  3H1I D;  1GDV A;  3HQ8 A;  1HJ4 A;  1N90 A;  5CID B;  1C2N A;  1QKS A;  2B4Z A;  3DR0 A;  2XTS B;  3SWS A;  3CX5 W;  2BGV X;  1YFC A;  3ITK A;  2N18 C;  1P84 D;  2D0W A;  1HJ3 A;  1CHJ A;  1CCR A;  3VYM A;  1RAQ A;  2Y0C A;  2GIW A;  1HZU A;  1J3S A;  4P4Q B;  4WQA A;  1C52 A;  4N0K A;  3SVW A;  2PAC A;  2C1D A;  1SQV D;  1CED A;  1CRH A;  4D6T D;  4WQ7 A;  2FWL A;  2MTA C;  4FAN A;  1CXA A;  1JDL A;  1W5C T;  3VNW A;  4EIE A;  1QYZ A;  1CSX A;  1DIQ C;  1CRY A;  1I8P A;  4J20 A;  1I6D A;  2RMZ A;  3PXW A;  3TYI A;  2LIT A;  1CSU A;  3BCC D;  3TGU D;  2B10 B;  3SXT A;  1BL9 A;  3ZOY A;  2CXB A;  1H33 A;  5CYT R;  3SLE A;  3CXH W;  1CRI A;  1IZL 0;  3ZBM A;  2C1D B;  4EDF A;  2DVH A;  1A56 A;  3OCD B;  2AI5 A;  4O1W A;  1AKK A;  3ZCF A;  3ZIY A;  1H9X A;  1CYC A;  2JWA A;  4AAN A;  1F1C A;  5CIE B;  2ZXY A;  2QG4 A;  1IQC A;  1LC1 A;  3OA8 A;  3L75 D;  5DJQ B;  4FA4 A;  4FA1 A;  1NNO A;  1W2L A;  4WQ8 A;  1PPJ D;  1BE3 D;  3HQ6 A;  2YIU B;  3ORV A;  1I5T A;  3ZOW A;  2N3Y A;  1COR A;  3WFC C;  2EXV A;  1HJ5 A;  3CYT I;  1C6O A;  5KLV D;  451C A;  1DW0 A;  1VYD A;  3HQ9 A;  2BCN B;  5TIS V;  3PH2 B;  5DF5 A;  2C1U A;  4UB8 V;  1CTJ A;  4FA9 A;  2GB8 B;  1CXC A;  3CP5 A;  2L91 A;  1E8E A;  4NFG B;  1IO3 A;  5GTH V;  4XYD B;  1H32 B;  3KZI V;  5C0Z A;  1S5L V;  3DMI A;  2N9J A;  1WVE C;  1EB7 A;  1CYI A;  2BH4 X;  2GC4 D;  4WQ9 A;  3O1Y A;  1L9B C;  2AIU A;  3WU2 V;  2ZOO A;  5C9M A;  3WFB C;  4KMG A;  4AAM A;  3MK7 B;  4L1Q A;  4AX3 A;  3WFE C;  5DFS A;  1H33 B;  1ZRT D;  1AYG A;  2V08 A;  1CSV A;  2KNC B;  1HZV A;  1M70 A;  3NWV A;  1LMS A;  4GYD A;  4U3F D;  4WQE A;  3TF5 A;  4O1Q A;  1L0N D;  1I54 A;  1YIQ A;  3L70 D;  2O3J A;  1NTK D;  2A06 D;  1DW3 A;  4DY9 A;  1YEA A;  1SQX D;  3A0B V;  3O20 A;  4PW9 B;  3PXS A;  3X39 A;  4UB6 V;  2JTI B;  2N9I A;  4RJT A;  5CIG B;  1CHH A;  1FHB A;  3H1L D;  4H0J A;  1HCM A;  4Q5P A;  1C7M A;  4PWA A;  3PRJ A;  1A2S A;  1CRG A;  2KS1 A;  2IBZ D;  1NTZ D;  2L4D A;  3CX5 D;  2Y0E A;  5CIB B;  4L3H A;  3H1K D;  5DJQ C;  3L73 D;  3JBT B;  4WQD A;  1YNR A;  2K9J B;  4RSZ A;  2B0Z B;  2CE0 A;  1OCD A;  1H32 A;  1F1F A;  2ZBO A;  3GG2 A;  1OAE A;  4WQC A;  1CRC A;  4EIF A;  3A0H V;  2CA4 B;  1RZ5 A;  2BH5 X;  1DW1 A;  3A9F A;  1COT A;  2YQB A;  1ETP A;  3PXT A;  4K3I A;  1CTY A;  3WUI A;  1NTM D;  3CWB D;  4GED B;  4FA5 A;  5CIH B;  5CIC B;  4L3G A;  5AUR A;  1A8C A;  2LIR A;  1BCC D;  3RN1 A;  3FWL A;  4IL6 V;  1GIW A;  4AAL A;  1C6R A;  1B7V A;  3SJL A;  1CTZ A;  2JQR A;  1CC5 A;  2MHM A;  3L4M A;  1CIH A;  1RZ6 A;  1CO6 A;  1H31 B;  3NBS A;  1DII C;  3WC8 A;  4PJ0 V;  1KV9 A;  2CE1 A;  1L9J C;  3L4O A;  2C9X B;  2ZZS 1;  2OZ1 B;  1L0L D;  1WEJ F;  2I8F A;  1KX7 A; 
#chains in the Genus database with same CATH topology
 3H1K E;  1CRJ A;  1GD2 E;  1NIR A;  3B5N A;  2ZYA A;  3T97 A;  1KIL B;  4I7Z B;  1SQQ J;  1NTM G;  2HV4 A;  5AW9 B;  3WUU A;  1YTZ I;  2BPB B;  1FZA A;  2E74 B;  4UB6 E;  2M5A B;  3HUS B;  1C2R A;  2N9B A;  5CIF B;  3A0B E;  4I2L C;  1N7S C;  5KAF E;  4YTP C;  1L0L J;  1R0Q A;  1URQ C;  2WWW A;  2OZ1 A;  2DGE A;  4YE1 A;  1DW2 A;  1ZN5 A;  3H1K J;  2V07 A;  1KB9 D;  1AV1 A;  3V2P A;  4EIC A;  5KLV K;  3RK2 D;  5M1B A;  1S9K E;  3LIE A;  4YXD C;  1IO4 A;  4H13 D;  2IPP A;  1JB0 J;  3M0D C;  5B5E V;  1K3G A;  1ZZH A;  4EID A;  2FYN B;  2M8R A;  3TK1 A;  1OVU A;  1U74 B;  2L5G B;  1CZQ A;  2FYU J;  4I1L A;  3RL0 B;  1SQQ D;  5CCH A;  1LS9 A;  2FYU D;  1QVF O;  5CBO A;  5KAI V;  1KIL C;  2QVA A;  1VDF A;  1OWA A;  1LTA C;  2IZ0 A;  1MZ4 A;  3L37 A;  1URQ D;  3QWO C;  1NOH A;  2QJP C;  1NTK E;  4PD4 D;  2D2C B;  1HRO A;  3KZI H;  3AEC C;  1N7S B;  1R8E A;  4DT0 A;  2R44 A;  3CX5 I;  1AVY A;  1C75 A;  1FCD C;  5AVS B;  4WY4 A;  3TDK A;  5KTB A;  3M91 A;  155C A;  2WPR A;  1RE4 A;  4JCG A;  1IRW A;  2JKV A;  1Y47 A;  1FOC A;  1SQX K;  2B89 A;  3EFF K;  2K9J A;  1AOQ A;  1H88 A;  1BE3 E;  3RGU A;  1PL5 A;  1CI6 B;  2ZVN B;  1ZR2 A;  1U7J A;  1X22 A;  2A45 G;  2QE7 H;  5CBN A;  1DEE G;  2VHD A;  3RN0 A;  3TGU J;  1EC5 A;  2PCB B;  4Y5R A;  1VQO P;  3PLN A;  3CCR P;  1NAY A;  3L74 D;  1NTZ K;  5AVV B;  1NO4 A;  3A0H E;  2WPQ A;  5AW2 B;  1QL3 A;  4YXW H;  1L4A A;  1M1K Q;  1RY3 A;  4PV1 B;  1NTK G;  3AE6 C;  4TLF A;  3L70 J;  2OAR A;  3CXH D;  1BGY E;  3TYY A;  1Y8A A;  1CW5 A;  1YIC A;  2BCC D;  3EWK A;  1CCH A;  1YJ9 P;  1T6A A;  1N50 A;  1LT9 C;  1HWT C;  1GDV A;  3HQ8 A;  1GL2 C;  1ZRT E;  1C2N A;  2G8Y A;  2E43 A;  3DR0 A;  2XTS B;  1JEK A;  3Q5R A;  1P84 D;  3P32 A;  1QX8 A;  1EXI A;  3VP9 A;  1SQX G;  1E79 H;  2B9B A;  2NRG A;  3CC7 P;  2Y0C A;  4NPE A;  2GIW A;  4BWN A;  2KYV A;  3AEA C;  5KLV J;  5KKZ C;  1NVO A;  1S72 P;  2PAC A;  1CSB A;  1IK9 A;  3BRT B;  1CRH A;  3D71 A;  2XV5 A;  1GU5 A;  1CXA A;  3NTN A;  1L0L E;  2N1T A;  5DJT B;  1NTZ E;  1GL2 B;  3AE9 C;  3SFD C;  4J20 A;  1NTK J;  3TYI A;  2YXQ B;  2B10 B;  4W7Y A;  1BL9 A;  4HB1 A;  3A2A A;  1WMK A;  1SQQ K;  4IL6 H;  3FXD A;  1IJD B;  1AQT A;  1RE3 A;  1SQP G;  1H33 A;  5APX A;  1IZL 0;  2QEX P;  1H8A A;  3ZBM A;  5CHX A;  2K1A A;  4UB6 H;  1M57 D;  4BXL A;  2DVH A;  3WUT A;  3LID A;  1VQP P;  2P10 A;  1IFM A;  1S3J A;  2K3R A;  3L70 E;  1G2C A;  2C9N Y;  2KK7 A;  5KAI H;  1KIL A;  3B5N C;  2Y9Z A;  2R32 A;  2E74 C;  3L75 D;  3AE5 C;  1NNO A;  1PPJ E;  2C0X A;  2LXB A;  2QIW A;  4WQ8 A;  3HE4 A;  2YKP A;  3AE7 C;  3JSV C;  4LGD E;  2AEM A;  1RQU A;  1SFC D;  3ZOW A;  3H1I E;  3U59 A;  1NKN A;  2Y9Y A;  451C A;  1DW0 A;  1DH3 A;  2AXT H;  5CJ0 A;  2FYN C;  4UB8 V;  3Q3D A;  1CTJ A;  3CCQ P;  1CXC A;  2D2C C;  3H1J J;  4O9B A;  2JP3 A;  1IO3 A;  5GTH V;  1A02 F;  1SQV G;  3GF7 A;  3VOP A;  2JEE A;  5KLV E;  2FXP A;  1JTH A;  1OFC X;  1YI2 P;  3SSU A;  3O1Y A;  5APT A;  1IFD A;  4W7Z A;  1ZW0 A;  5C9M A;  2Z5H A;  1YYC A;  4NPD A;  3WFE C;  3HTK A;  1CSV A;  2KSJ A;  2IFN A;  1T3U A;  1USD A;  1Q86 Q;  2KIK A;  1M70 A;  4N6J A;  3CCU P;  3NWV A;  4GYD A;  5BU8 B;  1L0N D;  3HD7 C;  1BSN A;  2J58 A;  4BRY A;  2WT7 A;  4RO0 A;  3B71 A;  1DW3 A;  3CME P;  4DY9 A;  1FDM A;  1KIL E;  1SQX D;  3A0B V;  1IFN A;  1KQG B;  1RF0 C;  4PW9 B;  3L74 J;  2E76 B;  2NZ2 A;  5APS A;  3PXS A;  4OWF A;  1SQV J;  2JTI B;  5AVQ B;  2QSI A;  1CHH A;  3H1L D;  4K35 A;  4N78 E;  4H0J A;  1PIX A;  3R4Y A;  1C7M A;  3SFE C;  5AW3 B;  3T97 B;  2IBZ D;  1Y9B A;  4DJG A;  1AFO A;  1NTZ D;  2H88 C;  3PP5 A;  2H8P D;  2HLO A;  2ZT9 B;  3L73 D;  2W6A A;  1W2E A;  1RF1 A;  2JWD A;  2B0Z B;  1LP1 A;  4PJ0 H;  2A45 H;  2Q3I A;  1H32 A;  1SQQ G;  4GOE A;  3E7K A;  1Q7Y Q;  4EIF A;  3A9F A;  1COT A;  2MKV A;  4OGQ C;  2OYH B;  2WSC J;  1LGH B;  2QJK C;  2E5T A;  3WUI A;  1DD4 A;  2LKM A;  2WTY A;  2BAS A;  2LIR A;  3FWL A;  2RKL A;  4AAL A;  1C6R A;  4JYC A;  1GZL A;  3SJL A;  3BAT A;  2MHM A;  1IFJ A;  1CIH A;  1RZ6 A;  4OVN F;  3VN0 A;  4H13 C;  3NBS A;  2DW3 A;  3VMY A;  2O01 H;  4PJ0 V;  3K5B A;  1WT6 A;  2IFM A;  2W8Z A;  3L4O A;  2C9X B;  2ZZS 1;  1AYG A;  1WEJ F;  2FYU E;  1JMM A;  2ZT9 D;  3L71 E;  1L0N G;  3D6Y A;  1FZC B;  2QJY B;  2IYP A;  3PH0 A;  1HF9 A;  2B87 A;  4PV1 C;  3NXS A;  1SFC B;  3U1C A;  2B87 B;  2YKQ A;  2M3B A;  1JTH B;  3G6E P;  4QAO A;  1KD1 Q;  1JCD A;  1YTC A;  2B11 B;  1GK6 A;  2NPS B;  1PGJ A;  1SQX E;  3R2P A;  1H9Y A;  1BDC A;  4OGQ B;  1LT9 A;  2A06 E;  1LNQ A;  1VPC A;  1NTZ G;  2C0W A;  1KB9 I;  5CCG C;  2OYO A;  2YK3 A;  5KAF V;  1FZC C;  1K3H A;  4I6M C;  4V2K A;  1VF5 B;  5CCH D;  3L73 G;  1Q90 D;  1CHI A;  2IX7 C;  1VQ5 P;  3D70 A;  2QM7 A;  2AXT E;  3CWB J;  1YHQ P;  5KKZ B;  1SLQ A;  1N8R Q;  3PHL A;  1T8Z A;  4WVZ A;  2YIU C;  3VMA A;  1ZR4 A;  2NPS C;  1X79 B;  1NMI A;  3RBX A;  2KOG A;  4LJI A;  2FKW B;  1JO5 A;  4WB4 A;  3OA8 B;  3AEE C;  1G1J A;  1SVF A;  2WQY C;  1SQB D;  1RF1 B;  1EDK A;  1FS0 E;  3IN6 A;  1U75 B;  5GTH H;  1H1O A;  1FC2 C;  4N3Y B;  2LR2 A;  1BE3 G;  3L72 G;  1K9M Q;  1GW3 A;  1G2C B;  2W83 C;  1KYO E;  2FXM A;  5KLI B;  1KQS O;  1Z56 A;  1BDD A;  3G4S P;  5K5G B;  3L73 J;  1QGK B;  2B12 B;  3H1H D;  2ZYG A;  4HJG H;  1GQ1 A;  2C8S A;  2QJP B;  3A5T A;  3GW6 A;  1SQP D;  1HUC A;  4WQB A;  3S4R A;  3HE5 B;  1FJ0 A;  1KQL A;  2WVR A;  1K8A Q;  1OMI A;  3V2R A;  1L4A D;  3BCC J;  3CCJ P;  3AEF C;  1OW7 A;  3MUD C;  3CPW O;  4FAV A;  1NU1 D;  5KLI C;  2Q1K A;  3CU4 A;  1CSW A;  5KLV G;  3Q5P A;  1DEB A;  1SFC A;  2KP8 A;  1BGY D;  3VMX A;  1NTK K;  1HRC A;  3KQG A;  3EFG A;  1E2R A;  2WSF J;  1M6Z A;  3HD7 D;  3L72 J;  3HUS C;  1IFI A;  3RK2 B;  3L72 D;  4D6T G;  1HJ0 A;  1JMB A;  3HE4 B;  3II6 A;  5IY5 1;  2LXC B;  2ZFC A;  4FB1 A;  3H1I D;  1NKZ B;  2OYH C;  1HTL C;  1NTM K;  2ZJS E;  1QKS A;  1JY2 O;  3SWS A;  3HRN A;  5EFW B;  1MFZ A;  3CWB E;  2BGV X;  1SQP J;  2N18 C;  1KMI Z;  4H0L B;  2XKM A;  4R4L A;  2ITA A;  1CCR A;  2E75 D;  1JY3 O;  3TNU A;  1J3S A;  4P4Q B;  4H13 B;  3O6Q B;  3G71 P;  1NAF A;  2PAJ A;  1SQV D;  1KB9 H;  4WQ7 A;  2WSE J;  1EDI A;  2WPV B;  4EIE A;  1PV3 A;  1LT1 A;  4ZNC A;  4DZO A;  1JY2 P;  2I1K A;  5KAI E;  3FWN A;  1DIQ C;  1CRY A;  1IC2 A;  4KJM A;  2LIT A;  3TGU D;  3ZOY A;  2H89 C;  2FYZ A;  3H32 B;  1PGQ A;  4ASW A;  3Q5S A;  3SLE A;  4IL6 E;  3CXH W;  1LTJ A;  1CRI A;  2V7Q H;  3IAO A;  5KJ7 D;  1UIX A;  4K3A A;  1A56 A;  1JY2 N;  4H44 C;  3JCU H;  3ZCF A;  1LTS C;  1HBW A;  3GHG C;  2JWA A;  2QJY C;  4XA4 A;  1F1C A;  1VQK P;  2ZXY A;  1IQC A;  4H0L C;  1NU1 J;  1BGY G;  1KB9 E;  3CC2 P;  1R5S A;  4LC1 A;  1SP4 A;  1JY3 P;  3OA8 A;  4R4M A;  2ZT9 C;  4FA4 A;  3CXH I;  2O01 N;  3B4S A;  2AEJ A;  1PPJ D;  2YNY A;  1BE3 D;  2YIU B;  3HTK B;  3M9B A;  3ORV A;  1COR A;  2EXV A;  1NHL A;  1C6O A;  2BEQ D;  3C9I A;  2BCC E;  1VYD A;  3HQ9 A;  2BCN B;  4KT0 J;  3L70 G;  5TIS V;  5APY A;  5DF5 A;  2C1U A;  2JJL A;  1M90 Q;  4OGQ D;  5AW0 B;  2L91 A;  5CCG D;  1JUN A;  1NU1 K;  1H32 B;  5AW6 B;  3MIW A;  3HE5 A;  1IZN B;  1SQB J;  1BCC E;  2ZVO B;  1EB7 A;  1NU1 G;  1BGY J;  3G3Z A;  2J59 M;  4WQ9 A;  1M7L A;  1YIT P;  1L9B C;  2GM4 A;  1VQ8 P;  2HOD B;  4IOI H;  4C46 A;  2K37 A;  1KQF B;  4AAM A;  1VQM P;  5BU5 A;  1VQ9 P;  2FBW C;  1LP1 B;  1QVG O;  2KNC B;  4IL6 X;  2FFD A;  1PP9 E;  1FZF A;  1LTG C;  5CCG A;  4WQE A;  3IF4 A;  3L70 D;  4UB8 H;  1S9K D;  2O3J A;  2FFD B;  2SPZ A;  2A06 D;  3OAK A;  3BAS A;  1YEA A;  1N86 A;  3ZDM A;  4UB6 V;  2BEZ F;  2HR3 A;  5APV A;  1YQ4 C;  1AJY A;  2HG5 D;  5CIG B;  1VF5 D;  1VQN P;  1FHB A;  3BVH A;  3GMA A;  2E5Y A;  1JM0 A;  1KV4 A;  1A2S A;  1CRG A;  2KS1 A;  1KFN A;  1KFM A;  2YXR B;  3CX5 D;  4RES B;  4ZKU A;  5CIB B;  3RL0 D;  1E5W A;  1VQ7 P;  3L75 G;  1S4X A;  5DJQ C;  3WUV A;  3JBT B;  3LW5 J;  3B5N D;  1RF1 C;  2E76 C;  3AE1 C;  4RSZ A;  1J1D B;  1ZXG A;  1DIP A;  1L0N J;  1F1F A;  4HKZ H;  4WQC A;  2XDJ A;  3A0H V;  1RZ5 A;  2R3C A;  1ETP A;  4EI2 A;  1NTM D;  2OYI A;  4GED B;  1QL2 A;  3CD6 P;  4IL6 V;  1B7V A;  1JOC A;  1SQB E;  3M9H A;  2OQQ A;  3TGU E;  3L4M A;  1J2J B;  2V4H A;  1H31 B;  4JPZ B;  1RHZ B;  3FXE A;  4TT3 H;  4H44 B;  2QA4 P;  1PPJ G;  2OZ1 B;  2I8F A;  3AE8 C;  3C8V A;  2JDI H;  5B66 V;  3CWB G;  3HQ7 A;  1LFM A;  2A06 G;  2KXP B;  2MJZ A;  1EZV D;  1JY3 N;  1SS1 A;  3A7O A;  2PP6 A;  3I56 P;  4EOT A;  5H2F V;  1LWU B;  1CNO A;  3KHU A;  1S6V B;  3RK2 C;  3KPE A;  5E79 V;  1VQ6 P;  1N15 A;  3L75 E;  2P58 A;  1FDI A;  4GOF A;  1A02 J;  1QL1 A;  3GHG B;  2N9Y B;  1WRG A;  1E29 A;  3HD7 A;  2D2C D;  3HD7 B;  1CIG A;  1FOS F;  3IR9 A;  2XND H;  2N18 B;  1QL4 A;  2BLF B;  3DP5 A;  3FGA D;  4MN4 C;  4YPC A;  3M06 A;  3H1K G;  2YCC A;  2ZXE B;  1DT1 A;  2HOD A;  2OTL P;  1I55 A;  1K73 Q;  1FDO A;  1YQ3 C;  3H1L G;  1Q81 Q;  1QN2 A;  4AQR D;  2Q5U A;  4C7R A;  2HPC A;  1TU3 F;  2IBZ G;  1PGO A;  3M0D A;  2Q9I A;  3OW2 O;  2WSS H;  3A3Y B;  1QLE D;  2OYI C;  4DOJ A;  3CX5 H;  3F89 A;  3S1K A;  1X9V A;  1GL2 D;  3P8C D;  5GTI V;  1X8Y A;  2XNX A;  3AE3 C;  1BCC J;  3RBZ A;  3O8Z A;  3L71 G;  1GKS A;  3H1J E;  3ZOX A;  1GK4 A;  2WPS A;  3PJS K;  4AAO A;  3WFD C;  3H1J D;  3OCD A;  4IFM A;  4GT1 A;  1FZC A;  2QJK B;  3OJA B;  1SQV E;  3CCM P;  1RAP A;  3TGU G;  1EZV G;  1I6E A;  2HFE D;  2Z4E A;  1IRV A;  5B6Q A;  2ORL A;  2CPS A;  1X0T A;  3RLM A;  3ZOO A;  2YMY A;  3NBT A;  2PRR A;  2C2C A;  2BCC G;  3H1L J;  1M60 A;  1LC2 A;  3C2C A;  1FU1 A;  1AOF A;  1FI7 A;  1LTI C;  3VRD A;  2FFD C;  1NU1 E;  1IFP A;  4IFD K;  5B5E H;  3BRV B;  1N2D C;  2OYI B;  2C1V A;  5AW4 B;  1DVV A;  2ZON G;  1G1I A;  1DX7 A;  2P1J A;  1OZH A;  3P7K A;  2NPS D;  3OA7 A;  2PGD A;  2YO2 A;  4XXL A;  3AE2 C;  3VMZ A;  1SQX J;  1PZQ A;  1FI9 A;  1CI6 A;  3TSI A;  2H43 A;  1MG2 D;  3KYQ A;  1FI3 A;  2ZXX A;  4M3L A;  5B66 E;  1HJ4 A;  1N90 A;  5CID B;  1NGM B;  2B4Z A;  3SWF A;  3CX5 W;  2IDB A;  1RH5 B;  2E42 A;  1FBM A;  2D0W A;  1HJ3 A;  1VF5 C;  1LWU A;  1L0N K;  4ZKP A;  1C52 A;  4N0K A;  2C1D A;  1CED A;  3W67 A;  4FAN A;  1OIP A;  2AEF A;  2R3S A;  1FE6 A;  4ASV A;  1W5C T;  1QYZ A;  4B86 A;  5TIS H;  1D7M A;  1I8P A;  1I6D A;  1GU4 A;  2QM8 A;  3PXW A;  3BCC D;  5CJ4 A;  2PFX A;  3RL0 g;  1OW8 A;  2R5D A;  1YJN P;  1EXJ A;  2IYO A;  5CYT R;  3MP7 B;  4EDF A;  2UWJ E;  2AI5 A;  2WZ7 A;  1AKK A;  3ZIY A;  2FY8 A;  1GDT A;  3MHV A;  2C9L Y;  1CYC A;  3D6Z A;  1GMJ A;  2FXO A;  3KZI E;  2QG4 A;  1LC1 A;  1KOR A;  3SWY A;  1AQ5 A;  5DJQ B;  5DJU B;  4EYY Q;  3HQ6 A;  4C7N B;  5C39 A;  3H1L E;  4N78 D;  4DCK A;  4KHX A;  3CCL P;  1KN7 A;  2N3Y A;  3WFC C;  3H1H E;  2KZI A;  5KLV D;  1L0L K;  5CMZ A;  3PH2 B;  1FZG A;  3CXH E;  4U3F J;  4FA9 A;  1K05 A;  2GB8 B;  3CP5 A;  3M0A A;  1MUU A;  3CI9 A;  1KTM A;  4NFG B;  4XYD B;  5C0Z A;  4L73 A;  1FZB A;  1PGP A;  1S5L V;  1ZLL A;  2K88 A;  2N9J A;  1WVE C;  4AUW A;  1M56 D;  1CYI A;  5KAF H;  2BH4 X;  1KC8 Q;  2GC4 D;  2P7J A;  5E79 E;  1H0T A;  1FOS E;  2XZR A;  3WU2 V;  2ZOO A;  4D6T E;  2KLV A;  5APW A;  5GTI H;  1VL2 A;  1NH4 A;  1URQ B;  1HVV A;  4NPF X;  4L75 A;  1L0L G;  4U3F D;  4BRY B;  3L72 E;  3KDP B;  1U57 A;  4O1Q A;  2M3E A;  4QMA A;  2IBZ E;  3TF5 A;  1MKM A;  1KYO H;  3E1I A;  1EQ7 A;  1YIQ A;  4Z1M H;  2KLU A;  1NTK D;  2WT7 B;  2KZJ A;  4H44 D;  5KJ7 C;  2XU6 A;  1USE A;  3MD0 A;  1OX3 A;  3CC4 P;  1AA0 A;  1FJP A;  2N9I A;  4PD4 H;  3GLM A;  3L74 E;  3AED C;  2FYU G;  4JYB A;  5AVZ B;  4Q5P A;  3AEG C;  4IFF A;  2WSF H;  5KJ7 A;  2Y0E A;  1ZP0 C;  3H1K D;  4U7J A;  4WQD A;  3V4Q A;  3WU2 E;  4WY4 D;  3GG2 A;  1R5L A;  2E75 C;  1OAE A;  5AVU B;  1CRC A;  1SQP K;  2CA4 B;  2M5A A;  1DW1 A;  3C1L A;  2YQB A;  3H1I G;  2IZ1 A;  3PXT A;  1CTY A;  2GUS A;  1T2K C;  1M1J A;  1S5L E;  2KI7 B;  3W68 A;  1EDJ A;  5CIH B;  5CIC B;  5AUR A;  1BCC D;  3G9R A;  1LJ2 A;  4AYC A;  4GIF A;  1CTZ A;  3BCC E;  2JQR A;  1CC5 A;  1CO6 A;  1KZU B;  4OH8 B;  3WC8 A;  1PP9 G;  1EZV I;  5B5E E;  2CE1 A;  3M9Q A;  1L0L D;  1GW4 A;  4EIJ A;  3MTU E;  1CYJ A;  2KS1 B;  3PTZ A;  2P2U A;  4WY4 B;  1HH7 A;  4MU8 A;  1N73 A;  1KIB A;  1P84 H;  2Z5I A;  5AW1 B;  3S9O A;  1H0T B;  4GOD A;  1M1J B;  3O6Q A;  5L8R J;  3I5C A;  2RN0 A;  1NTZ J;  3FX0 A;  1LTJ B;  2WSC H;  2POH A;  3MK7 C;  1W5C E;  2E75 B;  2O1J A;  3O5C A;  3H1I J;  3RL0 C;  4A7P A;  1LT9 B;  1OW6 A;  3RK3 D;  3H25 A;  1Q82 Q;  3VP8 A;  4JBZ A;  1W2B O;  2D0S A;  4GDO A;  3N4X A;  3MGN A;  2PCC B;  1BCC G;  2O01 J;  1KYO D;  2CA3 B;  1JNM A;  2R5B A;  1I8O A;  5TJH A;  5GTH E;  3CMA P;  3QH9 A;  1S1C X;  1NTM J;  3WU2 H;  1PP9 J;  3CX5 E;  5AVY B;  2CPB A;  3P8C E;  1GJQ A;  3L71 D;  1M8O B;  1NJI Q;  1QEX A;  1DVH A;  1EDL A;  4GKG A;  2Y0D A;  1BE3 J;  2N3B A;  1GU2 A;  4ZMD A;  1CIE A;  1YTZ T;  2BCC J;  1S2E A;  3CCS P;  1U7M A;  1NML A;  3O0R C;  1GTW A;  1KYO W;  5H2F H;  4PD4 I;  2VRS A;  2B88 A;  3NFQ A;  1ZOY C;  1H31 A;  3RK3 B;  1N9C A;  1RE3 C;  1URQ A;  1T3J A;  2I1J A;  3E1R A;  3JCU E;  3WMM 0;  5AVW B;  2Q7C A;  3B5N B;  1RE4 C;  1ZV8 A;  3BCC G;  351C A;  1YCC A;  1MG3 D;  3L73 E;  4L74 A;  1K04 A;  3AE4 C;  3VTP C;  5EXQ A;  1YBK A;  5AVR B;  5CCH C;  2KSE A;  1KB0 A;  1P84 E;  2O1K A;  2M0B A;  5TIS E;  4H0K A;  3P8M C;  3F5H A;  1KX2 A;  3Q2Y A;  2HPC B;  2FRC A;  1VQL P;  1OXZ A;  4LLH A;  4CPG A;  1C6S A;  4D6T J;  2W6J H;  2OYH A;  1ZME C;  2OGU A;  2GC7 D;  1CIF A;  3V4W A;  4JQ0 D;  1KIL D;  2AXT V;  3VYI A;  3CCE P;  1YEB A;  3L4F A;  3RK3 C;  4PV1 D;  1YIJ P;  2Q3E A;  1N7S A;  1MFT A;  3MUD A;  1PP9 D;  3M97 X;  1S5L X;  2P67 A;  4H0L D;  3RMZ A;  1HJB A;  3I55 P;  2KNC A;  1GL2 A;  2NPS A;  1NTM E;  2V7Q J;  1YFC A;  3ITK A;  1J1E B;  2JO1 A;  4U3F E;  1BSH A;  1CHJ A;  1SQP E;  4PJ0 E;  3VYM A;  3V5B A;  2N1T D;  4Y99 B;  1RAQ A;  1FJK A;  1HZU A;  1MV8 A;  2GUV A;  3TNU B;  4WQA A;  2RH0 A;  3SVW A;  3MZW B;  4D6T D;  5AW5 B;  1NYH A;  2FWL A;  2MTA C;  1JDL A;  3SWK A;  2KUB A;  3VNW A;  1CSX A;  1H89 A;  3IFM A;  2RMZ A;  1DD3 A;  2WIT A;  1OVV A;  1CSU A;  1M1J C;  3SXT A;  3N7N A;  5AW7 B;  1SQQ E;  2G3A A;  3A0B H;  2CXB A;  3L71 J;  2HYN A;  5APQ A;  2ZAE B;  1KYO I;  2C1D B;  1OVR A;  4UB8 E;  2Q6Q A;  2IBZ I;  2W6B A;  3OCD B;  4O1W A;  1H9X A;  4U3F G;  3L36 A;  4WY4 C;  4AAN A;  1N7L A;  5CIE B;  5AVT B;  2JR8 A;  3AEB C;  1J1E C;  2K9Y A;  4W80 A;  2WSE H;  3H1H J;  2YO3 A;  2AXC A;  1YJW P;  1LTJ C;  5H2F E;  1N7S D;  1J1D C;  3H32 A;  3KXD A;  4FA1 A;  1W2L A;  3B8E B;  3GHG A;  1NWQ A;  3HUS A;  1I5T A;  1HJ5 A;  3UIA A;  3Q1M A;  3CYT I;  4WWI A;  4XE5 B;  3JC2 2;  2CK3 H;  1T2K D;  1SQB G;  1EZV E;  3V2N A;  4HYT B;  1E8E A;  4RKU J;  3L35 A;  3CL3 D;  3ABV C;  3U1A A;  3KZI V;  2E74 D;  4WBA A;  1LTT C;  2N1T B;  3DMI A;  3A0H H;  1RQV A;  3H6P A;  3H1H G;  1HGZ A;  1SFC C;  1N73 B;  5AVX B;  2A45 I;  2J5U A;  2AIU A;  1LWU C;  1SQB K;  1AVO A;  3WFB C;  1LTB C;  4KMG A;  3GF3 A;  3NMD A;  3MK7 B;  4L1Q A;  4AX3 A;  5DFS A;  1H33 B;  1ZRT D;  2V08 A;  4C7N A;  4L76 A;  1P84 I;  3LW5 H;  1FAV A;  2N1T C;  1HZV A;  1XTC C;  1LMS A;  3H1J G;  3D0W A;  1L4A C;  3EQ2 A;  1I54 A;  2OTJ P;  2W27 A;  2FYU K;  2WMM A;  1L2P A;  1UII A;  3RK3 E;  2KB7 P;  2ZYD A;  3O20 A;  1HH0 A;  1XTG B;  3CLQ A;  5GTI E;  3X39 A;  4RJT A;  1Q2N A;  4HH2 A;  1S5L H;  3L75 J;  1PFI A;  5E79 H;  1HCM A;  3PRJ A;  4PWA A;  1JCC A;  5AW8 B;  4I7Z C;  2GA1 A;  2L4D A;  1VQ4 P;  3V2Q A;  4L3H A;  1N73 C;  1YNR A;  2OTK E;  2QRX A;  2K9J B;  2CE0 A;  1OCD A;  2ZBO A;  1L0N E;  1MZ9 A;  2I8D A;  3CXH H;  2BH5 X;  1FZE A;  3L74 G;  5B66 H;  4K3I A;  2H7H A;  3CWB D;  2YKO A;  1HGV A;  4JF7 A;  1L4A B;  4FA5 A;  2E76 D;  4PD4 E;  4L3G A;  1A8C A;  5BVZ A;  3RN1 A;  2W90 A;  1GIW A;  4Y99 C;  1RF0 A;  2YMK A;  3CCV P;  4Y28 J;  1IK7 A;  4XFJ A;  1DII C;  1KV9 A;  1L9J C;  3USS A;  3V6I A;  1KX7 A;  1SQV K;  5APU A; 
#chains in the Genus database with same CATH homology
 1CRJ A;  1NIR A;  1CYJ A;  3PTZ A;  5B66 V;  2QJY B;  1HH7 A;  2HV4 A;  3HQ7 A;  1LFM A;  4MU8 A;  1KIB A;  1EZV D;  2BPB B;  2RN0 A;  5H2F V;  4QAO A;  1C2R A;  3MK7 C;  1CNO A;  3KHU A;  1S6V B;  5CIF B;  1YTC A;  5E79 V;  1N15 A;  2B11 B;  1R0Q A;  3O5C A;  4A7P A;  2OZ1 A;  2DGE A;  4YE1 A;  1DW2 A;  2V07 A;  1KB9 D;  1H9Y A;  2N9Y B;  4EIC A;  1E29 A;  2D0S A;  1CIG A;  2YK3 A;  5KAF V;  1K3H A;  2PCC B;  1KYO D;  2N18 B;  4V2K A;  1QL4 A;  2CA3 B;  2BLF B;  1I8O A;  5TJH A;  3DP5 A;  5B5E V;  1CHI A;  1K3G A;  1ZZH A;  4EID A;  2FYN B;  2YCC A;  1U74 B;  1DT1 A;  5KKZ B;  1I55 A;  3PHL A;  1SQQ D;  1GJQ A;  3L71 D;  1LS9 A;  2FYU D;  1QN2 A;  3VMA A;  5KAI V;  1DVH A;  1NMI A;  4LJI A;  2Y0D A;  2N3B A;  1GU2 A;  1CIE A;  3OA8 B;  1NML A;  3O0R C;  1MZ4 A;  1KYO W;  1SQB D;  5GTI V;  1H31 A;  1U75 B;  1H1O A;  1N9C A;  4PD4 D;  1HRO A;  1GKS A;  1C75 A;  1FCD C;  3ZOX A;  4AAO A;  5KLI B;  3WFD C;  3H1J D;  3OCD A;  3TDK A;  2QJK B;  155C A;  4JCG A;  1RAP A;  1IRW A;  1FOC A;  2B12 B;  1I6E A;  351C A;  1IRV A;  3H1H D;  5B6Q A;  1YCC A;  1MG3 D;  2ORL A;  1GQ1 A;  2C8S A;  3RLM A;  2QJP B;  3ZOO A;  1AOQ A;  3GW6 A;  1SQP D;  3NBT A;  4WQB A;  5EXQ A;  1FJ0 A;  2C2C A;  1KB0 A;  2VHD A;  3RN0 A;  1M60 A;  4H0K A;  1LC2 A;  2PCB B;  4Y5R A;  1KX2 A;  3C2C A;  3PLN A;  2FRC A;  1AOF A;  1FI7 A;  3L74 D;  4FAV A;  1NU1 D;  3VRD A;  1C6S A;  3CU4 A;  1CSW A;  1QL3 A;  2GC7 D;  1CIF A;  2C1V A;  1BGY D;  2AXT V;  2ZON G;  1DVV A;  1HRC A;  3CXH D;  1YEB A;  1E2R A;  1M6Z A;  1YIC A;  2Q3E A;  4XXL A;  3L72 D;  2BCC D;  1PP9 D;  1FI9 A;  3M97 X;  1CCH A;  1MG2 D;  5IY5 1;  1FI3 A;  1N50 A;  3RMZ A;  4FB1 A;  3H1I D;  1GDV A;  3HQ8 A;  1HJ4 A;  1N90 A;  5CID B;  1C2N A;  1QKS A;  2B4Z A;  3DR0 A;  2XTS B;  3SWS A;  3CX5 W;  2BGV X;  1YFC A;  3ITK A;  2N18 C;  1P84 D;  2D0W A;  1HJ3 A;  1CHJ A;  1CCR A;  3VYM A;  1RAQ A;  2Y0C A;  2GIW A;  1HZU A;  1J3S A;  4P4Q B;  4WQA A;  1C52 A;  4N0K A;  3SVW A;  2PAC A;  2C1D A;  1SQV D;  1CED A;  1CRH A;  4D6T D;  4WQ7 A;  2FWL A;  2MTA C;  4FAN A;  1CXA A;  1JDL A;  1W5C T;  3VNW A;  4EIE A;  1QYZ A;  1CSX A;  1DIQ C;  1CRY A;  1I8P A;  4J20 A;  1I6D A;  2RMZ A;  3PXW A;  3TYI A;  2LIT A;  1CSU A;  3BCC D;  3TGU D;  2B10 B;  3SXT A;  1BL9 A;  3ZOY A;  2CXB A;  1H33 A;  5CYT R;  3SLE A;  3CXH W;  1CRI A;  1IZL 0;  3ZBM A;  2C1D B;  4EDF A;  2DVH A;  1A56 A;  3OCD B;  2AI5 A;  4O1W A;  1AKK A;  3ZCF A;  3ZIY A;  1H9X A;  1CYC A;  2JWA A;  4AAN A;  1F1C A;  5CIE B;  2ZXY A;  2QG4 A;  1IQC A;  1LC1 A;  3OA8 A;  3L75 D;  5DJQ B;  4FA4 A;  4FA1 A;  1NNO A;  1W2L A;  4WQ8 A;  1PPJ D;  1BE3 D;  3HQ6 A;  2YIU B;  3ORV A;  1I5T A;  3ZOW A;  2N3Y A;  1COR A;  3WFC C;  2EXV A;  1HJ5 A;  3CYT I;  1C6O A;  5KLV D;  451C A;  1DW0 A;  1VYD A;  3HQ9 A;  2BCN B;  5TIS V;  3PH2 B;  5DF5 A;  2C1U A;  4UB8 V;  1CTJ A;  4FA9 A;  2GB8 B;  1CXC A;  3CP5 A;  2L91 A;  1E8E A;  4NFG B;  1IO3 A;  5GTH V;  4XYD B;  1H32 B;  3KZI V;  5C0Z A;  1S5L V;  3DMI A;  2N9J A;  1WVE C;  1EB7 A;  1CYI A;  2BH4 X;  2GC4 D;  4WQ9 A;  3O1Y A;  1L9B C;  2AIU A;  3WU2 V;  2ZOO A;  5C9M A;  3WFB C;  4KMG A;  4AAM A;  3MK7 B;  4L1Q A;  4AX3 A;  3WFE C;  5DFS A;  1H33 B;  1ZRT D;  1AYG A;  2V08 A;  1CSV A;  2KNC B;  1HZV A;  1M70 A;  3NWV A;  1LMS A;  4GYD A;  4U3F D;  4WQE A;  3TF5 A;  4O1Q A;  1L0N D;  1I54 A;  1YIQ A;  3L70 D;  2O3J A;  1NTK D;  2A06 D;  1DW3 A;  4DY9 A;  1YEA A;  1SQX D;  3A0B V;  3O20 A;  4PW9 B;  3PXS A;  3X39 A;  4UB6 V;  2JTI B;  2N9I A;  4RJT A;  5CIG B;  1CHH A;  1FHB A;  3H1L D;  4H0J A;  1HCM A;  4Q5P A;  1C7M A;  4PWA A;  3PRJ A;  1A2S A;  1CRG A;  2KS1 A;  2IBZ D;  1NTZ D;  2L4D A;  3CX5 D;  2Y0E A;  5CIB B;  4L3H A;  3H1K D;  5DJQ C;  3L73 D;  3JBT B;  4WQD A;  1YNR A;  2K9J B;  4RSZ A;  2B0Z B;  2CE0 A;  1OCD A;  1H32 A;  1F1F A;  2ZBO A;  3GG2 A;  1OAE A;  4WQC A;  1CRC A;  4EIF A;  3A0H V;  2CA4 B;  1RZ5 A;  2BH5 X;  1DW1 A;  3A9F A;  1COT A;  2YQB A;  1ETP A;  3PXT A;  4K3I A;  1CTY A;  3WUI A;  1NTM D;  3CWB D;  4GED B;  4FA5 A;  5CIH B;  5CIC B;  4L3G A;  5AUR A;  1A8C A;  2LIR A;  1BCC D;  3RN1 A;  3FWL A;  4IL6 V;  1GIW A;  4AAL A;  1C6R A;  1B7V A;  3SJL A;  1CTZ A;  2JQR A;  1CC5 A;  2MHM A;  3L4M A;  1CIH A;  1RZ6 A;  1CO6 A;  1H31 B;  3NBS A;  1DII C;  3WC8 A;  4PJ0 V;  1KV9 A;  2CE1 A;  1L9J C;  3L4O A;  2C9X B;  2ZZS 1;  2OZ1 B;  1L0L D;  1WEJ F;  2I8F A;  1KX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...