2IBZD

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
b'MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2ibzD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2ibzD02
3HQ9A 4U3FD 3HQ7A 1CIFA 1DW2A 1NTMD 2XTSB 1CRGA 1CXCA 1GJQA 1QYZA 2GC4D 2GIWA 1BE3D 2B11B 3M97X 4EIFA 1A2SA 2ZONG 2PACA 1GKSA 1FCDC 4WQ9A 1E2RA 1RAPA 2RN0A 2DGEA 1LS9A 1CC5A 4L3GA 4XXLA 1LFMA 2C8SA 2CE0A 1GQ1A 4MU8A 4UB6V 5TISV 1N9CA 2BCCD 1MZ4A 1CORA 3OCDA 4WQ7A 3H1HD 1C2RA 1CHIA 5CICB 1PP9D 1QL3A 1OCDA 1HJ5A 4FANA 2N9IA 2B0ZB 1F1CA 1N50A 1DW3A 5GTIV 4GEDB 1I54A 4FA4A 2MTAC 4K3IA 1N15A 351CA 2YIUB 3VMAA 2CXBA 4JCGA 1CYIA 1FI3A 1NTKD 1AKKA 2OZ1B 1J3SA 3HQ6A 3PHLA 2BH5X 2QJKB 1I5TA 2O3JA 1CSXA 2JTIB 1KB9D 1CO6A 4A7PA 3RN0A 2CA4B 1H1OA 3WU2V 5C0ZA 3RMZA 1CXAA 1W5CT 1EZVD 3RLMA 4AX3A 5C9MA 3A0BV 2D0WA 1AOFA 1NTZD 2KS1A 1KX2A 2K9JB 4H0KA 2QJYB 3PH2B 1FJ0A 1DIIC 3TF5A 1CTZA 1EB7A 1K3HA 4N0KA 4WQCA 1L9BC 1CHJA 2JQRA 1U74B 2FWLA 1LC2A 5B5EV 2LIRA 4FA5A 1I6EA 1SQVD 1HROA 1HJ4A 451CA 2OZ1A 1C2NA 1M6ZA 3CWBD 1DW0A 5KAIV 5DJQC 3HQ8A 4KMGA 2CA3B 1BL9A 4Q5PA 3H1KD 2Q3EA 1IZL0 3ITKA 2BH4X 3PXSA 2RMZA 1M70A 1GU2A 1CTJA 1FI7A 3L4MA 3PTZA 1I6DA 1OAEA 1HCMA 1QL4A 4UB8V 3ZOYA 3FWLA 3WFBC 1DVVA 2Y0DA 4AAMA 1DW1A 1DVHA 2C9XB 1M60A 1CRYA 1CRIA 1CSUA 3WFDC 1H32B 3O5CA 4Y5RA 2FRCA 3L70D 1H9YA 1CIHA 3SVWA 4QAOA 3O0RC 1IO3A 3H1JD 1B7VA 3L73D 2CE1A 1LC1A 3BCCD 1YEAA 4D6TD 3CU4A 1HZVA 1FI9A 4LJIA 2D0SA 1CRCA 1CEDA 4PW9B 1YNRA 2N18C 1PPJD 2C1DB 155CA 3DR0A 1CCRA 4FAVA 3ORVA 1HJ3A 5EXQA 1AOQA 2Y0EA 2V08A 1IRVA 1QKSA 3TYIA 2N9YB 1KX7A 1NMIA 1CIEA 5DJQB 3SXTA 1SQXD 1ETPA 5E79V 1YIQA 1MG2D 3WUIA 3H1LD 5KAFV 2A06D 1NU1D 2N3BA 4YE1A 1L9JC 1CRJA 1RZ6A 4WQBA 1ZRTD 3L75D 2QG4A 4NFGB 4DY9A 1CYJA 3C2CA 1HZUA 3OA8B 2B12B 5GTHV 1I8PA 4RSZA 1CRHA 2N9JA 3PLNA 1NIRA 2FYUD 2C1DA 2ZXYA 2MHMA 5CIHB 5CYTR 2L4DA 1RZ5A 5DF5A 1C52A 3ZCFA 5CIFB 2FYNB 5H2FV 2LITA 4J20A 1YCCA 3TDKA 4L3HA 1U75B 3ZBMA 1NNOA 2V07A 4PD4D 4RJTA 3L72D 3ZOWA 2AIUA 3GW6A 3RN1A 3L4OA 2N18B 1IRWA 1P84D 2PCBB 2BLFB 2PCCB 1SQPD 1H31B 3NBTA 1KYOD 1SQQD 4AAOA 4AALA 3VRDA 4FA1A 1H9XA 4XYDB 2YCCA 3KHUA 4PJ0V 2BPBB 3MK7C 3GG2A 2IBZD 4O1WA 3X39A 3NWVA 1C6RA 3H1ID 3OCDB 3L74D 1KYOW 1CTYA 1KIBA 4EICA 3CXHD 1C6SA 4EIEA 3ZOOA 1CSVA 2GC7D 1FOCA 1S5LV 4WQ8A 1GDVA 1YTCA 3VYMA 1BCCD 5CIDB 1LMSA 2ZBOA 5KLIB 1W2LA 2AI5A 3SLEA 1NMLA 3A0HV 3PXWA 1H31A 2HV4A 3CXHW 1H33B 1WEJF 3PXTA 4EDFA 4IL6V 4P4QB 2ZZS1 3WFCC 1CYCA 2C1UA 4FB1A 2I8FA 3SWSA 3DMIA 3JBTB 3TGUD 1YFCA 3SJLA 1FHBA 1DIQC 1COTA 1L0LD 1AYGA 2VHDA 1YICA 5CIEB 5CIGB 2Y0CA 1I8OA 3CX5D 1GIWA 3WC8A 1VYDA 1H32A 1BGYD 1C6OA 1YEBA 4WQDA 1HH7A 1MG3D 1S6VB 3L71D 2BCNB 1E8EA 1C75A 3MK7B 3VNWA 4L1QA 4GYDA 3ZOXA 2B4ZA 3CX5W 5KKZB 1IQCA 1CCHA 4WQEA 1N90A 4V2KA 5B6QA 1A56A 2BGVX 2EXVA 1H33A 2B10B 1CSWA 1KV9A 3DP5A 2C1VA 1K3GA 4O1QA 5DFSA 5KLVD 1WVEC 3ZIYA 4AANA 5B66V 3O20A 1ZZHA 1R0QA 5CIBB 1DT1A 5TJHA 1A8CA 3KZIV 1RAQA 1I55A 1L0ND 5IY51 2C2CA 5AURA 2QJPB 1SQBD 3NBSA 2ZOOA 1HRCA 1QN2A 3CP5A 1C7MA 2L91A 1JDLA 1CIGA 2YQBA 3O1YA 1CHHA 1KB0A 2N3YA 2YK3A 3OA8A 2JWAA 1E29A 1F1FA 2KNCB 1CNOA 3WFEC 4EIDA 4FA9A 2GB8B 4WQAA 3PRJA 3A9FA 4PWAA 2AXTV 3CYTI 4H0JA 2DVHA 2ORLA
chains in the Genus database with same CATH superfamily
4I2LC 3L70E 3HQ7A 3E7KA 1X79B 2M5AB 2YXRB 1CXCA 3V2PA 3RK3E 3M97X 2YO2A 3Q5PA 1A2SA 1PIXA 3R4YA 1PPJE 5KJ7D 1G2CA 3H6PA 3H1HG 2KUBA 1RH5B 1LT9C 1LFMA 4I1LA 4H13D 3P7KA 1YQ4C 4MU8A 1N9CA 3HUSA 1CORA 1YHQP 2D2CB 4ZKPA 3L35A 1KN7A 1URQB 1HJ5A 2B0ZB 3L70J 3RK3C 4DOJA 1F1CA 1N50A 2QE7H 4KT0J 5CCGD 2AEFA 3HD7B 3L37A 1OW7A 4BRYB 4K3IA 2ZVOB 2HLOA 4LLHA 351CA 1YJ9P 4GODA 1HWTC 3GHGB 3VMAA 3A3YB 2CXBA 3OAKA 4JCGA 4GKGA 1CYIA 2FYUE 1AKKA 1J3SA 3HQ6A 3PHLA 5H2FH 1M57D 4TLFA 1I5TA 2ZYGA 1CSXA 2KK7A 1KB9D 2W6BA 5APQA 3CD6P 2ZT9D 1W5CE 2CPBA 1SQBG 3WU2V 1KFMA 1JEKA 1CXAA 5C9MA 3A0BV 5AW5B 3AE5C 4ASVA 2R3CA 4K3AA 1SQVG 4H0KA 3CWBG 1KYOE 4GT1A 1T3UA 1EB7A 2OYIB 4PJ0H 4WQCA 1KQSO 1U74B 4K35A 3B8EB 2E75B 3TK1A 3EFFK 1H0TB 2FWLA 2QIWA 4C46A 1I6EA 3I55P 2B87B 1HROA 1VQLP 2OZ1A 1M6ZA 1DW0A 2FYUJ 1AVOA 2ZYDA 4KMGA 4H0LD 1BL9A 1IK9A 1IZL0 3T97A 1ZR2A 1M70A 2FYUK 4PV1B 3L4MA 4M3LA 2O01J 1I6DA 1KILA 2OYHC 2Q5UA 1Z56A 1DVVA 3A0HH 4AAMA 3VP8A 1A02F 1DVHA 4AQRD 3L73G 1NOHA 4XFJA 1CRIA 1S2EA 4WY4A 1CSUA 4D6TG 3O5CA 2N1TB 2C9LY 2N9BA 1VQNP 3V6IA 2HYNA 2FYNC 2YNYA 2MKVA 1GW4A 2CPSA 4N78E 1IO3A 3H1JD 2E74C 3S9OA 1B7VA 1FDMA 2CE1A 1HBWA 1LC1A 4JYBA 1YEAA 1FI9A 4LJIA 3USSA 1OXZA 1CEDA 4PW9B 3S1KA 2C1DB 2OGUA 1T6AA 1K05A 1AVYA 1Y9BA 5EXQA 3RL0D 1AOQA 2Y0EA 1SFCD 2I1JA 3WU2E 1KX7A 3L75G 3A0BE 3SXTA 3M9QA 1SQXD 5E79V 4IFFA 2IFNA 4I7ZC 3CC7P 1ZR4A 5KAFV 2A06D 1VQ7P 1FZBA 1KYOI 4OGQC 1L9JC 3AEBC 3G9RA 1CRJA 2NPSA 1DIPA 3O8ZA 2E5YA 1JMMA 1ZRTD 1W2EA 2GM4A 1L0LJ 1X22A 4DY9A 5GTHV 4RSZA 1L0LK 2O01H 1NIRA 2NRGA 1FJPA 2ZXYA 2MHMA 1KFNA 3ZCFA 1YCCA 3TDKA 4L3HA 3ZBMA 1NNOA 2V07A 4PD4D 1GL2A 2AIUA 3M0AA 1KYOH 1T8ZA 2RKLA 3KPEA 3N7NA 1IRWA 1E79H 1J2JB 2PCBB 1GTWA 2BLFB 2XNXA 1N7SD 1BDDA 1FZEA 3IFMA 3H32B 5CCHA 3NBTA 3L74G 3QWOC 2Q7CA 4AALA 3FGAD 1H9XA 5AVTB 1LWUB 1ZOYC 3MK7C 2OTLP 3M9BA 2WMMA 3Q5SA 1WT6A 2IZ0A 3CXHH 1HJBA 1EDJA 4B86A 1LTAC 1HJ0A 4N6JA 3EFGA 2FXOA 2OTKE 3E1IA 2HPCB 1N86A 3HRNA 2GC7D 1S5LV 3H1JE 1JMBA 3B5NC 1FZAA 1FE6A 1T2KC 2BCCE 1BCCD 1LMSA 2ZBOA 2DW3A 1XTCC 2WSCJ 4GIFA 2R5BA 2QJYC 2NZ2A 5KAFE 3L4FA 3HE5B 1WEJF 1S5LX 1EXJA 1FZCA 2E76B 3TGUD 3Q1MA 1PV3A 2VHDA 2QM7A 5GTHE 3C1LA 2A06E 1H32A 1BGYD 3CC2P 1C6OA 1RF0C 2FYUG 1LTSC 1MG3D 1S6VB 2BCNB 3A0BH 1AQTA 1CI6A 4L1QA 5KKZB 1NTZE 2BCCJ 4YXWH 5KLVG 1IQCA 1CCHA 2Q6QA 3H1HJ 4WQEA 2H43A 3RL0C 3RBZA 5B6QA 1A56A 1J1DB 2UWJE 1H33A 1IJDB 3VP9A 3N4XA 1NJIQ 2C1VA 4L75A 3NTNA 1FOSF 5DFSA 4H44D 2ZVNB 4PD4E 1WVEC 2YKPA 3KDPB 2I8DA 2E74B 1SQVE 1UIIA 2QEXP 2WITA 3CI9A 3PP5A 1L4AC 3SWFA 1RQVA 2D2CC 5IY51 5AURA 5AVVB 4JF7A 3NBSA 1X0TA 1HRCA 3CP5A 1URQC 1JDLA 5AW2B 3BATA 2YQBA 3HD7C 1L2PA 1S5LE 2WSCH 3OA8A 1E29A 1NTZJ 4H13B 2KNCB 3WFEC 2BEQD 2GB8B 1NTZK 4BWNA 2YXQB 5KTBA 1FZGA 3MGNA 1KILD 3HQ9A 4U3FD 1CIFA 1XTGB 2VRSA 1CRGA 3L73E 2B11B 1SQVJ 2O01N 4EIFA 3CWBJ 2PACA 2GUVA 4WY4D 1GKSA 5AVQB 1SQVK 4WQ9A 4W7ZA 2RN0A 2Q3IA 2K37A 3RGUA 3AE7C 3LIDA 3O6QB 1CC5A 1VPCA 1ZLLA 2OYIC 1VQ4P 1M7LA 2CE0A 1LTTC 4C7RA 1GQ1A 2KP8A 2E75C 1HF9A 4UB6V 5TISV 2ZT9B 3AE1C 5KAFH 3OCDA 1OX3A 1C2RA 3MD0A 3IR9A 1OFCX 2M5AA 4FANA 1EDIA 3S4RA 2PAJA 3CCSP 1SLQA 1DW3A 1GZLA 4PV1C 5GTHH 3VMZA 1QX8A 4PD4I 2YIUB 3L73J 2OYOA 2FY8A 1N7LA 2J58A 4D6TJ 2XV5A 3SSUA 3M91A 2QJKB 3V4WA 1PFIA 1LNQA 4H0LB 2JTIB 1CO6A 2AEJA 3RN0A 2KOGA 1KTMA 2CA4B 1YIJP 1NKNA 1EZVD 1DD4A 3MZWB 1AOFA 4BXLA 1ZP0C 1RE3A 3BASA 2K9JB 5AW9B 2QJYB 1H8AA 3TF5A 1SQQE 2WT7A 3B4SA 1K3HA 3FXEA 1CHJA 4BRYA 3L75J 3VYIA 3CMAP 3GHGA 2H88C 5B5EV 4YPCA 2LIRA 4LC1A 4FA5A 2ZJSE 1QL1A 3W67A 5KAIV 3CCRP 1GU5A 2QA4P 3L74E 5CCHD 3H1KD 4U3FE 4YXDC 3PXSA 1NAYA 1GU2A 1QLED 3PTZA 1OAEA 4NPEA 1QL4A 1JB0J 4UB8V 2ZXEB 4YTPC 2WVRA 2P1JA 4UB6E 5TISE 1KORA 5AW8B 3RL0B 1SFCB 4L74A 1M60A 3H1JG 1OWAA 4W7YA 3CCQP 2OYIA 2BCCG 1QVGO 2L5GB 3WFDC 2LKMA 3UIAA 1SQQJ 4RO0A 4XE5B 4C7NB 1H9YA 3Q3DA 1SQQK 1CIHA 4XA4A 2B87A 1S4XA 3WUVA 1MFTA 2FFDC 1X8YA 1L4AB 3BCCD 3L74J 2WPVB 3TNUB 1YNRA 2FXMA 1E5WA 4FAVA 3GF3A 3L71E 1VDFA 2SPZA 2A06G 1PL5A 3FXDA 1ZN5A 1ZXGA 1N73A 2N9YB 1HGVA 1LWUC 3CLQA 2IX7C 1KD1Q 2IDBA 1CIEA 2C0XA 1NVOA 3AE9C 1RE4A 2V7QJ 3H1LD 2N1TA 3P32A 1NTZG 2MJZA 2N3BA 1RY3A 1GMJA 3P8CD 3VOPA 3HE4B 5KLVE 1RZ6A 1EZVE 4WQBA 3C2CA 1HZUA 5B5EE 3ABVC 1I8PA 5KAIE 2C1DA 1DD3A 4GOFA 5CYTR 1RZ5A 1M1JB 3K5BA 1C52A 1PGOA 3L71J 3KYQA 1U75B 4UB8E 2K1AA 1JY3O 2E76C 3L72D 1MKMA 1UIXA 1RF1A 1VQ9P 3II6A 2N18B 4JBZA 1P84D 1G2CB 2PCCB 2KSJA 1SQPD 1H31B 3HTKA 2JDIH 2YMKA 4L73A 3VRDA 5KLVJ 1U57A 1HH0A 3GG2A 3SWYA 2IBZD 4O1WA 5KLVK 1KZUB 1C6RA 1JY3N 4OH8B 5KKZC 3HUSB 1BCCG 1MFZA 1CTYA 1KIBA 3AE2C 1LT9A 4EICA 1J1DC 4EIEA 1GDTA 1CSVA 1J1EC 3MUDC 1QVFO 1GDVA 5CJ0A 2V7QH 5L8RJ 2W83C 4AUWA 3BCCE 3B71A 1IZNB 2ZYAA 3D70A 3TGUG 3WUUA 5KLIB 4IOIH 3I5CA 2Z5HA 1W2LA 2AI5A 1ZV8A 1QEXA 1NMLA 2K88A 1D7MA 2HG5D 4IL6V 1LWUA 2K3RA 5KJ7C 2I8FA 3SWSA 3DMIA 3JBTB 5AW1B 1YI2P 1GK6A 1YFCA 1EZVI 2AEMA 4L76A 1YTZT 1YICA 5CIEB 2K9YA 2Y0CA 3AE8C 2O1JA 1I8OA 4H44B 3CX5D 3H1LE 4H13C 3CCLP 2HPCA 4IL6X 4R4MA 1IFJA 2P2UA 1KB9E 2XU6A 2E43A 1OVRA 2WQYC 4WQDA 2AXCA 1CW5A 1C75A 3ZOXA 3LW5J 3CX5W 5CCGC 2PGDA 1N90A 1Q82Q 1JY3P 2KIKA 3RK2D 2BGVX 1HUCA 3T97B 1OW6A 1CSBA 3SFEC 3DP5A 4O1QA 1H89A 1LTGC 1KILB 3ZIYA 4AANA 5B66V 3O20A 1SQQG 5KAIH 1R0QA 2FFDB 5CIBB 1MV8A 2P7JA 1P84E 2ZT9C 1S72P 1R8EA 3KZIV 1SQPE 4HKZH 1I55A 1L0ND 2OYHA 1SQBD 4UB8H 4WY4B 1C7MA 2A45I 3RBXA 2KSEA 4NPFX 3RL0g 2CK3H 4U3FG 4MN4C 1NH4A 2GUSA 3CCUP 1F1FA 2YIUC 1CNOA 3JCUE 3R2PA 5AW7B 4WQAA 4PWAA 2AXTV 1VQ8P 2DVHA 2QJKC 3M9HA 2C9NY 3CPWO 4H0LC 3OJAB 1DW2A 1NTMD 3A2AA 2YKOA 1QYZA 1GU4A 1PGPA 1LTJC 1BE3D 2ZONG 1BSHA 5E79E 1E2RA 2JJLA 1RAPA 1LP1A 1NHLA 5AVSB 2H89C 3C8VA 5KJ7A 3LW5H 1OVVA 1K73Q 1K9MQ 1KB9I 1SQPK 3Q2YA 4XXLA 1PGJA 2W8ZA 2Z4EA 2Q1KA 3L71G 1SQXE 3MP7B 1MZ4A 4WQ7A 1CHIA 1T3JA 1PP9D 1OCDA 2N9IA 3WU2H 5GTIV 3CC4P 1ZRTE 4GEDB 3AEEC 5B66E 3H1JJ 1N15A 2IFMA 3CMEP 2HODA 1KB9H 2KZIA 1YQ3C 1NTKD 1EZVG 1P84I 3MHVA 3KZIE 1SFCC 3D6ZA 3U1AA 2BH5X 1R5LA 1LGHB 3O6QA 2PRRA 4LGDE 4QMAA 1J1EB 4TT3H 1EDKA 3L36A 3GF7A 1H1OA 2P58A 3VTPC 5C0ZA 1VQ5P 1SQXJ 3EWKA 2D0WA 2KS1A 1SQXK 1N2DC 2V4HA 3PH2B 1FJ0A 1H88A 2AXTE 1YJWP 3A7OA 3H1KG 1L9BC 1IK7A 1HJ4A 5APXA 5C39A 1JCCA 2FBWC 2CA3B 3ITKA 2BH4X 1DEEG 4IFMA 3CCMP 2RMZA 1CTJA 1FI7A 1IFPA 3B5NA 3NXSA 1NTME 1HCMA 1SVFA 2FXPA 1BE3E 1FZCB 1U7MA 3OA7A 3M0DC 3JCUH 1BCCE 3KXDA 1N7SC 3VN0A 1JY2N 3FWLA 3WFBC 2A45G 4ZMDA 5BU8B 1KMIZ 1RHZB 1DW1A 2C9XB 1IFDA 1SP4A 1LTIC 1BDCA 1WMKA 3C9IA 3BCCG 2FKWB 1H32B 1RQUA 2FRCA 1M1JC 3L70D 1ZMEC 3TGUE 5GTIE 3WUTA 1JNMA 1FU1A 4HYTB 1CI6B 1NYHA 5E79H 2QM8A 3GLMA 2W6JH 3RK3D 1PP9E 3V5BA 1BGYE 1RF0A 1M90Q 1JOCA 2N18C 1PPJD 4EI2A 155CA 3DR0A 5AVWB 1CCRA 3H1LG 1HJ3A 2HR3A 1IRVA 1BCCJ 1NTKE 1FAVA 1NTMK 1NMIA 4N3YB 5DJQB 3NFQA 1ETPA 2LXCB 1YIQA 1OMIA 3AE3C 5AW4B 3HUSC 3G71P 1NU1D 2NPSD 1JO5A 4C7NA 1W2BO 3OW2O 2XNDH 1KC8Q 3TGUJ 1VF5D 2QG4A 1LTJB 3CCEP 3U59A 4NFGB 2G8YA 1CYJA 3OA8B 1L4AA 2B12B 2JR8A 1CRHA 2FYZA 2N9JA 3L72G 5BU5A 2LXBA 5KLIC 3TNUA 1YITP 2FYUD 5CIHB 1BGYJ 2L4DA 1URQA 5AW6B 2HFED 4PD4H 2IYPA 2KYVA 3AE4C 2W90A 1R5SA 3HD7A 4J20A 1SQPG 3NMDA 1JCDA 1GL2D 1WRGA 5AW3B 4EYYQ 2AXTH 3RN1A 1FDIA 4H44C 2YMYA 2PP6A 1NTKK 1KILE 5CBOA 2J5UA 1Q86Q 1KYOD 1S5LH 3G4SP 4AAOA 4NPDA 4OWFA 4FA1A 2YCCA 1IFMA 1AV1A 1KQGB 3NWVA 1FS0E 3H1ID 3OCDB 1QGKB 1OW8A 1KYOW 3CXHD 1C6SA 2E74D 2WPSA 4Y28J 1PZQA 2P10A 1H0TA 1FOCA 4WQ8A 1NO4A 1KILC 4EOTA 3VYMA 1U7JA 4I6MC 2IYOA 4DT0A 1KQLA 3IN6A 2M0BA 3SLEA 1KQFB 1YBKA 5CHXA 5GTIH 1H31A 1IFIA 3CXHW 1SQXG 4U3FJ 2ZXXA 2E5TA 3RK2B 3CL3D 4HH2A 3IAOA 3WFCC 4WY4C 4FB1A 3SJLA 1AA0A 1COTA 1L0LD 1AYGA 2QRXA 1EDLA 5CIGB 4N78D 1USEA 4OGQD 1GIWA 1NU1E 2J59M 3P8MC 1VYDA 5EFWB 1QL2A 3A5TA 3F5HA 1YEBA 2WT7B 1HH7A 3V2NA 1EC5A 1N7SB 3FWNA 4GYDA 1JTHB 4DJGA 2Q9IA 3CCVP 2WSFJ 3V2QA 2KB7P 1PGQA 2EXVA 4ZKUA 4JQ0D 2M3BA 1L0NG 2PFXA 2JO1A 5AVXB 2M8RA 2NPSC 4EIJA 1ZZHA 1FC2C 5TJHA 3U1CA 3H1KE 1VF5C 2I1KA 1VL2A 1M1KQ 1NU1J 2QJPB 2RH0A 2ZOOA 2P67A 1IC2A 1NU1K 2L91A 3BRVB 5CMZA 4Y99C 1KB0A 1DH3A 2YK3A 2E42A 2JWAA 3H1IE 1NTMG 1FZFA 2R32A 4ASWA 1BE3G 4JYCA 1GL2C 3WMM0 2KLUA 1FOSE 4EIDA 1NGMB 3A9FA 3CXHE 3QH9A 3B5ND 2YKQA 4DZOA 4ZNCA 1T2KD 2JP3A 1FBMA 1K8AQ 2KXPB 5CCHC 4UB6H 5TISH 1Q7YQ 2OARA 2XTSB 1YTZI 1GJQA 2GC4D 1N73B 2FFDA 2GIWA 1M8OB 2KI7B 1JM0A 3H1KJ 1HVVA 1FCDC 2C0WA 2DGEA 3H32A 2WPQA 2XZRA 1MUUA 1LS9A 4RESB 1PP9G 2WSFH 4L3GA 1BGYG 2C8SA 1VQOP 1L0LE 1N8RQ 4JPZB 3H1IJ 3LIEA 2BCCD 2R3SA 4WB4A 3H1HD 2ZAEB 5CICB 1NTKG 1EXIA 1QL3A 3P8CE 5APUA 1Y47A 4FA4A 1I54A 2MTAC 3MTUE 2BEZF 1FZCC 3AEGC 1LT1A 3BCCJ 1FI3A 2OZ1B 1RF1B 2WWWA 3HE5A 2O3JA 3F89A 3HTKB 1EQ7A 4A7PA 5B5EH 1VQ6P 1L4AD 3L72E 1S9KD 2D2CD 3RMZA 5AVYB 1W5CT 3RLMA 4AX3A 2ZFCA 1DX7A 1NTZD 1URQD 3PJSK 3H1LJ 1KX2A 2QVAA 2WSEJ 1ZW0A 1VQKP 3HD7D 1DIIC 1CTZA 3CXHI 1LT9B 4N0KA 3TYYA 2JQRA 2IBZE 5APTA 3FX0A 1LC2A 1SQVD 451CA 1GK4A 1C2NA 3CWBD 1M56D 5DJQC 3HQ8A 4Q5PA 2Q3EA 2YO3A 3RK3B 3MUDA 1OZHA 1Q81Q 4Z1MH 4IL6E 4R4LA 1NAFA 2Z5IA 3ZOYA 3L70G 3L72J 2B88A 5AVZB 2Y0DA 5APSA 2A45H 3JC22 1CRYA 3JSVC 4OVNF 1SQPJ 2JEEA 2E75D 4Y5RA 3V2RA 1IFNA 2IZ1A 1PPJG 3IF4A 2NPSB 4W80A 3SVWA 5M1BA 4QAOA 3O0RC 1HTLC 3CX5E 5APYA 5CJ4A 3H1HE 4KJMA 3L73D 4U7JA 2KNCA 1VF5B 2O1KA 2XDJA 4D6TD 3CU4A 4PV1D 2H7HA 1HZVA 2OTJP 2D0SA 1CRCA 3AEDC 1VQMP 1LTBC 3AEAC 3ORVA 4Y99B 1NU1G 5CCGA 2V08A 1FJKA 1QKSA 3TYIA 3KQGA 2WSEH 1GL2B 3G6EP 1MG2D 2N1TD 3WUIA 3ZDMA 1DEBA 1YYCA 2QSIA 1X9VA 2R44A 2OYHB 4YE1A 2IPPA 4AYCA 3CCJP 3E1RA 1S9KE 3GMAA 3L75D 5DJUB 2IBZI 1GW3A 1NWQA 2Y9YA 3PLNA 1VQPP 1L0NE 2OQQA 3AEFC 1AQ5A 1SQBE 4WBAA 5AW0B 4HJGH 4RKUJ 5CBNA 5DF5A 2Y9ZA 1FDOA 5CIFB 2FYNB 5H2FV 2LITA 3RK2C 1JY2O 3MIWA 1P84H 3CWBE 2R5DA 5APWA 4RJTA 3ZOWA 3GW6A 3L4OA 2H8PD 1LP1B 3H1IG 3D6YA 1RE3C 3PH0A 1SQQD 1AFOA 1Q2NA 1MZ9A 1LTJA 1IO4A 4XYDB 3KHUA 1G1JA 4PJ0V 1S1CX 2JKVA 2BPBB 2WZ7A 2JWDA 3BRTB 3X39A 3AE6C 3GHGC 1AJYA 3CX5I 4I7ZB 2BASA 3EQ2A 1USDA 2K9JA 4GDOA 2ITAA 1L0NJ 2GA1A 5AVRB 3L74D 3G3ZA 4IL6H 4OGQB 1SQBJ 4CPGA 1L0NK 3ZOOA 1SQBK 3M06A 1YTCA 1NKZB 5CIDB 3SFDC 1KV4A 1SS1A 4D6TE 3D0WA 2HODB 1L0LG 1YJNP 3A0HV 5APVA 3PXWA 1LJ2A 2POHA 2HV4A 1H33B 3PXTA 4EDFA 3D71A 2QJPC 4P4QB 2ZZS1 1CYCA 3CX5H 2C1UA 2B89A 2WPRA 4GOEA 1NTMJ 1BE3J 1FHBA 3VMXA 1DIQC 1CZQA 1SFCA 1K04A 3I56P 2KS1B 1HGZA 3WC8A 1BSNA 2LR2A 2W6AA 3Q5RA 4WVZA 1TU3F 4WWIA 3L75E 5B66H 3L71D 1E8EA 5H2FE 3MK7B 3VNWA 1S3JA 2KZJA 3AECC 4KHXA 3W68A 2B4ZA 1GD2E 3KZIH 1N73C 1JY2P 1G1IA 2KLVA 4V2KA 1PP9J 5AVUB 3VMYA 3TSIA 2B10B 1RE4C 2G3AA 2E76D 2WTYA 1CSWA 1KV9A 2XKMA 3BVHA 2N1TC 1K3GA 4IFDK 1Y8AA 3B5NB 1A02J 5KLVD 4PJ0E 4O9BA 4DCKA 1OIPA 1NTKJ 1DT1A 1A8CA 2B9BA 2IBZG 1RAQA 2C2CA 2W27A 5BVZA 3HE4A 3M0DA 1QN2A 1N7SA 1CIGA 3SWKA 1JTHA 3O1YA 1CHHA 2N3YA 2WSSH 2M3EA 3H25A 5K5GB 1Q90D 4HB1A 1OVUA 4FA9A 5DJTB 3A0HE 3PRJA 3V4QA 1JUNA 1RF1C 3CYTI 4H0JA 1M1JA 2ORLA
chains in the Genus database with same CATH topology
3HQ9A 4U3FD 3HQ7A 1CIFA 1DW2A 1NTMD 2XTSB 1CRGA 1CXCA 1GJQA 1QYZA 2GC4D 2GIWA 1BE3D 2B11B 3M97X 4EIFA 1A2SA 2ZONG 2PACA 1GKSA 1FCDC 4WQ9A 1E2RA 1RAPA 2RN0A 2DGEA 1LS9A 1CC5A 4L3GA 4XXLA 1LFMA 2C8SA 2CE0A 1GQ1A 4MU8A 4UB6V 5TISV 1N9CA 2BCCD 1MZ4A 1CORA 3OCDA 4WQ7A 3H1HD 1C2RA 1CHIA 5CICB 1PP9D 1QL3A 1OCDA 1HJ5A 4FANA 2N9IA 2B0ZB 1F1CA 1N50A 1DW3A 5GTIV 4GEDB 1I54A 4FA4A 2MTAC 4K3IA 1N15A 351CA 2YIUB 3VMAA 2CXBA 4JCGA 1CYIA 1FI3A 1NTKD 1AKKA 2OZ1B 1J3SA 3HQ6A 3PHLA 2BH5X 2QJKB 1I5TA 2O3JA 1CSXA 2JTIB 1KB9D 1CO6A 4A7PA 3RN0A 2CA4B 1H1OA 3WU2V 5C0ZA 3RMZA 1CXAA 1W5CT 1EZVD 3RLMA 4AX3A 5C9MA 3A0BV 2D0WA 1AOFA 1NTZD 2KS1A 1KX2A 2K9JB 4H0KA 2QJYB 3PH2B 1FJ0A 1DIIC 3TF5A 1CTZA 1EB7A 1K3HA 4N0KA 4WQCA 1L9BC 1CHJA 2JQRA 1U74B 2FWLA 1LC2A 5B5EV 2LIRA 4FA5A 1I6EA 1SQVD 1HROA 1HJ4A 451CA 2OZ1A 1C2NA 1M6ZA 3CWBD 1DW0A 5KAIV 5DJQC 3HQ8A 4KMGA 2CA3B 1BL9A 4Q5PA 3H1KD 2Q3EA 1IZL0 3ITKA 2BH4X 3PXSA 2RMZA 1M70A 1GU2A 1CTJA 1FI7A 3L4MA 3PTZA 1I6DA 1OAEA 1HCMA 1QL4A 4UB8V 3ZOYA 3FWLA 3WFBC 1DVVA 2Y0DA 4AAMA 1DW1A 1DVHA 2C9XB 1M60A 1CRYA 1CRIA 1CSUA 3WFDC 1H32B 3O5CA 4Y5RA 2FRCA 3L70D 1H9YA 1CIHA 3SVWA 4QAOA 3O0RC 1IO3A 3H1JD 1B7VA 3L73D 2CE1A 1LC1A 3BCCD 1YEAA 4D6TD 3CU4A 1HZVA 1FI9A 4LJIA 2D0SA 1CRCA 1CEDA 4PW9B 1YNRA 2N18C 1PPJD 2C1DB 155CA 3DR0A 1CCRA 4FAVA 3ORVA 1HJ3A 5EXQA 1AOQA 2Y0EA 2V08A 1IRVA 1QKSA 3TYIA 2N9YB 1KX7A 1NMIA 1CIEA 5DJQB 3SXTA 1SQXD 1ETPA 5E79V 1YIQA 1MG2D 3WUIA 3H1LD 5KAFV 2A06D 1NU1D 2N3BA 4YE1A 1L9JC 1CRJA 1RZ6A 4WQBA 1ZRTD 3L75D 2QG4A 4NFGB 4DY9A 1CYJA 3C2CA 1HZUA 3OA8B 2B12B 5GTHV 1I8PA 4RSZA 1CRHA 2N9JA 3PLNA 1NIRA 2FYUD 2C1DA 2ZXYA 2MHMA 5CIHB 5CYTR 2L4DA 1RZ5A 5DF5A 1C52A 3ZCFA 5CIFB 2FYNB 5H2FV 2LITA 4J20A 1YCCA 3TDKA 4L3HA 1U75B 3ZBMA 1NNOA 2V07A 4PD4D 4RJTA 3L72D 3ZOWA 2AIUA 3GW6A 3RN1A 3L4OA 2N18B 1IRWA 1P84D 2PCBB 2BLFB 2PCCB 1SQPD 1H31B 3NBTA 1KYOD 1SQQD 4AAOA 4AALA 3VRDA 4FA1A 1H9XA 4XYDB 2YCCA 3KHUA 4PJ0V 2BPBB 3MK7C 3GG2A 2IBZD 4O1WA 3X39A 3NWVA 1C6RA 3H1ID 3OCDB 3L74D 1KYOW 1CTYA 1KIBA 4EICA 3CXHD 1C6SA 4EIEA 3ZOOA 1CSVA 2GC7D 1FOCA 1S5LV 4WQ8A 1GDVA 1YTCA 3VYMA 1BCCD 5CIDB 1LMSA 2ZBOA 5KLIB 1W2LA 2AI5A 3SLEA 1NMLA 3A0HV 3PXWA 1H31A 2HV4A 3CXHW 1H33B 1WEJF 3PXTA 4EDFA 4IL6V 4P4QB 2ZZS1 3WFCC 1CYCA 2C1UA 4FB1A 2I8FA 3SWSA 3DMIA 3JBTB 3TGUD 1YFCA 3SJLA 1FHBA 1DIQC 1COTA 1L0LD 1AYGA 2VHDA 1YICA 5CIEB 5CIGB 2Y0CA 1I8OA 3CX5D 1GIWA 3WC8A 1VYDA 1H32A 1BGYD 1C6OA 1YEBA 4WQDA 1HH7A 1MG3D 1S6VB 3L71D 2BCNB 1E8EA 1C75A 3MK7B 3VNWA 4L1QA 4GYDA 3ZOXA 2B4ZA 3CX5W 5KKZB 1IQCA 1CCHA 4WQEA 1N90A 4V2KA 5B6QA 1A56A 2BGVX 2EXVA 1H33A 2B10B 1CSWA 1KV9A 3DP5A 2C1VA 1K3GA 4O1QA 5DFSA 5KLVD 1WVEC 3ZIYA 4AANA 5B66V 3O20A 1ZZHA 1R0QA 5CIBB 1DT1A 5TJHA 1A8CA 3KZIV 1RAQA 1I55A 1L0ND 5IY51 2C2CA 5AURA 2QJPB 1SQBD 3NBSA 2ZOOA 1HRCA 1QN2A 3CP5A 1C7MA 2L91A 1JDLA 1CIGA 2YQBA 3O1YA 1CHHA 1KB0A 2N3YA 2YK3A 3OA8A 2JWAA 1E29A 1F1FA 2KNCB 1CNOA 3WFEC 4EIDA 4FA9A 2GB8B 4WQAA 3PRJA 3A9FA 4PWAA 2AXTV 3CYTI 4H0JA 2DVHA 2ORLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQ9 A;  4U3F D;  3HQ7 A;  1CIF A;  1DW2 A;  1NTM D;  2XTS B;  1CRG A;  1CXC A;  1GJQ A;  1QYZ A;  2GC4 D;  2GIW A;  1BE3 D;  2B11 B;  3M97 X;  4EIF A;  1A2S A;  2ZON G;  2PAC A;  1GKS A;  1FCD C;  4WQ9 A;  1E2R A;  1RAP A;  2RN0 A;  2DGE A;  1LS9 A;  1CC5 A;  4L3G A;  4XXL A;  1LFM A;  2C8S A;  2CE0 A;  1GQ1 A;  4MU8 A;  4UB6 V;  5TIS V;  1N9C A;  2BCC D;  1MZ4 A;  1COR A;  3OCD A;  4WQ7 A;  3H1H D;  1C2R A;  1CHI A;  5CIC B;  1PP9 D;  1QL3 A;  1OCD A;  1HJ5 A;  4FAN A;  2N9I A;  2B0Z B;  1F1C A;  1N50 A;  1DW3 A;  5GTI V;  4GED B;  1I54 A;  4FA4 A;  2MTA C;  4K3I A;  1N15 A;  351C A;  2YIU B;  3VMA A;  2CXB A;  4JCG A;  1CYI A;  1FI3 A;  1NTK D;  1AKK A;  2OZ1 B;  1J3S A;  3HQ6 A;  3PHL A;  2BH5 X;  2QJK B;  1I5T A;  2O3J A;  1CSX A;  2JTI B;  1KB9 D;  1CO6 A;  4A7P A;  3RN0 A;  2CA4 B;  1H1O A;  3WU2 V;  5C0Z A;  3RMZ A;  1CXA A;  1W5C T;  1EZV D;  3RLM A;  4AX3 A;  5C9M A;  3A0B V;  2D0W A;  1AOF A;  1NTZ D;  2KS1 A;  1KX2 A;  2K9J B;  4H0K A;  2QJY B;  3PH2 B;  1FJ0 A;  1DII C;  3TF5 A;  1CTZ A;  1EB7 A;  1K3H A;  4N0K A;  4WQC A;  1L9B C;  1CHJ A;  2JQR A;  1U74 B;  2FWL A;  1LC2 A;  5B5E V;  2LIR A;  4FA5 A;  1I6E A;  1SQV D;  1HRO A;  1HJ4 A;  451C A;  2OZ1 A;  1C2N A;  1M6Z A;  3CWB D;  1DW0 A;  5KAI V;  5DJQ C;  3HQ8 A;  4KMG A;  2CA3 B;  1BL9 A;  4Q5P A;  3H1K D;  2Q3E A;  1IZL 0;  3ITK A;  2BH4 X;  3PXS A;  2RMZ A;  1M70 A;  1GU2 A;  1CTJ A;  1FI7 A;  3L4M A;  3PTZ A;  1I6D A;  1OAE A;  1HCM A;  1QL4 A;  4UB8 V;  3ZOY A;  3FWL A;  3WFB C;  1DVV A;  2Y0D A;  4AAM A;  1DW1 A;  1DVH A;  2C9X B;  1M60 A;  1CRY A;  1CRI A;  1CSU A;  3WFD C;  1H32 B;  3O5C A;  4Y5R A;  2FRC A;  3L70 D;  1H9Y A;  1CIH A;  3SVW A;  4QAO A;  3O0R C;  1IO3 A;  3H1J D;  1B7V A;  3L73 D;  2CE1 A;  1LC1 A;  3BCC D;  1YEA A;  4D6T D;  3CU4 A;  1HZV A;  1FI9 A;  4LJI A;  2D0S A;  1CRC A;  1CED A;  4PW9 B;  1YNR A;  2N18 C;  1PPJ D;  2C1D B;  155C A;  3DR0 A;  1CCR A;  4FAV A;  3ORV A;  1HJ3 A;  5EXQ A;  1AOQ A;  2Y0E A;  2V08 A;  1IRV A;  1QKS A;  3TYI A;  2N9Y B;  1KX7 A;  1NMI A;  1CIE A;  5DJQ B;  3SXT A;  1SQX D;  1ETP A;  5E79 V;  1YIQ A;  1MG2 D;  3WUI A;  3H1L D;  5KAF V;  2A06 D;  1NU1 D;  2N3B A;  4YE1 A;  1L9J C;  1CRJ A;  1RZ6 A;  4WQB A;  1ZRT D;  3L75 D;  2QG4 A;  4NFG B;  4DY9 A;  1CYJ A;  3C2C A;  1HZU A;  3OA8 B;  2B12 B;  5GTH V;  1I8P A;  4RSZ A;  1CRH A;  2N9J A;  3PLN A;  1NIR A;  2FYU D;  2C1D A;  2ZXY A;  2MHM A;  5CIH B;  5CYT R;  2L4D A;  1RZ5 A;  5DF5 A;  1C52 A;  3ZCF A;  5CIF B;  2FYN B;  5H2F V;  2LIT A;  4J20 A;  1YCC A;  3TDK A;  4L3H A;  1U75 B;  3ZBM A;  1NNO A;  2V07 A;  4PD4 D;  4RJT A;  3L72 D;  3ZOW A;  2AIU A;  3GW6 A;  3RN1 A;  3L4O A;  2N18 B;  1IRW A;  1P84 D;  2PCB B;  2BLF B;  2PCC B;  1SQP D;  1H31 B;  3NBT A;  1KYO D;  1SQQ D;  4AAO A;  4AAL A;  3VRD A;  4FA1 A;  1H9X A;  4XYD B;  2YCC A;  3KHU A;  4PJ0 V;  2BPB B;  3MK7 C;  3GG2 A;  2IBZ D;  4O1W A;  3X39 A;  3NWV A;  1C6R A;  3H1I D;  3OCD B;  3L74 D;  1KYO W;  1CTY A;  1KIB A;  4EIC A;  3CXH D;  1C6S A;  4EIE A;  3ZOO A;  1CSV A;  2GC7 D;  1FOC A;  1S5L V;  4WQ8 A;  1GDV A;  1YTC A;  3VYM A;  1BCC D;  5CID B;  1LMS A;  2ZBO A;  5KLI B;  1W2L A;  2AI5 A;  3SLE A;  1NML A;  3A0H V;  3PXW A;  1H31 A;  2HV4 A;  3CXH W;  1H33 B;  1WEJ F;  3PXT A;  4EDF A;  4IL6 V;  4P4Q B;  2ZZS 1;  3WFC C;  1CYC A;  2C1U A;  4FB1 A;  2I8F A;  3SWS A;  3DMI A;  3JBT B;  3TGU D;  1YFC A;  3SJL A;  1FHB A;  1DIQ C;  1COT A;  1L0L D;  1AYG A;  2VHD A;  1YIC A;  5CIE B;  5CIG B;  2Y0C A;  1I8O A;  3CX5 D;  1GIW A;  3WC8 A;  1VYD A;  1H32 A;  1BGY D;  1C6O A;  1YEB A;  4WQD A;  1HH7 A;  1MG3 D;  1S6V B;  3L71 D;  2BCN B;  1E8E A;  1C75 A;  3MK7 B;  3VNW A;  4L1Q A;  4GYD A;  3ZOX A;  2B4Z A;  3CX5 W;  5KKZ B;  1IQC A;  1CCH A;  4WQE A;  1N90 A;  4V2K A;  5B6Q A;  1A56 A;  2BGV X;  2EXV A;  1H33 A;  2B10 B;  1CSW A;  1KV9 A;  3DP5 A;  2C1V A;  1K3G A;  4O1Q A;  5DFS A;  5KLV D;  1WVE C;  3ZIY A;  4AAN A;  5B66 V;  3O20 A;  1ZZH A;  1R0Q A;  5CIB B;  1DT1 A;  5TJH A;  1A8C A;  3KZI V;  1RAQ A;  1I55 A;  1L0N D;  5IY5 1;  2C2C A;  5AUR A;  2QJP B;  1SQB D;  3NBS A;  2ZOO A;  1HRC A;  1QN2 A;  3CP5 A;  1C7M A;  2L91 A;  1JDL A;  1CIG A;  2YQB A;  3O1Y A;  1CHH A;  1KB0 A;  2N3Y A;  2YK3 A;  3OA8 A;  2JWA A;  1E29 A;  1F1F A;  2KNC B;  1CNO A;  3WFE C;  4EID A;  4FA9 A;  2GB8 B;  4WQA A;  3PRJ A;  3A9F A;  4PWA A;  2AXT V;  3CYT I;  4H0J A;  2DVH A;  2ORL A; 
#chains in the Genus database with same CATH topology
 4I2L C;  3L70 E;  3HQ7 A;  3E7K A;  1X79 B;  2M5A B;  2YXR B;  1CXC A;  3V2P A;  3RK3 E;  3M97 X;  2YO2 A;  3Q5P A;  1A2S A;  1PIX A;  3R4Y A;  1PPJ E;  5KJ7 D;  1G2C A;  3H6P A;  3H1H G;  2KUB A;  1RH5 B;  1LT9 C;  1LFM A;  4I1L A;  4H13 D;  3P7K A;  1YQ4 C;  4MU8 A;  1N9C A;  3HUS A;  1COR A;  1YHQ P;  2D2C B;  4ZKP A;  3L35 A;  1KN7 A;  1URQ B;  1HJ5 A;  2B0Z B;  3L70 J;  3RK3 C;  4DOJ A;  1F1C A;  1N50 A;  2QE7 H;  4KT0 J;  5CCG D;  2AEF A;  3HD7 B;  3L37 A;  1OW7 A;  4BRY B;  4K3I A;  2ZVO B;  2HLO A;  4LLH A;  351C A;  1YJ9 P;  4GOD A;  1HWT C;  3GHG B;  3VMA A;  3A3Y B;  2CXB A;  3OAK A;  4JCG A;  4GKG A;  1CYI A;  2FYU E;  1AKK A;  1J3S A;  3HQ6 A;  3PHL A;  5H2F H;  1M57 D;  4TLF A;  1I5T A;  2ZYG A;  1CSX A;  2KK7 A;  1KB9 D;  2W6B A;  5APQ A;  3CD6 P;  2ZT9 D;  1W5C E;  2CPB A;  1SQB G;  3WU2 V;  1KFM A;  1JEK A;  1CXA A;  5C9M A;  3A0B V;  5AW5 B;  3AE5 C;  4ASV A;  2R3C A;  4K3A A;  1SQV G;  4H0K A;  3CWB G;  1KYO E;  4GT1 A;  1T3U A;  1EB7 A;  2OYI B;  4PJ0 H;  4WQC A;  1KQS O;  1U74 B;  4K35 A;  3B8E B;  2E75 B;  3TK1 A;  3EFF K;  1H0T B;  2FWL A;  2QIW A;  4C46 A;  1I6E A;  3I55 P;  2B87 B;  1HRO A;  1VQL P;  2OZ1 A;  1M6Z A;  1DW0 A;  2FYU J;  1AVO A;  2ZYD A;  4KMG A;  4H0L D;  1BL9 A;  1IK9 A;  1IZL 0;  3T97 A;  1ZR2 A;  1M70 A;  2FYU K;  4PV1 B;  3L4M A;  4M3L A;  2O01 J;  1I6D A;  1KIL A;  2OYH C;  2Q5U A;  1Z56 A;  1DVV A;  3A0H H;  4AAM A;  3VP8 A;  1A02 F;  1DVH A;  4AQR D;  3L73 G;  1NOH A;  4XFJ A;  1CRI A;  1S2E A;  4WY4 A;  1CSU A;  4D6T G;  3O5C A;  2N1T B;  2C9L Y;  2N9B A;  1VQN P;  3V6I A;  2HYN A;  2FYN C;  2YNY A;  2MKV A;  1GW4 A;  2CPS A;  4N78 E;  1IO3 A;  3H1J D;  2E74 C;  3S9O A;  1B7V A;  1FDM A;  2CE1 A;  1HBW A;  1LC1 A;  4JYB A;  1YEA A;  1FI9 A;  4LJI A;  3USS A;  1OXZ A;  1CED A;  4PW9 B;  3S1K A;  2C1D B;  2OGU A;  1T6A A;  1K05 A;  1AVY A;  1Y9B A;  5EXQ A;  3RL0 D;  1AOQ A;  2Y0E A;  1SFC D;  2I1J A;  3WU2 E;  1KX7 A;  3L75 G;  3A0B E;  3SXT A;  3M9Q A;  1SQX D;  5E79 V;  4IFF A;  2IFN A;  4I7Z C;  3CC7 P;  1ZR4 A;  5KAF V;  2A06 D;  1VQ7 P;  1FZB A;  1KYO I;  4OGQ C;  1L9J C;  3AEB C;  3G9R A;  1CRJ A;  2NPS A;  1DIP A;  3O8Z A;  2E5Y A;  1JMM A;  1ZRT D;  1W2E A;  2GM4 A;  1L0L J;  1X22 A;  4DY9 A;  5GTH V;  4RSZ A;  1L0L K;  2O01 H;  1NIR A;  2NRG A;  1FJP A;  2ZXY A;  2MHM A;  1KFN A;  3ZCF A;  1YCC A;  3TDK A;  4L3H A;  3ZBM A;  1NNO A;  2V07 A;  4PD4 D;  1GL2 A;  2AIU A;  3M0A A;  1KYO H;  1T8Z A;  2RKL A;  3KPE A;  3N7N A;  1IRW A;  1E79 H;  1J2J B;  2PCB B;  1GTW A;  2BLF B;  2XNX A;  1N7S D;  1BDD A;  1FZE A;  3IFM A;  3H32 B;  5CCH A;  3NBT A;  3L74 G;  3QWO C;  2Q7C A;  4AAL A;  3FGA D;  1H9X A;  5AVT B;  1LWU B;  1ZOY C;  3MK7 C;  2OTL P;  3M9B A;  2WMM A;  3Q5S A;  1WT6 A;  2IZ0 A;  3CXH H;  1HJB A;  1EDJ A;  4B86 A;  1LTA C;  1HJ0 A;  4N6J A;  3EFG A;  2FXO A;  2OTK E;  3E1I A;  2HPC B;  1N86 A;  3HRN A;  2GC7 D;  1S5L V;  3H1J E;  1JMB A;  3B5N C;  1FZA A;  1FE6 A;  1T2K C;  2BCC E;  1BCC D;  1LMS A;  2ZBO A;  2DW3 A;  1XTC C;  2WSC J;  4GIF A;  2R5B A;  2QJY C;  2NZ2 A;  5KAF E;  3L4F A;  3HE5 B;  1WEJ F;  1S5L X;  1EXJ A;  1FZC A;  2E76 B;  3TGU D;  3Q1M A;  1PV3 A;  2VHD A;  2QM7 A;  5GTH E;  3C1L A;  2A06 E;  1H32 A;  1BGY D;  3CC2 P;  1C6O A;  1RF0 C;  2FYU G;  1LTS C;  1MG3 D;  1S6V B;  2BCN B;  3A0B H;  1AQT A;  1CI6 A;  4L1Q A;  5KKZ B;  1NTZ E;  2BCC J;  4YXW H;  5KLV G;  1IQC A;  1CCH A;  2Q6Q A;  3H1H J;  4WQE A;  2H43 A;  3RL0 C;  3RBZ A;  5B6Q A;  1A56 A;  1J1D B;  2UWJ E;  1H33 A;  1IJD B;  3VP9 A;  3N4X A;  1NJI Q;  2C1V A;  4L75 A;  3NTN A;  1FOS F;  5DFS A;  4H44 D;  2ZVN B;  4PD4 E;  1WVE C;  2YKP A;  3KDP B;  2I8D A;  2E74 B;  1SQV E;  1UII A;  2QEX P;  2WIT A;  3CI9 A;  3PP5 A;  1L4A C;  3SWF A;  1RQV A;  2D2C C;  5IY5 1;  5AUR A;  5AVV B;  4JF7 A;  3NBS A;  1X0T A;  1HRC A;  3CP5 A;  1URQ C;  1JDL A;  5AW2 B;  3BAT A;  2YQB A;  3HD7 C;  1L2P A;  1S5L E;  2WSC H;  3OA8 A;  1E29 A;  1NTZ J;  4H13 B;  2KNC B;  3WFE C;  2BEQ D;  2GB8 B;  1NTZ K;  4BWN A;  2YXQ B;  5KTB A;  1FZG A;  3MGN A;  1KIL D;  3HQ9 A;  4U3F D;  1CIF A;  1XTG B;  2VRS A;  1CRG A;  3L73 E;  2B11 B;  1SQV J;  2O01 N;  4EIF A;  3CWB J;  2PAC A;  2GUV A;  4WY4 D;  1GKS A;  5AVQ B;  1SQV K;  4WQ9 A;  4W7Z A;  2RN0 A;  2Q3I A;  2K37 A;  3RGU A;  3AE7 C;  3LID A;  3O6Q B;  1CC5 A;  1VPC A;  1ZLL A;  2OYI C;  1VQ4 P;  1M7L A;  2CE0 A;  1LTT C;  4C7R A;  1GQ1 A;  2KP8 A;  2E75 C;  1HF9 A;  4UB6 V;  5TIS V;  2ZT9 B;  3AE1 C;  5KAF H;  3OCD A;  1OX3 A;  1C2R A;  3MD0 A;  3IR9 A;  1OFC X;  2M5A A;  4FAN A;  1EDI A;  3S4R A;  2PAJ A;  3CCS P;  1SLQ A;  1DW3 A;  1GZL A;  4PV1 C;  5GTH H;  3VMZ A;  1QX8 A;  4PD4 I;  2YIU B;  3L73 J;  2OYO A;  2FY8 A;  1N7L A;  2J58 A;  4D6T J;  2XV5 A;  3SSU A;  3M91 A;  2QJK B;  3V4W A;  1PFI A;  1LNQ A;  4H0L B;  2JTI B;  1CO6 A;  2AEJ A;  3RN0 A;  2KOG A;  1KTM A;  2CA4 B;  1YIJ P;  1NKN A;  1EZV D;  1DD4 A;  3MZW B;  1AOF A;  4BXL A;  1ZP0 C;  1RE3 A;  3BAS A;  2K9J B;  5AW9 B;  2QJY B;  1H8A A;  3TF5 A;  1SQQ E;  2WT7 A;  3B4S A;  1K3H A;  3FXE A;  1CHJ A;  4BRY A;  3L75 J;  3VYI A;  3CMA P;  3GHG A;  2H88 C;  5B5E V;  4YPC A;  2LIR A;  4LC1 A;  4FA5 A;  2ZJS E;  1QL1 A;  3W67 A;  5KAI V;  3CCR P;  1GU5 A;  2QA4 P;  3L74 E;  5CCH D;  3H1K D;  4U3F E;  4YXD C;  3PXS A;  1NAY A;  1GU2 A;  1QLE D;  3PTZ A;  1OAE A;  4NPE A;  1QL4 A;  1JB0 J;  4UB8 V;  2ZXE B;  4YTP C;  2WVR A;  2P1J A;  4UB6 E;  5TIS E;  1KOR A;  5AW8 B;  3RL0 B;  1SFC B;  4L74 A;  1M60 A;  3H1J G;  1OWA A;  4W7Y A;  3CCQ P;  2OYI A;  2BCC G;  1QVG O;  2L5G B;  3WFD C;  2LKM A;  3UIA A;  1SQQ J;  4RO0 A;  4XE5 B;  4C7N B;  1H9Y A;  3Q3D A;  1SQQ K;  1CIH A;  4XA4 A;  2B87 A;  1S4X A;  3WUV A;  1MFT A;  2FFD C;  1X8Y A;  1L4A B;  3BCC D;  3L74 J;  2WPV B;  3TNU B;  1YNR A;  2FXM A;  1E5W A;  4FAV A;  3GF3 A;  3L71 E;  1VDF A;  2SPZ A;  2A06 G;  1PL5 A;  3FXD A;  1ZN5 A;  1ZXG A;  1N73 A;  2N9Y B;  1HGV A;  1LWU C;  3CLQ A;  2IX7 C;  1KD1 Q;  2IDB A;  1CIE A;  2C0X A;  1NVO A;  3AE9 C;  1RE4 A;  2V7Q J;  3H1L D;  2N1T A;  3P32 A;  1NTZ G;  2MJZ A;  2N3B A;  1RY3 A;  1GMJ A;  3P8C D;  3VOP A;  3HE4 B;  5KLV E;  1RZ6 A;  1EZV E;  4WQB A;  3C2C A;  1HZU A;  5B5E E;  3ABV C;  1I8P A;  5KAI E;  2C1D A;  1DD3 A;  4GOF A;  5CYT R;  1RZ5 A;  1M1J B;  3K5B A;  1C52 A;  1PGO A;  3L71 J;  3KYQ A;  1U75 B;  4UB8 E;  2K1A A;  1JY3 O;  2E76 C;  3L72 D;  1MKM A;  1UIX A;  1RF1 A;  1VQ9 P;  3II6 A;  2N18 B;  4JBZ A;  1P84 D;  1G2C B;  2PCC B;  2KSJ A;  1SQP D;  1H31 B;  3HTK A;  2JDI H;  2YMK A;  4L73 A;  3VRD A;  5KLV J;  1U57 A;  1HH0 A;  3GG2 A;  3SWY A;  2IBZ D;  4O1W A;  5KLV K;  1KZU B;  1C6R A;  1JY3 N;  4OH8 B;  5KKZ C;  3HUS B;  1BCC G;  1MFZ A;  1CTY A;  1KIB A;  3AE2 C;  1LT9 A;  4EIC A;  1J1D C;  4EIE A;  1GDT A;  1CSV A;  1J1E C;  3MUD C;  1QVF O;  1GDV A;  5CJ0 A;  2V7Q H;  5L8R J;  2W83 C;  4AUW A;  3BCC E;  3B71 A;  1IZN B;  2ZYA A;  3D70 A;  3TGU G;  3WUU A;  5KLI B;  4IOI H;  3I5C A;  2Z5H A;  1W2L A;  2AI5 A;  1ZV8 A;  1QEX A;  1NML A;  2K88 A;  1D7M A;  2HG5 D;  4IL6 V;  1LWU A;  2K3R A;  5KJ7 C;  2I8F A;  3SWS A;  3DMI A;  3JBT B;  5AW1 B;  1YI2 P;  1GK6 A;  1YFC A;  1EZV I;  2AEM A;  4L76 A;  1YTZ T;  1YIC A;  5CIE B;  2K9Y A;  2Y0C A;  3AE8 C;  2O1J A;  1I8O A;  4H44 B;  3CX5 D;  3H1L E;  4H13 C;  3CCL P;  2HPC A;  4IL6 X;  4R4M A;  1IFJ A;  2P2U A;  1KB9 E;  2XU6 A;  2E43 A;  1OVR A;  2WQY C;  4WQD A;  2AXC A;  1CW5 A;  1C75 A;  3ZOX A;  3LW5 J;  3CX5 W;  5CCG C;  2PGD A;  1N90 A;  1Q82 Q;  1JY3 P;  2KIK A;  3RK2 D;  2BGV X;  1HUC A;  3T97 B;  1OW6 A;  1CSB A;  3SFE C;  3DP5 A;  4O1Q A;  1H89 A;  1LTG C;  1KIL B;  3ZIY A;  4AAN A;  5B66 V;  3O20 A;  1SQQ G;  5KAI H;  1R0Q A;  2FFD B;  5CIB B;  1MV8 A;  2P7J A;  1P84 E;  2ZT9 C;  1S72 P;  1R8E A;  3KZI V;  1SQP E;  4HKZ H;  1I55 A;  1L0N D;  2OYH A;  1SQB D;  4UB8 H;  4WY4 B;  1C7M A;  2A45 I;  3RBX A;  2KSE A;  4NPF X;  3RL0 g;  2CK3 H;  4U3F G;  4MN4 C;  1NH4 A;  2GUS A;  3CCU P;  1F1F A;  2YIU C;  1CNO A;  3JCU E;  3R2P A;  5AW7 B;  4WQA A;  4PWA A;  2AXT V;  1VQ8 P;  2DVH A;  2QJK C;  3M9H A;  2C9N Y;  3CPW O;  4H0L C;  3OJA B;  1DW2 A;  1NTM D;  3A2A A;  2YKO A;  1QYZ A;  1GU4 A;  1PGP A;  1LTJ C;  1BE3 D;  2ZON G;  1BSH A;  5E79 E;  1E2R A;  2JJL A;  1RAP A;  1LP1 A;  1NHL A;  5AVS B;  2H89 C;  3C8V A;  5KJ7 A;  3LW5 H;  1OVV A;  1K73 Q;  1K9M Q;  1KB9 I;  1SQP K;  3Q2Y A;  4XXL A;  1PGJ A;  2W8Z A;  2Z4E A;  2Q1K A;  3L71 G;  1SQX E;  3MP7 B;  1MZ4 A;  4WQ7 A;  1CHI A;  1T3J A;  1PP9 D;  1OCD A;  2N9I A;  3WU2 H;  5GTI V;  3CC4 P;  1ZRT E;  4GED B;  3AEE C;  5B66 E;  3H1J J;  1N15 A;  2IFM A;  3CME P;  2HOD A;  1KB9 H;  2KZI A;  1YQ3 C;  1NTK D;  1EZV G;  1P84 I;  3MHV A;  3KZI E;  1SFC C;  3D6Z A;  3U1A A;  2BH5 X;  1R5L A;  1LGH B;  3O6Q A;  2PRR A;  4LGD E;  4QMA A;  1J1E B;  4TT3 H;  1EDK A;  3L36 A;  3GF7 A;  1H1O A;  2P58 A;  3VTP C;  5C0Z A;  1VQ5 P;  1SQX J;  3EWK A;  2D0W A;  2KS1 A;  1SQX K;  1N2D C;  2V4H A;  3PH2 B;  1FJ0 A;  1H88 A;  2AXT E;  1YJW P;  3A7O A;  3H1K G;  1L9B C;  1IK7 A;  1HJ4 A;  5APX A;  5C39 A;  1JCC A;  2FBW C;  2CA3 B;  3ITK A;  2BH4 X;  1DEE G;  4IFM A;  3CCM P;  2RMZ A;  1CTJ A;  1FI7 A;  1IFP A;  3B5N A;  3NXS A;  1NTM E;  1HCM A;  1SVF A;  2FXP A;  1BE3 E;  1FZC B;  1U7M A;  3OA7 A;  3M0D C;  3JCU H;  1BCC E;  3KXD A;  1N7S C;  3VN0 A;  1JY2 N;  3FWL A;  3WFB C;  2A45 G;  4ZMD A;  5BU8 B;  1KMI Z;  1RHZ B;  1DW1 A;  2C9X B;  1IFD A;  1SP4 A;  1LTI C;  1BDC A;  1WMK A;  3C9I A;  3BCC G;  2FKW B;  1H32 B;  1RQU A;  2FRC A;  1M1J C;  3L70 D;  1ZME C;  3TGU E;  5GTI E;  3WUT A;  1JNM A;  1FU1 A;  4HYT B;  1CI6 B;  1NYH A;  5E79 H;  2QM8 A;  3GLM A;  2W6J H;  3RK3 D;  1PP9 E;  3V5B A;  1BGY E;  1RF0 A;  1M90 Q;  1JOC A;  2N18 C;  1PPJ D;  4EI2 A;  155C A;  3DR0 A;  5AVW B;  1CCR A;  3H1L G;  1HJ3 A;  2HR3 A;  1IRV A;  1BCC J;  1NTK E;  1FAV A;  1NTM K;  1NMI A;  4N3Y B;  5DJQ B;  3NFQ A;  1ETP A;  2LXC B;  1YIQ A;  1OMI A;  3AE3 C;  5AW4 B;  3HUS C;  3G71 P;  1NU1 D;  2NPS D;  1JO5 A;  4C7N A;  1W2B O;  3OW2 O;  2XND H;  1KC8 Q;  3TGU J;  1VF5 D;  2QG4 A;  1LTJ B;  3CCE P;  3U59 A;  4NFG B;  2G8Y A;  1CYJ A;  3OA8 B;  1L4A A;  2B12 B;  2JR8 A;  1CRH A;  2FYZ A;  2N9J A;  3L72 G;  5BU5 A;  2LXB A;  5KLI C;  3TNU A;  1YIT P;  2FYU D;  5CIH B;  1BGY J;  2L4D A;  1URQ A;  5AW6 B;  2HFE D;  4PD4 H;  2IYP A;  2KYV A;  3AE4 C;  2W90 A;  1R5S A;  3HD7 A;  4J20 A;  1SQP G;  3NMD A;  1JCD A;  1GL2 D;  1WRG A;  5AW3 B;  4EYY Q;  2AXT H;  3RN1 A;  1FDI A;  4H44 C;  2YMY A;  2PP6 A;  1NTK K;  1KIL E;  5CBO A;  2J5U A;  1Q86 Q;  1KYO D;  1S5L H;  3G4S P;  4AAO A;  4NPD A;  4OWF A;  4FA1 A;  2YCC A;  1IFM A;  1AV1 A;  1KQG B;  3NWV A;  1FS0 E;  3H1I D;  3OCD B;  1QGK B;  1OW8 A;  1KYO W;  3CXH D;  1C6S A;  2E74 D;  2WPS A;  4Y28 J;  1PZQ A;  2P10 A;  1H0T A;  1FOC A;  4WQ8 A;  1NO4 A;  1KIL C;  4EOT A;  3VYM A;  1U7J A;  4I6M C;  2IYO A;  4DT0 A;  1KQL A;  3IN6 A;  2M0B A;  3SLE A;  1KQF B;  1YBK A;  5CHX A;  5GTI H;  1H31 A;  1IFI A;  3CXH W;  1SQX G;  4U3F J;  2ZXX A;  2E5T A;  3RK2 B;  3CL3 D;  4HH2 A;  3IAO A;  3WFC C;  4WY4 C;  4FB1 A;  3SJL A;  1AA0 A;  1COT A;  1L0L D;  1AYG A;  2QRX A;  1EDL A;  5CIG B;  4N78 D;  1USE A;  4OGQ D;  1GIW A;  1NU1 E;  2J59 M;  3P8M C;  1VYD A;  5EFW B;  1QL2 A;  3A5T A;  3F5H A;  1YEB A;  2WT7 B;  1HH7 A;  3V2N A;  1EC5 A;  1N7S B;  3FWN A;  4GYD A;  1JTH B;  4DJG A;  2Q9I A;  3CCV P;  2WSF J;  3V2Q A;  2KB7 P;  1PGQ A;  2EXV A;  4ZKU A;  4JQ0 D;  2M3B A;  1L0N G;  2PFX A;  2JO1 A;  5AVX B;  2M8R A;  2NPS C;  4EIJ A;  1ZZH A;  1FC2 C;  5TJH A;  3U1C A;  3H1K E;  1VF5 C;  2I1K A;  1VL2 A;  1M1K Q;  1NU1 J;  2QJP B;  2RH0 A;  2ZOO A;  2P67 A;  1IC2 A;  1NU1 K;  2L91 A;  3BRV B;  5CMZ A;  4Y99 C;  1KB0 A;  1DH3 A;  2YK3 A;  2E42 A;  2JWA A;  3H1I E;  1NTM G;  1FZF A;  2R32 A;  4ASW A;  1BE3 G;  4JYC A;  1GL2 C;  3WMM 0;  2KLU A;  1FOS E;  4EID A;  1NGM B;  3A9F A;  3CXH E;  3QH9 A;  3B5N D;  2YKQ A;  4DZO A;  4ZNC A;  1T2K D;  2JP3 A;  1FBM A;  1K8A Q;  2KXP B;  5CCH C;  4UB6 H;  5TIS H;  1Q7Y Q;  2OAR A;  2XTS B;  1YTZ I;  1GJQ A;  2GC4 D;  1N73 B;  2FFD A;  2GIW A;  1M8O B;  2KI7 B;  1JM0 A;  3H1K J;  1HVV A;  1FCD C;  2C0W A;  2DGE A;  3H32 A;  2WPQ A;  2XZR A;  1MUU A;  1LS9 A;  4RES B;  1PP9 G;  2WSF H;  4L3G A;  1BGY G;  2C8S A;  1VQO P;  1L0L E;  1N8R Q;  4JPZ B;  3H1I J;  3LIE A;  2BCC D;  2R3S A;  4WB4 A;  3H1H D;  2ZAE B;  5CIC B;  1NTK G;  1EXI A;  1QL3 A;  3P8C E;  5APU A;  1Y47 A;  4FA4 A;  1I54 A;  2MTA C;  3MTU E;  2BEZ F;  1FZC C;  3AEG C;  1LT1 A;  3BCC J;  1FI3 A;  2OZ1 B;  1RF1 B;  2WWW A;  3HE5 A;  2O3J A;  3F89 A;  3HTK B;  1EQ7 A;  4A7P A;  5B5E H;  1VQ6 P;  1L4A D;  3L72 E;  1S9K D;  2D2C D;  3RMZ A;  5AVY B;  1W5C T;  3RLM A;  4AX3 A;  2ZFC A;  1DX7 A;  1NTZ D;  1URQ D;  3PJS K;  3H1L J;  1KX2 A;  2QVA A;  2WSE J;  1ZW0 A;  1VQK P;  3HD7 D;  1DII C;  1CTZ A;  3CXH I;  1LT9 B;  4N0K A;  3TYY A;  2JQR A;  2IBZ E;  5APT A;  3FX0 A;  1LC2 A;  1SQV D;  451C A;  1GK4 A;  1C2N A;  3CWB D;  1M56 D;  5DJQ C;  3HQ8 A;  4Q5P A;  2Q3E A;  2YO3 A;  3RK3 B;  3MUD A;  1OZH A;  1Q81 Q;  4Z1M H;  4IL6 E;  4R4L A;  1NAF A;  2Z5I A;  3ZOY A;  3L70 G;  3L72 J;  2B88 A;  5AVZ B;  2Y0D A;  5APS A;  2A45 H;  3JC2 2;  1CRY A;  3JSV C;  4OVN F;  1SQP J;  2JEE A;  2E75 D;  4Y5R A;  3V2R A;  1IFN A;  2IZ1 A;  1PPJ G;  3IF4 A;  2NPS B;  4W80 A;  3SVW A;  5M1B A;  4QAO A;  3O0R C;  1HTL C;  3CX5 E;  5APY A;  5CJ4 A;  3H1H E;  4KJM A;  3L73 D;  4U7J A;  2KNC A;  1VF5 B;  2O1K A;  2XDJ A;  4D6T D;  3CU4 A;  4PV1 D;  2H7H A;  1HZV A;  2OTJ P;  2D0S A;  1CRC A;  3AED C;  1VQM P;  1LTB C;  3AEA C;  3ORV A;  4Y99 B;  1NU1 G;  5CCG A;  2V08 A;  1FJK A;  1QKS A;  3TYI A;  3KQG A;  2WSE H;  1GL2 B;  3G6E P;  1MG2 D;  2N1T D;  3WUI A;  3ZDM A;  1DEB A;  1YYC A;  2QSI A;  1X9V A;  2R44 A;  2OYH B;  4YE1 A;  2IPP A;  4AYC A;  3CCJ P;  3E1R A;  1S9K E;  3GMA A;  3L75 D;  5DJU B;  2IBZ I;  1GW3 A;  1NWQ A;  2Y9Y A;  3PLN A;  1VQP P;  1L0N E;  2OQQ A;  3AEF C;  1AQ5 A;  1SQB E;  4WBA A;  5AW0 B;  4HJG H;  4RKU J;  5CBN A;  5DF5 A;  2Y9Z A;  1FDO A;  5CIF B;  2FYN B;  5H2F V;  2LIT A;  3RK2 C;  1JY2 O;  3MIW A;  1P84 H;  3CWB E;  2R5D A;  5APW A;  4RJT A;  3ZOW A;  3GW6 A;  3L4O A;  2H8P D;  1LP1 B;  3H1I G;  3D6Y A;  1RE3 C;  3PH0 A;  1SQQ D;  1AFO A;  1Q2N A;  1MZ9 A;  1LTJ A;  1IO4 A;  4XYD B;  3KHU A;  1G1J A;  4PJ0 V;  1S1C X;  2JKV A;  2BPB B;  2WZ7 A;  2JWD A;  3BRT B;  3X39 A;  3AE6 C;  3GHG C;  1AJY A;  3CX5 I;  4I7Z B;  2BAS A;  3EQ2 A;  1USD A;  2K9J A;  4GDO A;  2ITA A;  1L0N J;  2GA1 A;  5AVR B;  3L74 D;  3G3Z A;  4IL6 H;  4OGQ B;  1SQB J;  4CPG A;  1L0N K;  3ZOO A;  1SQB K;  3M06 A;  1YTC A;  1NKZ B;  5CID B;  3SFD C;  1KV4 A;  1SS1 A;  4D6T E;  3D0W A;  2HOD B;  1L0L G;  1YJN P;  3A0H V;  5APV A;  3PXW A;  1LJ2 A;  2POH A;  2HV4 A;  1H33 B;  3PXT A;  4EDF A;  3D71 A;  2QJP C;  4P4Q B;  2ZZS 1;  1CYC A;  3CX5 H;  2C1U A;  2B89 A;  2WPR A;  4GOE A;  1NTM J;  1BE3 J;  1FHB A;  3VMX A;  1DIQ C;  1CZQ A;  1SFC A;  1K04 A;  3I56 P;  2KS1 B;  1HGZ A;  3WC8 A;  1BSN A;  2LR2 A;  2W6A A;  3Q5R A;  4WVZ A;  1TU3 F;  4WWI A;  3L75 E;  5B66 H;  3L71 D;  1E8E A;  5H2F E;  3MK7 B;  3VNW A;  1S3J A;  2KZJ A;  3AEC C;  4KHX A;  3W68 A;  2B4Z A;  1GD2 E;  3KZI H;  1N73 C;  1JY2 P;  1G1I A;  2KLV A;  4V2K A;  1PP9 J;  5AVU B;  3VMY A;  3TSI A;  2B10 B;  1RE4 C;  2G3A A;  2E76 D;  2WTY A;  1CSW A;  1KV9 A;  2XKM A;  3BVH A;  2N1T C;  1K3G A;  4IFD K;  1Y8A A;  3B5N B;  1A02 J;  5KLV D;  4PJ0 E;  4O9B A;  4DCK A;  1OIP A;  1NTK J;  1DT1 A;  1A8C A;  2B9B A;  2IBZ G;  1RAQ A;  2C2C A;  2W27 A;  5BVZ A;  3HE4 A;  3M0D A;  1QN2 A;  1N7S A;  1CIG A;  3SWK A;  1JTH A;  3O1Y A;  1CHH A;  2N3Y A;  2WSS H;  2M3E A;  3H25 A;  5K5G B;  1Q90 D;  4HB1 A;  1OVU A;  4FA9 A;  5DJT B;  3A0H E;  3PRJ A;  3V4Q A;  1JUN A;  1RF1 C;  3CYT I;  4H0J A;  1M1J A;  2ORL A; 
#chains in the Genus database with same CATH homology
 3HQ9 A;  4U3F D;  3HQ7 A;  1CIF A;  1DW2 A;  1NTM D;  2XTS B;  1CRG A;  1CXC A;  1GJQ A;  1QYZ A;  2GC4 D;  2GIW A;  1BE3 D;  2B11 B;  3M97 X;  4EIF A;  1A2S A;  2ZON G;  2PAC A;  1GKS A;  1FCD C;  4WQ9 A;  1E2R A;  1RAP A;  2RN0 A;  2DGE A;  1LS9 A;  1CC5 A;  4L3G A;  4XXL A;  1LFM A;  2C8S A;  2CE0 A;  1GQ1 A;  4MU8 A;  4UB6 V;  5TIS V;  1N9C A;  2BCC D;  1MZ4 A;  1COR A;  3OCD A;  4WQ7 A;  3H1H D;  1C2R A;  1CHI A;  5CIC B;  1PP9 D;  1QL3 A;  1OCD A;  1HJ5 A;  4FAN A;  2N9I A;  2B0Z B;  1F1C A;  1N50 A;  1DW3 A;  5GTI V;  4GED B;  1I54 A;  4FA4 A;  2MTA C;  4K3I A;  1N15 A;  351C A;  2YIU B;  3VMA A;  2CXB A;  4JCG A;  1CYI A;  1FI3 A;  1NTK D;  1AKK A;  2OZ1 B;  1J3S A;  3HQ6 A;  3PHL A;  2BH5 X;  2QJK B;  1I5T A;  2O3J A;  1CSX A;  2JTI B;  1KB9 D;  1CO6 A;  4A7P A;  3RN0 A;  2CA4 B;  1H1O A;  3WU2 V;  5C0Z A;  3RMZ A;  1CXA A;  1W5C T;  1EZV D;  3RLM A;  4AX3 A;  5C9M A;  3A0B V;  2D0W A;  1AOF A;  1NTZ D;  2KS1 A;  1KX2 A;  2K9J B;  4H0K A;  2QJY B;  3PH2 B;  1FJ0 A;  1DII C;  3TF5 A;  1CTZ A;  1EB7 A;  1K3H A;  4N0K A;  4WQC A;  1L9B C;  1CHJ A;  2JQR A;  1U74 B;  2FWL A;  1LC2 A;  5B5E V;  2LIR A;  4FA5 A;  1I6E A;  1SQV D;  1HRO A;  1HJ4 A;  451C A;  2OZ1 A;  1C2N A;  1M6Z A;  3CWB D;  1DW0 A;  5KAI V;  5DJQ C;  3HQ8 A;  4KMG A;  2CA3 B;  1BL9 A;  4Q5P A;  3H1K D;  2Q3E A;  1IZL 0;  3ITK A;  2BH4 X;  3PXS A;  2RMZ A;  1M70 A;  1GU2 A;  1CTJ A;  1FI7 A;  3L4M A;  3PTZ A;  1I6D A;  1OAE A;  1HCM A;  1QL4 A;  4UB8 V;  3ZOY A;  3FWL A;  3WFB C;  1DVV A;  2Y0D A;  4AAM A;  1DW1 A;  1DVH A;  2C9X B;  1M60 A;  1CRY A;  1CRI A;  1CSU A;  3WFD C;  1H32 B;  3O5C A;  4Y5R A;  2FRC A;  3L70 D;  1H9Y A;  1CIH A;  3SVW A;  4QAO A;  3O0R C;  1IO3 A;  3H1J D;  1B7V A;  3L73 D;  2CE1 A;  1LC1 A;  3BCC D;  1YEA A;  4D6T D;  3CU4 A;  1HZV A;  1FI9 A;  4LJI A;  2D0S A;  1CRC A;  1CED A;  4PW9 B;  1YNR A;  2N18 C;  1PPJ D;  2C1D B;  155C A;  3DR0 A;  1CCR A;  4FAV A;  3ORV A;  1HJ3 A;  5EXQ A;  1AOQ A;  2Y0E A;  2V08 A;  1IRV A;  1QKS A;  3TYI A;  2N9Y B;  1KX7 A;  1NMI A;  1CIE A;  5DJQ B;  3SXT A;  1SQX D;  1ETP A;  5E79 V;  1YIQ A;  1MG2 D;  3WUI A;  3H1L D;  5KAF V;  2A06 D;  1NU1 D;  2N3B A;  4YE1 A;  1L9J C;  1CRJ A;  1RZ6 A;  4WQB A;  1ZRT D;  3L75 D;  2QG4 A;  4NFG B;  4DY9 A;  1CYJ A;  3C2C A;  1HZU A;  3OA8 B;  2B12 B;  5GTH V;  1I8P A;  4RSZ A;  1CRH A;  2N9J A;  3PLN A;  1NIR A;  2FYU D;  2C1D A;  2ZXY A;  2MHM A;  5CIH B;  5CYT R;  2L4D A;  1RZ5 A;  5DF5 A;  1C52 A;  3ZCF A;  5CIF B;  2FYN B;  5H2F V;  2LIT A;  4J20 A;  1YCC A;  3TDK A;  4L3H A;  1U75 B;  3ZBM A;  1NNO A;  2V07 A;  4PD4 D;  4RJT A;  3L72 D;  3ZOW A;  2AIU A;  3GW6 A;  3RN1 A;  3L4O A;  2N18 B;  1IRW A;  1P84 D;  2PCB B;  2BLF B;  2PCC B;  1SQP D;  1H31 B;  3NBT A;  1KYO D;  1SQQ D;  4AAO A;  4AAL A;  3VRD A;  4FA1 A;  1H9X A;  4XYD B;  2YCC A;  3KHU A;  4PJ0 V;  2BPB B;  3MK7 C;  3GG2 A;  2IBZ D;  4O1W A;  3X39 A;  3NWV A;  1C6R A;  3H1I D;  3OCD B;  3L74 D;  1KYO W;  1CTY A;  1KIB A;  4EIC A;  3CXH D;  1C6S A;  4EIE A;  3ZOO A;  1CSV A;  2GC7 D;  1FOC A;  1S5L V;  4WQ8 A;  1GDV A;  1YTC A;  3VYM A;  1BCC D;  5CID B;  1LMS A;  2ZBO A;  5KLI B;  1W2L A;  2AI5 A;  3SLE A;  1NML A;  3A0H V;  3PXW A;  1H31 A;  2HV4 A;  3CXH W;  1H33 B;  1WEJ F;  3PXT A;  4EDF A;  4IL6 V;  4P4Q B;  2ZZS 1;  3WFC C;  1CYC A;  2C1U A;  4FB1 A;  2I8F A;  3SWS A;  3DMI A;  3JBT B;  3TGU D;  1YFC A;  3SJL A;  1FHB A;  1DIQ C;  1COT A;  1L0L D;  1AYG A;  2VHD A;  1YIC A;  5CIE B;  5CIG B;  2Y0C A;  1I8O A;  3CX5 D;  1GIW A;  3WC8 A;  1VYD A;  1H32 A;  1BGY D;  1C6O A;  1YEB A;  4WQD A;  1HH7 A;  1MG3 D;  1S6V B;  3L71 D;  2BCN B;  1E8E A;  1C75 A;  3MK7 B;  3VNW A;  4L1Q A;  4GYD A;  3ZOX A;  2B4Z A;  3CX5 W;  5KKZ B;  1IQC A;  1CCH A;  4WQE A;  1N90 A;  4V2K A;  5B6Q A;  1A56 A;  2BGV X;  2EXV A;  1H33 A;  2B10 B;  1CSW A;  1KV9 A;  3DP5 A;  2C1V A;  1K3G A;  4O1Q A;  5DFS A;  5KLV D;  1WVE C;  3ZIY A;  4AAN A;  5B66 V;  3O20 A;  1ZZH A;  1R0Q A;  5CIB B;  1DT1 A;  5TJH A;  1A8C A;  3KZI V;  1RAQ A;  1I55 A;  1L0N D;  5IY5 1;  2C2C A;  5AUR A;  2QJP B;  1SQB D;  3NBS A;  2ZOO A;  1HRC A;  1QN2 A;  3CP5 A;  1C7M A;  2L91 A;  1JDL A;  1CIG A;  2YQB A;  3O1Y A;  1CHH A;  1KB0 A;  2N3Y A;  2YK3 A;  3OA8 A;  2JWA A;  1E29 A;  1F1F A;  2KNC B;  1CNO A;  3WFE C;  4EID A;  4FA9 A;  2GB8 B;  4WQA A;  3PRJ A;  3A9F A;  4PWA A;  2AXT V;  3CYT I;  4H0J A;  2DVH A;  2ORL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...