2IBZD

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2ibzD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2ibzD02
1L0ND 2BCCD 2AXTV 1CORA 3CP5A 4N0KA 3O0RC 2QG4A 4O1WA 1L9BC 1CTJA 1A56A 3OCDB 3L4MA 1DW3A 1HROA 2VHDA 2KS1A 4L1QA 4EIDA 3KHUA 1H9XA 3DR0A 1DW2A 3PRJA 1FCDC 1JDLA 5CIGB 3CXHD 3SXTA 1W2LA 4Q5PA 2V07A 1KB9D 2BCNB 4L3GA 2C1UA 5B5EV 1CNOA 155CA 1S5LV 4Y5RA 4WQCA 1E29A 2L91A 4WQBA 2GC4D 3VRDA 5KKZB 3OCDA 1QYZA 4GEDB 3X39A 1N90A 4JCGA 4UB8V 5CIHB 3SWSA 2N9IA 3RN1A 2CA3B 2GIWA 2DGEA 3CU4A 1CSUA 4PD4D 4RSZA 1C52A 1OCDA 5AURA 3RN0A 3SVWA 1EZVD 2JWAA 4K3IA 1U74B 2C1DB 2CE0A 2IBZD 4LJIA 4D6TD 3L4OA 1ZZHA 5KAIV 1NMIA 3DP5A 1RAPA 1GKSA 3HQ6A 4FB1A 4AAOA 1NTMD 2BGVX 3RMZA 1SQPD 1P84D 2Q3EA 1MZ4A 2B12B 1J3SA 1NU1D 1R0QA 1DIIC 1LC2A 3H1KD 1CIEA 2YCCA 2MTAC 4H0KA 1E2RA 2AI5A 2YIUB 2Y0DA 3ITKA 3TF5A 1CC5A 2ZONG 2O3JA 3WUIA 2BLFB 3PXSA 1CIGA 1CRHA 1GU2A 1MG2D 1HCMA 2L4DA 4DY9A 3BCCD 2QJPB 5TISV 1M6ZA 1IRWA 2MHMA 3PH2B 3TYIA 1CHIA 2QJYB 3FWLA 3CX5W 1HH7A 2N18C 5C0ZA 1NIRA 2OZ1A 4WQ9A 5CIFB 1F1CA 4GYDA 1DIQC 5GTHV 4FANA 3WFEC 1I55A 1I6EA 1C7MA 1CXAA 5KAFV 2ZZS1 1H32A 1E8EA 3M97X 2CA4B 1FI9A 1C2RA 2QJKB 2V08A 351CA 1K3GA 1CSVA 1I5TA 1BGYD 2KNCB 1H33A 1YICA 5C9MA 4EDFA 1M60A 2C9XB 1U75B 4IL6V 1LS9A 1AOFA 3WC8A 1HZVA 1FI7A 3A9FA 1LMSA 3VYMA 3RLMA 1NTZD 5CYTR 3MK7C 1CHHA 1GQ1A 3ZOXA 1YIQA 3ORVA 3L72D 1HJ3A 2PCCB 1FHBA 3L71D 2C8SA 2Y0EA 4XYDB 5CIEB 1VYDA 1C6SA 4YE1A 1COTA 1YFCA 1BE3D 3H1ID 2HV4A 1CIHA 2ORLA 3OA8B 1I54A 2DVHA 3WFDC 2N3YA 1NMLA 1IO3A 2GC7D 1W5CT 3TDKA 1M70A 4AAMA 1CXCA 4FAVA 3DMIA 4H0JA 1CTZA 2BPBB 1YTCA 1IZL0 3SJLA 2JQRA 1IQCA 1L0LD 1CYCA 2YQBA 3ZOWA 4U3FD 4EIEA 1CIFA 2D0WA 5KLVD 1KIBA 4EICA 1DVVA 1CYIA 4FA4A 4FA5A 5KLIB 1HJ5A 1YCCA 4WQEA 5DJQC 1FOCA 2B10B 5B66V 1DVHA 3PXTA 2C1DA 3A0BV 2CE1A 3WFBC 3VMAA 1C6OA 3WU2V 4FA1A 4EIFA 1F1FA 1LFMA 2FRCA 2LITA 1K3HA 4PW9B 1NTKD 3HQ9A 1I6DA 4RJTA 2YK3A 3H1JD 1RZ6A 1QL3A 2RN0A 1EB7A 5DFSA 1C2NA 1QL4A 2N9JA 5DJQB 3C2CA 3TGUD 1AOQA 3NBSA 2B0ZB 1H31B 1CSWA 1S6VB 1HZUA 4FA9A 2I8FA 1L9JC 1WVEC 1ETPA 1FJ0A 1CEDA 1IRVA 1CCRA 1H1OA 4PWAA 1SQVD 2D0SA 1AKKA 5CIBB 4WQAA 4AALA 1PPJD 1YNRA 2Y0CA 4AANA 1H9YA 5H2FV 2XTSB 3CWBD 1CYJA 4MU8A 2BH4X 4J20A 3ZOOA 3VNWA 5IY51 3ZIYA 4O1QA 2K9JB 1KYOW 2A06D 5EXQA 3GW6A 3H1LD 3KZIV 1YEAA 2GB8B 2N18B 3L74D 3NWVA 2FYUD 3WFCC 1YEBA 2CXBA 5CICB 1I8OA 1QN2A 1KX2A 3PXWA 4KMGA 3O20A 2PACA 1WEJF 3O5CA 2LIRA 1FI3A 1SQQD 1ZRTD 2FWLA 3L75D 2FYNB 3JBTB 1RAQA 3HQ8A 3SLEA 4QAOA 4XXLA 1CRCA 1CO6A 1CHJA 3MK7B 1NNOA 2C2CA 1N50A 4AX3A 4NFGB 3ZCFA 1HRCA 3OA8A 1RZ5A 1BCCD 3H1HD 1AYGA 1HJ4A 4WQ7A 2ZXYA 1SQXD 1CTYA 3CXHW 3CX5D 1CRGA 3L73D 2BH5X 1C75A 1N9CA 3O1YA 1CCHA 1MG3D 5E79V 1CRYA 4V2KA 4A7PA 4P4QB 5TJHA 1LC1A 4WQDA 1DT1A 3L70D 4L3HA 4PJ0V 2AIUA 3NBTA 3HQ7A 2JTIB 1C6RA 1CRJA 3GG2A 1CRIA 1B7VA 3ZBMA 2RMZA 2EXVA 2N3BA 1CSXA 1OAEA 1KYOD 4UB6V 1DW0A 1GJQA 5CIDB 2B11B 2ZBOA 2ZOOA 3ZOYA 2OZ1B 1GIWA 2B4ZA 2N9YB 1DW1A 1BL9A 1KB0A 3PHLA 2C1VA 5DF5A 1H32B 1SQBD 1PP9D 1QKSA 4WQ8A 2PCBB 1A8CA 3PLNA 1GDVA 3CYTI 1I8PA 1N15A 5B6QA 1KV9A 1KX7A 5GTIV 3A0HV 3PTZA 1H33B 451CA 1H31A 1A2SA
chains in the Genus database with same CATH superfamily
1ZV8A 1OMIA 3H32B 1QX8A 3Q5PA 3H1LJ 2E75D 2QSIA 3OCDB 3L4MA 2HR3A 2W6JH 3HUSC 2ZYGA 3MUDA 1HROA 2KS1A 2YXQB 3CCLP 4HJGH 1LT9B 3L72J 3PRJA 5AVWB 1NTME 2OGUA 3R2PA 1SQPE 3NTNA 4PJ0H 3C9IA 2RH0A 4IL6X 1YQ4C 2XDJA 1GK6A 1CNOA 4EI2A 3RBZA 4Y5RA 1E29A 2L91A 3SSUA 3T97B 1KYOE 1QYZA 2IBZI 3X39A 2KYVA 1LWUB 3HRNA 1W2EA 3RN1A 1AA0A 4LC1A 3CU4A 4BRYB 1CSUA 2YXRB 4PD4D 4RSZA 1JB0J 3SVWA 3TK1A 1FDOA 4W7ZA 2PAJA 3USSA 1BCCJ 5TISH 3VN0A 2C1DB 2P7JA 4M3LA 2CE0A 2V7QH 4LJIA 3L4OA 2KZJA 1ZZHA 3DP5A 1RAPA 1GKSA 4FB1A 1AQ5A 2BCCE 1NTMD 3RMZA 1SQPD 3H1IG 1ZR4A 1MZ4A 2B12B 1QGKB 1VL2A 1N7SB 1X0TA 2KLUA 3L75G 1CIEA 5APQA 2QJYC 1HTLC 1LTJC 3BATA 2WPVB 1E2RA 2AI5A 1RF1B 1N73B 1N7LA 1A02J 1SVFA 2YKPA 3WUIA 1JMBA 3G4SP 5DJTB 2HYNA 3PXSA 1CIGA 4JQ0D 3RL0g 3FXEA 1MG2D 3BCCD 2YMKA 4WBAA 2P58A 3LIDA 2QJPB 5TISV 2HPCA 1NWQA 1IRWA 2WSEH 3HE5A 3AE6C 4C7RA 1CHIA 1AQTA 2M5AA 1Z56A 1HH7A 5BVZA 1M1JA 1R5LA 3I56P 1DIQC 5GTHV 1S2EA 1I6EA 2QM7A 3C1LA 2Z5HA 3GLMA 3M97X 5KJ7C 5CCGC 1C2RA 2XU6A 2E76B 3GHGC 1X22A 3HE4B 1K3GA 1BGYD 1RF0C 2GUSA 1VQLP 2R3SA 2G3AA 1YICA 5C9MA 4EDFA 1P84E 2ZYAA 1U75B 3WC8A 4GIFA 4NPEA 2N1TB 4XA4A 1LMSA 1RHZB 3RLMA 1CHHA 1NO4A 5CCHC 2QEXP 4H13C 5B66E 2P67A 5E79E 3V2NA 1KD1Q 2C8SA 5CBOA 2WSSH 2NRGA 1PPJG 3P8CE 1PGJA 1CIHA 3OA8B 1ZMEC 1K8AQ 3H1JE 1J1DC 1L0NG 1IO3A 2K37A 5M1BA 4FAVA 2ZVOB 2Q3IA 1L0LD 2Q9IA 2FYUG 3P32A 5AW1B 1VQKP 1IJDB 3U59A 3HUSA 5KTBA 1DVVA 1CYIA 1YCCA 5DJQC 1SQVE 1SQQG 1NU1J 3CC2P 2E74D 2K88A 3E1IA 3WFBC 3WU2V 1GL2D 3QWOC 2ZJSE 4EIFA 1LFMA 1JCCA 3HTKB 4OVNF 2A06E 4H0LB 1FS0E 1IFPA 1NTZE 5AW4B 4R4LA 4RJTA 1RE4C 5APYA 1EZVG 1FU1A 3H1JD 4LLHA 1RZ6A 1QL3A 2RN0A 2FYUK 3GF7A 3L72E 1D7MA 4OGQD 3L71E 3K5BA 2YO3A 1GW4A 1DIPA 1Q82Q 1BSNA 1SQQK 3O6QA 1L9JC 1VQOP 4WVZA 3VOPA 5B5EE 1FJ0A 1CEDA 1JY2P 1IRVA 1CCRA 1S5LE 1SFCD 1S4XA 3Q3DA 3PJSK 2WT7B 3CMEP 4PWAA 1LTTC 1SQVD 2GA1A 2KS1B 5CIBB 4AALA 5H2FV 1EXJA 1NYHA 2L5GB 3ZOOA 1L4AA 1BCCE 1S72P 1FZGA 2A06D 3GW6A 3H1LD 3CX5E 2WTYA 3KZIV 1YEAA 2MKVA 2HODB 3L74D 3NWVA 2WPRA 3V4WA 4HKZH 1YEBA 3RK3E 5CICB 1M8OB 1QN2A 5KAIE 1LJ2A 1NAYA 1KMIZ 1CW5A 2KIKA 3I55P 2QM8A 1DH3A 1VQ7P 2GUVA 2K9JA 2FYNB 1S5LX 4OWFA 3RL0C 1H88A 3MK7B 2NPSA 4ZMDA 5AVRB 5KJ7A 2E74B 3M9BA 3WUTA 2E5YA 4RO0A 3GHGA 1BCCD 2Z5IA 4ZKPA 3S1KA 1VQPP 1FC2C 2IYOA 1EDKA 3CXHW 3CX5D 4Y99B 2H7HA 2BH5X 3KPEA 2D2CC 2C0XA 1CCHA 5C39A 1CRYA 3AE4C 4KJMA 1KYOI 1MKMA 5TJHA 3RK3D 1LC1A 5CCHA 1T3UA 3L70D 3CC7P 1BE3G 3HQ7A 2H89C 3Q5SA 2KSJA 1OX3A 1U57A 2HPCB 3L35A 1HF9A 3HE5B 3ZBMA 3BCCJ 1ZR2A 2EXVA 2WMMA 2IBZG 1IZNB 1Y9BA 4D6TG 1JCDA 1GJQA 3IR9A 5CIDB 1IFIA 2ZOOA 4U3FG 2N9YB 1DW1A 3LW5H 1FDIA 3KDPB 1N8RQ 3G9RA 3PHLA 3KYQA 4HYTB 1A8CA 1MUUA 4AYCA 1M1KQ 4UB8H 2XKMA 3H1KG 3AE3C 2Q1KA 1ZW0A 4AUWA 3CCVP 1BGYJ 1KB9I 1NTKG 3V4QA 1CTJA 1KILE 1HUCA 2IZ0A 1RE4A 4L1QA 3DR0A 1DW2A 5CIGB 1JDLA 2BEZF 4PV1C 1IK7A 4Q5PA 2BCNB 1NU1E 2P1JA 2C1UA 1FZBA 2C9LY 1EZVI 1SQQJ 1S3JA 1K04A 155CA 2GM4A 1VPCA 4WQBA 1KYOH 3VRDA 5KKZB 4UB6H 5AW7B 3GMAA 4JCGA 4UB8V 1M57D 5CIHB 2N9IA 1L0LJ 2CA3B 3HUSB 1JY3O 1S9KE 2JWAA 1P84I 3H1HJ 4BXLA 1LP1A 2W83C 1MFTA 2NZ2A 4OGQC 2Q7CA 2QVAA 1L2PA 3B71A 3JCUE 4GOFA 2H88C 1CI6A 1ZLLA 2BGVX 2DW3A 2W6BA 2G8YA 3AE7C 3FXDA 1NU1D 3D70A 4K35A 1R0QA 4GT1A 3LIEA 3OJAB 1RQVA 4EOTA 1SFCC 3OW2O 5KAFE 2OQQA 2PGDA 1OVRA 3RBXA 4I7ZC 4ZKUA 3TF5A 1KB9H 1N7SD 2ZONG 3O6QB 2FFDA 3WUVA 1KC8Q 1OIPA 5KLVG 1S9KD 2L4DA 1JY2N 4JYBA 2QJKC 3SWKA 3B5NC 1GZLA 1HGZA 3VMXA 2PRRA 1VF5D 5AVQB 1J1EB 2QJYB 1L4AB 5AW3B 2V7QJ 3L36A 2R44A 1QEXA 5AW9B 5C0ZA 3TYYA 4WQ9A 1I55A 2Q6QA 2WWWA 4AQRD 4ZNCA 2CA4B 3L74J 1KV4A 1BSHA 2V08A 3HD7A 3AE2C 5KLVK 3MTUE 3TGUG 2Y9ZA 1AOFA 3CD6P 1HZVA 5AW6B 1FI7A 3A9FA 3VYMA 3L37A 2E76D 3II6A 5CJ4A 1ZP0C 1DD4A 1GQ1A 2AEJA 1DEEG 4C7NA 2OTLP 1PP9G 3ORVA 2NPSB 1HJ3A 2WPSA 2PCCB 2N1TD 4XYDB 5CIEB 1C6SA 5EFWB 4YE1A 3CCMP 4GOEA 1YFCA 3RK3C 3H1ID 2WSEJ 3CWBG 1NJIQ 5DJUB 2DVHA 3BCCE 1CZQA 3TDKA 1M70A 2J59M 4AAMA 1CXCA 3DMIA 1U7MA 3V2RA 1YTCA 2IDBA 1YHQP 2MJZA 2JQRA 4D6TJ 4HH2A 3G6EP 3ZOWA 1CIFA 3TNUA 2D0WA 4NPDA 3MZWB 3P7KA 1KIBA 4JBZA 1AFOA 4B86A 3L70J 5GTHH 5KLIB 1HJ5A 1FBMA 1IFMA 1OW6A 2I8DA 4CPGA 1CSBA 2B10B 1T8ZA 5B66V 1DVHA 5AW8B 1PPJE 3PXTA 1J1DB 2ZVNB 1HVVA 3H1KJ 3VMAA 3CXHH 1FZCC 2OTJP 1BGYE 3A0HE 2FRCA 4PW9B 2ZT9C 2KLVA 3Q2YA 3MIWA 1VF5B 3W67A 4DOJA 2CPBA 3CCRP 4WY4C 1NGMB 1C2NA 2FXMA 1X9VA 4H44C 1QL4A 3P8MC 4H0LD 2N9JA 5DJQB 1AOQA 1G2CB 3D0WA 1SQQE 1ZRTE 1HZUA 2I8FA 4WB4A 1H1OA 4JYCA 3VTPC 1LT9C 2XZRA 1HH0A 2D0SA 1L0LE 2Y0CA 1PPJD 4AANA 1IFNA 3O8ZA 3RK2B 1RE3C 5IY51 3H1HE 1JM0A 2B87A 2FXOA 1KYOW 1JUNA 3NFQA 2FY8A 1GTWA 4OH8B 2N18B 1Q2NA 3FWNA 2FYUD 3WFCC 3WU2H 1VQ6P 1KQSO 1I8OA 1KILC 1KX2A 3B5NA 2PACA 3O5CA 4N3YB 3AEBC 3B8EB 2KNCA 4PJ0E 1SQQD 5AW5B 1ZRTD 1QVFO 2FWLA 1LP1B 2BCCG 1URQA 3HQ8A 3SLEA 2WQYC 1YIJP 1CHJA 1T2KC 1NNOA 1N50A 1CI6B 4AX3A 1HBWA 3ZCFA 1HRCA 3M91A 1N7SC 1NHLA 4C46A 5KLVJ 4Y28J 3H1HD 1YTZT 3ABVC 1RF1C 1N73C 1FDMA 2KP8A 1CTYA 2KZIA 5H2FH 1L0NK 2FFDB 3Q5RA 2AXTH 1R8EA 2AIUA 1MFZA 3NBTA 3H1LE 3KZIH 2WSFJ 1H89A 3L74E 4DCKA 2RMZA 1USDA 2E75C 4DT0A 2JKVA 4I2LC 2N3BA 1UIXA 2OYIC 2W27A 3D6ZA 3BVHA 3F89A 1JOCA 3V6IA 2Y9YA 3TGUJ 2D2CB 1OW7A 2OYOA 3MD0A 2CPSA 2E76C 5DF5A 3AEFC 4WQ8A 3CYTI 3HD7B 1N15A 1PGPA 4GDOA 2SPZA 1R5SA 1HJ0A 2KUBA 1SLQA 2N1TC 3CWBJ 3PTZA 3M9HA 4W80A 3V5BA 4ASWA 1H31A 1LTJA 1FZAA 3AE1C 3CMAP 1OVUA 2AXTV 3CP5A 3MHVA 3O0RC 2QG4A 2IBZE 1L9BC 4C7NB 3OAKA 4D6TE 1A56A 3IFMA 3CCJP 1DW3A 2ITAA 4WY4A 1DEBA 4EIDA 3KHUA 1H9XA 1G1JA 2O1JA 3L70E 3CXHD 1OVVA 2V07A 3H1IJ 4PD4I 3H1KE 3CI9A 4I6MC 3H32A 3JSVC 1LTIC 3CPWO 3L75J 3OA7A 4YXDC 3U1AA 3OCDA 3LW5J 3A3YB 3N4XA 4I1LA 2B9BA 3SWSA 3TNUB 4GODA 1LT9A 1GK4A 3B4SA 5BU8B 1C52A 5CCGA 3PP5A 3D71A 2VRSA 3GF3A 4K3IA 1JNMA 1U74B 1J2JB 3SWYA 2A06G 1ZOYC 1RF0A 1NTZG 2IBZD 4D6TD 3JC22 4H0LC 3BRVB 1NMIA 3BRTB 1LTBC 3AE5C 3L72G 2AEFA 4L73A 4AAOA 3L71G 1RY3A 1KILA 1USEA 2Q3EA 1DD3A 5BU5A 2FYZA 5KAFH 1LC2A 3H1KD 1E79H 2YIUB 3ITKA 2M5AB 2O3JA 2KK7A 1U7JA 4IL6H 1M1JB 1NKZB 4WWIA 1A02F 3VMYA 1NTZK 1GU2A 1HCMA 4DY9A 1YYCA 1BCCG 1FAVA 1M6ZA 3I5CA 2O01H 2MHMA 3TYIA 1PIXA 4PD4H 3FWLA 1FJKA 1GW3A 2B87B 1AV1A 3CX5W 1Y8AA 2POHA 1YBKA 2OZ1A 1L0NJ 2LXBA 2KI7B 4FANA 3WFEC 3CL3D 1GU5A 1C7MA 1L4AD 1CXAA 5KAFV 1G1IA 3CCQP 5AW2B 1YJWP 2QJKB 2FYUJ 1YJNP 1FOSE 3MGNA 5KLVE 1CSVA 5APWA 2KNCB 3AEAC 1H33A 4K3AA 2C9XB 2OYIA 5CBNA 4IL6V 2E42A 1JY3N 1URQB 4L74A 1H0TA 3A7OA 5CYTR 3MK7C 2CK3H 2YO2A 3A0BE 4W7YA 5AVYB 1YIQA 2E74C 1EC5A 5AW0B 1FJPA 1FHBA 3AECC 2OARA 3WMM0 1GL2C 1GDTA 2UWJE 2HV4A 2ORLA 1NTKK 1I54A 2NPSD 2N3YA 3VYIA 3CLQA 2GC7D 1VQMP 2WZ7A 5KJ7D 2O1KA 4H0JA 2YMYA 2BPBB 3TGUE 5K5GB 1ZXGA 1IZL0 2K3RA 3IAOA 1CYCA 1Q81Q 3W68A 2C9NY 4EIEA 3A5TA 5KLVD 3IN6A 1NAFA 4EICA 1WT6A 5CCHD 2Z4EA 2OYHC 4H13D 2JR8A 1VQ4P 4O9BA 5L8RJ 1QLED 5CMZA 1M90Q 4FA1A 3A2AA 1K9MQ 1F1FA 3EQ2A 2LITA 3ZDMA 3NMDA 1FZEA 3M0AA 1DX7A 1YQ3C 1PV3A 2HG5D 1I6DA 1Q90D 4IFFA 2V4HA 1XTGB 1EB7A 1SQXG 2WSCH 3L73G 3IF4A 3TGUD 1MV8A 3H1IE 1OZHA 2B0ZB 1H31B 1CSWA 1LTJB 3AEGC 4FA9A 1WVEC 3L75E 3S9OA 2FKWB 1VQ5P 2ZT9B 1NU1G 1UIIA 4IFMA 1AKKA 5CHXA 2AXCA 4WQAA 1LNQA 4UB8E 4WY4B 2IPPA 3CWBD 1CYJA 4MU8A 2BH4X 5AVXB 1T6AA 1BDDA 3VNWA 2K1AA 1P84H 1KZUB 2M8RA 2WVRA 2P2UA 2PFXA 1JY2O 5KKZC 2K9JB 1SQXK 1NVOA 3AEDC 5B66H 1NTZJ 2WT7A 5E79H 3RK2D 1M56D 1SQBG 3PXWA 4QMAA 3KQGA 3FX0A 3L71J 3O20A 3UIAA 1BE3J 2QE7H 2LIRA 1NU1K 1SS1A 1FI3A 4KHXA 3GHGB 3L75D 3E7KA 4QAOA 2ZXEB 2HODA 3CX5I 2LKMA 4L76A 3WUUA 4UB6E 1N86A 2P10A 3EWKA 4ASVA 4H13B 1N2DC 3PH0A 4JF7A 3EFGA 2ZYDA 4U3FJ 1KFNA 1KILB 2BEQD 1Y47A 3E1RA 1AYGA 1HJ4A 1SQBK 1HWTC 2ZFCA 1IFJA 1CRGA 2PP6A 1N9CA 3O1YA 1MG3D 5E79V 1HJBA 1EDJA 4IOIH 4A7PA 1MZ9A 5GTIE 2E5TA 1L0NE 1DT1A 4PJ0V 2W8ZA 1VQ9P 1NTKJ 1GL2A 3RL0D 1J1EC 3GG2A 2FYUE 1L4AC 1CSXA 2M0BA 1KYOD 3Q1MA 2H43A 2WPQA 2B11B 1IFDA 1KB9E 2ZBOA 3M06A 2OZ1B 5APXA 1GIWA 5B5EH 3CCSP 2B4ZA 1S5LH 1NTMG 2R3CA 1SQPG 1NH4A 2D2CD 1QKSA 5APVA 2PCBB 1RQUA 3PLNA 3AEEC 1EXIA 2LR2A 3M0DC 5B6QA 2OYHA 1KV9A 1YJ9P 2A45G 1X79B 2E75B 2N9BA 1H33B 1SFCA 1EZVE 2OYIB 451CA 3H6PA 3EFFK 1L0ND 2BCCD 1H0TB 1CORA 4N0KA 3R4YA 2I1KA 3CX5H 3HD7D 2NPSC 2W6AA 3CCUP 2XV5A 4O1WA 1LWUC 2FBWC 1PL5A 3BCCG 5KAIH 2VHDA 4YPCA 1FCDC 3SXTA 1W2LA 1NTMK 3G71P 1BDCA 1SQPK 2JO1A 3SFEC 1KB9D 4L3GA 2J5UA 1Q86Q 1JY3P 5B5EV 1S5LV 4WQCA 3M9QA 2GC4D 4U7JA 3AE9C 4GEDB 1N90A 3NXSA 5KLIC 2GIWA 2DGEA 5AURA 1OCDA 1QVGO 3RN0A 1EZVD 1BGYG 5TISE 1SQXJ 3F5HA 5APTA 3L73J 1VQNP 5KAIV 1VF5C 2IFMA 4PV1D 3RL0B 3HQ6A 1IC2A 2QJPC 1EDLA 1P84D 1J3SA 1IO4A 5GTHE 2KB7P 1DIIC 2QRXA 2B89A 3C8VA 2YCCA 2MTAC 4H0KA 1KFMA 4EYYQ 1LT1A 2Y0DA 4Z1MH 3CXHE 3V2PA 2HFED 1CC5A 1L0LG 1KQGB 4GKGA 2BLFB 3P8CD 4RESB 1CRHA 3CC4P 2W90A 3KXDA 3H1HG 1EQ7A 1IK9A 3VP8A 1NKNA 1SQBJ 1PP9J 3PH2B 3RK2C 2FXPA 5CJ0A 1BE3E 4EIJA 1JMMA 3CCEP 1W5CE 3U1CA 1JTHA 2N18C 1NIRA 1FZCA 1PFIA 5CIFB 1F1CA 4GYDA 2K9YA 2IYPA 3RGUA 3SFDC 1KQFB 2ZZS1 1H32A 1E8EA 2JJLA 3H1JG 1L0LK 4BWNA 1FI9A 4U3FE 3FGAD 1JEKA 1GU4A 351CA 4DJGA 1I5TA 1TU3F 3N7NA 1M60A 4YTPC 1LS9A 3SWFA 1NTZD 3B5ND 2KXPB 1QL1A 3ZOXA 2C0WA 4XFJA 4LGDE 3A0BH 5AVTB 4JPZB 4TT3H 1PGQA 3VMZA 3L72D 2JDIH 1E5WA 2Y0EA 3L71D 1SQVG 1URQD 2J58A 3BASA 3WU2E 1PZQA 1VYDA 2XNDH 2WSFH 1COTA 1NTKE 1BE3D 2O01J 3M0DA 3WFDC 2RKLA 1WRGA 2QIWA 1NMLA 1W5CT 4PV1B 1QL2A 1RE3A 3H1LG 1CTZA 2JEEA 3T97A 2FFDC 5AVSB 3SJLA 1RH5B 2R5BA 2A45I 2Q5UA 1IQCA 3L74G 3JCUH 2YQBA 1LWUA 1OFCX 1K05A 4U3FD 1OWAA 2ZAEB 2YKOA 4BRYA 1GL2B 1NTMJ 4FA4A 4FA5A 1SQPJ 1OXZA 4WQEA 2M3EA 1FOCA 1SQVK 2C1DA 3A0BV 2CE1A 2QA4P 1C6OA 5H2FE 1LTAC 1K3HA 1YITP 2XNXA 4OGQB 1NTKD 2AXTE 2KOGA 3HQ9A 3MUDC 3QH9A 2YK3A 3HD7C 3KZIE 5AVZB 2M3BA 5DFSA 1N7SA 2IFNA 2OYHB 1HGVA 3C2CA 5APUA 1GD2E 1SFCB 3NBSA 1RF1A 1N73A 1PGOA 1W2BO 1EDIA 1K73Q 1S6VB 2E43A 1Q7YQ 2YKQA 4I7ZB 1ETPA 3L70G 2BCCJ 4HB1A 2I1JA 4DZOA 2OTKE 3TSIA 1NOHA 1YNRA 1H9YA 1YI2P 2XTSB 1FE6A 2AEMA 3B5NB 4J20A 1JO5A 2ZT9D 1G2CA 1AJYA 2FYNC 4N6JA 2YNYA 3ZIYA 4O1QA 1SQXE 4WY4D 5EXQA 1KN7A 1AVYA 3L73E 2A45H 4XE5B 2R32A 4H44D 4MN4C 4YXWH 5AVVB 2GB8B 1X8YA 2CXBA 1LTSC 4IFDK 4RKUJ 4KMGA 3HE4A 1WEJF 1H8AA 2WSCJ 2B88A 4Y99C 3D6YA 1YTZI 3JBTB 4R4MA 2N1TA 1VDFA 1RAQA 3S4RA 3MP7B 1M7LA 4NPFX 4XXLA 5CCGD 2JWDA 1CRCA 1CO6A 1FZFA 1KTMA 1XTCC 2C2CA 1KQLA 3V2QA 4NFGB 1SP4A 1LGHB 3OA8A 1RZ5A 4WQ7A 1SQBE 1PP9E 3RK3B 3H25A 2ZXYA 1FOSF 2BASA 4L75A 2YIUC 1SQXD 3L73D 2LXCB 1KILD 1C75A 1GMJA 1M1JC 3CWBE 4N78E 5APSA 5GTIH 1KORA 3A0HH 4V2KA 4P4QB 1LTGC 2ZXXA 4WQDA 1S1CX 2R5DA 2IX7C 4L3HA 2JP3A 2JTIB 1C6RA 2IZ1A 1CRJA 2HLOA 1CRIA 2O01N 1B7VA 2H8PD 3H1JJ 5AVUB 3AE8C 1T2KD 1OAEA 4UB6V 1DW0A 2KSEA 1JTHB 3G3ZA 3ZOYA 4KT0J 1T3JA 4IL6E 3HTKA 4TLFA 1FZCB 3L4FA 1BL9A 1ZN5A 1KB0A 2C1VA 1H32B 1SQBD 1PP9D 1VQ8P 1GDVA 1OW8A 1WMKA 1I8PA 1SQVJ 3VP9A 1AVOA 2WITA 1KX7A 4N78D 1URQC 5GTIV 3A0HV 4H44B 4PD4E 1A2SA 3CXHI
chains in the Genus database with same CATH topology
1L0ND 2BCCD 2AXTV 1CORA 3CP5A 4N0KA 3O0RC 2QG4A 4O1WA 1L9BC 1CTJA 1A56A 3OCDB 3L4MA 1DW3A 1HROA 2VHDA 2KS1A 4L1QA 4EIDA 3KHUA 1H9XA 3DR0A 1DW2A 3PRJA 1FCDC 1JDLA 5CIGB 3CXHD 3SXTA 1W2LA 4Q5PA 2V07A 1KB9D 2BCNB 4L3GA 2C1UA 5B5EV 1CNOA 155CA 1S5LV 4Y5RA 4WQCA 1E29A 2L91A 4WQBA 2GC4D 3VRDA 5KKZB 3OCDA 1QYZA 4GEDB 3X39A 1N90A 4JCGA 4UB8V 5CIHB 3SWSA 2N9IA 3RN1A 2CA3B 2GIWA 2DGEA 3CU4A 1CSUA 4PD4D 4RSZA 1C52A 1OCDA 5AURA 3RN0A 3SVWA 1EZVD 2JWAA 4K3IA 1U74B 2C1DB 2CE0A 2IBZD 4LJIA 4D6TD 3L4OA 1ZZHA 5KAIV 1NMIA 3DP5A 1RAPA 1GKSA 3HQ6A 4FB1A 4AAOA 1NTMD 2BGVX 3RMZA 1SQPD 1P84D 2Q3EA 1MZ4A 2B12B 1J3SA 1NU1D 1R0QA 1DIIC 1LC2A 3H1KD 1CIEA 2YCCA 2MTAC 4H0KA 1E2RA 2AI5A 2YIUB 2Y0DA 3ITKA 3TF5A 1CC5A 2ZONG 2O3JA 3WUIA 2BLFB 3PXSA 1CIGA 1CRHA 1GU2A 1MG2D 1HCMA 2L4DA 4DY9A 3BCCD 2QJPB 5TISV 1M6ZA 1IRWA 2MHMA 3PH2B 3TYIA 1CHIA 2QJYB 3FWLA 3CX5W 1HH7A 2N18C 5C0ZA 1NIRA 2OZ1A 4WQ9A 5CIFB 1F1CA 4GYDA 1DIQC 5GTHV 4FANA 3WFEC 1I55A 1I6EA 1C7MA 1CXAA 5KAFV 2ZZS1 1H32A 1E8EA 3M97X 2CA4B 1FI9A 1C2RA 2QJKB 2V08A 351CA 1K3GA 1CSVA 1I5TA 1BGYD 2KNCB 1H33A 1YICA 5C9MA 4EDFA 1M60A 2C9XB 1U75B 4IL6V 1LS9A 1AOFA 3WC8A 1HZVA 1FI7A 3A9FA 1LMSA 3VYMA 3RLMA 1NTZD 5CYTR 3MK7C 1CHHA 1GQ1A 3ZOXA 1YIQA 3ORVA 3L72D 1HJ3A 2PCCB 1FHBA 3L71D 2C8SA 2Y0EA 4XYDB 5CIEB 1VYDA 1C6SA 4YE1A 1COTA 1YFCA 1BE3D 3H1ID 2HV4A 1CIHA 2ORLA 3OA8B 1I54A 2DVHA 3WFDC 2N3YA 1NMLA 1IO3A 2GC7D 1W5CT 3TDKA 1M70A 4AAMA 1CXCA 4FAVA 3DMIA 4H0JA 1CTZA 2BPBB 1YTCA 1IZL0 3SJLA 2JQRA 1IQCA 1L0LD 1CYCA 2YQBA 3ZOWA 4U3FD 4EIEA 1CIFA 2D0WA 5KLVD 1KIBA 4EICA 1DVVA 1CYIA 4FA4A 4FA5A 5KLIB 1HJ5A 1YCCA 4WQEA 5DJQC 1FOCA 2B10B 5B66V 1DVHA 3PXTA 2C1DA 3A0BV 2CE1A 3WFBC 3VMAA 1C6OA 3WU2V 4FA1A 4EIFA 1F1FA 1LFMA 2FRCA 2LITA 1K3HA 4PW9B 1NTKD 3HQ9A 1I6DA 4RJTA 2YK3A 3H1JD 1RZ6A 1QL3A 2RN0A 1EB7A 5DFSA 1C2NA 1QL4A 2N9JA 5DJQB 3C2CA 3TGUD 1AOQA 3NBSA 2B0ZB 1H31B 1CSWA 1S6VB 1HZUA 4FA9A 2I8FA 1L9JC 1WVEC 1ETPA 1FJ0A 1CEDA 1IRVA 1CCRA 1H1OA 4PWAA 1SQVD 2D0SA 1AKKA 5CIBB 4WQAA 4AALA 1PPJD 1YNRA 2Y0CA 4AANA 1H9YA 5H2FV 2XTSB 3CWBD 1CYJA 4MU8A 2BH4X 4J20A 3ZOOA 3VNWA 5IY51 3ZIYA 4O1QA 2K9JB 1KYOW 2A06D 5EXQA 3GW6A 3H1LD 3KZIV 1YEAA 2GB8B 2N18B 3L74D 3NWVA 2FYUD 3WFCC 1YEBA 2CXBA 5CICB 1I8OA 1QN2A 1KX2A 3PXWA 4KMGA 3O20A 2PACA 1WEJF 3O5CA 2LIRA 1FI3A 1SQQD 1ZRTD 2FWLA 3L75D 2FYNB 3JBTB 1RAQA 3HQ8A 3SLEA 4QAOA 4XXLA 1CRCA 1CO6A 1CHJA 3MK7B 1NNOA 2C2CA 1N50A 4AX3A 4NFGB 3ZCFA 1HRCA 3OA8A 1RZ5A 1BCCD 3H1HD 1AYGA 1HJ4A 4WQ7A 2ZXYA 1SQXD 1CTYA 3CXHW 3CX5D 1CRGA 3L73D 2BH5X 1C75A 1N9CA 3O1YA 1CCHA 1MG3D 5E79V 1CRYA 4V2KA 4A7PA 4P4QB 5TJHA 1LC1A 4WQDA 1DT1A 3L70D 4L3HA 4PJ0V 2AIUA 3NBTA 3HQ7A 2JTIB 1C6RA 1CRJA 3GG2A 1CRIA 1B7VA 3ZBMA 2RMZA 2EXVA 2N3BA 1CSXA 1OAEA 1KYOD 4UB6V 1DW0A 1GJQA 5CIDB 2B11B 2ZBOA 2ZOOA 3ZOYA 2OZ1B 1GIWA 2B4ZA 2N9YB 1DW1A 1BL9A 1KB0A 3PHLA 2C1VA 5DF5A 1H32B 1SQBD 1PP9D 1QKSA 4WQ8A 2PCBB 1A8CA 3PLNA 1GDVA 3CYTI 1I8PA 1N15A 5B6QA 1KV9A 1KX7A 5GTIV 3A0HV 3PTZA 1H33B 451CA 1H31A 1A2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0N D;  2BCC D;  2AXT V;  1COR A;  3CP5 A;  4N0K A;  3O0R C;  2QG4 A;  4O1W A;  1L9B C;  1CTJ A;  1A56 A;  3OCD B;  3L4M A;  1DW3 A;  1HRO A;  2VHD A;  2KS1 A;  4L1Q A;  4EID A;  3KHU A;  1H9X A;  3DR0 A;  1DW2 A;  3PRJ A;  1FCD C;  1JDL A;  5CIG B;  3CXH D;  3SXT A;  1W2L A;  4Q5P A;  2V07 A;  1KB9 D;  2BCN B;  4L3G A;  2C1U A;  5B5E V;  1CNO A;  155C A;  1S5L V;  4Y5R A;  4WQC A;  1E29 A;  2L91 A;  4WQB A;  2GC4 D;  3VRD A;  5KKZ B;  3OCD A;  1QYZ A;  4GED B;  3X39 A;  1N90 A;  4JCG A;  4UB8 V;  5CIH B;  3SWS A;  2N9I A;  3RN1 A;  2CA3 B;  2GIW A;  2DGE A;  3CU4 A;  1CSU A;  4PD4 D;  4RSZ A;  1C52 A;  1OCD A;  5AUR A;  3RN0 A;  3SVW A;  1EZV D;  2JWA A;  4K3I A;  1U74 B;  2C1D B;  2CE0 A;  2IBZ D;  4LJI A;  4D6T D;  3L4O A;  1ZZH A;  5KAI V;  1NMI A;  3DP5 A;  1RAP A;  1GKS A;  3HQ6 A;  4FB1 A;  4AAO A;  1NTM D;  2BGV X;  3RMZ A;  1SQP D;  1P84 D;  2Q3E A;  1MZ4 A;  2B12 B;  1J3S A;  1NU1 D;  1R0Q A;  1DII C;  1LC2 A;  3H1K D;  1CIE A;  2YCC A;  2MTA C;  4H0K A;  1E2R A;  2AI5 A;  2YIU B;  2Y0D A;  3ITK A;  3TF5 A;  1CC5 A;  2ZON G;  2O3J A;  3WUI A;  2BLF B;  3PXS A;  1CIG A;  1CRH A;  1GU2 A;  1MG2 D;  1HCM A;  2L4D A;  4DY9 A;  3BCC D;  2QJP B;  5TIS V;  1M6Z A;  1IRW A;  2MHM A;  3PH2 B;  3TYI A;  1CHI A;  2QJY B;  3FWL A;  3CX5 W;  1HH7 A;  2N18 C;  5C0Z A;  1NIR A;  2OZ1 A;  4WQ9 A;  5CIF B;  1F1C A;  4GYD A;  1DIQ C;  5GTH V;  4FAN A;  3WFE C;  1I55 A;  1I6E A;  1C7M A;  1CXA A;  5KAF V;  2ZZS 1;  1H32 A;  1E8E A;  3M97 X;  2CA4 B;  1FI9 A;  1C2R A;  2QJK B;  2V08 A;  351C A;  1K3G A;  1CSV A;  1I5T A;  1BGY D;  2KNC B;  1H33 A;  1YIC A;  5C9M A;  4EDF A;  1M60 A;  2C9X B;  1U75 B;  4IL6 V;  1LS9 A;  1AOF A;  3WC8 A;  1HZV A;  1FI7 A;  3A9F A;  1LMS A;  3VYM A;  3RLM A;  1NTZ D;  5CYT R;  3MK7 C;  1CHH A;  1GQ1 A;  3ZOX A;  1YIQ A;  3ORV A;  3L72 D;  1HJ3 A;  2PCC B;  1FHB A;  3L71 D;  2C8S A;  2Y0E A;  4XYD B;  5CIE B;  1VYD A;  1C6S A;  4YE1 A;  1COT A;  1YFC A;  1BE3 D;  3H1I D;  2HV4 A;  1CIH A;  2ORL A;  3OA8 B;  1I54 A;  2DVH A;  3WFD C;  2N3Y A;  1NML A;  1IO3 A;  2GC7 D;  1W5C T;  3TDK A;  1M70 A;  4AAM A;  1CXC A;  4FAV A;  3DMI A;  4H0J A;  1CTZ A;  2BPB B;  1YTC A;  1IZL 0;  3SJL A;  2JQR A;  1IQC A;  1L0L D;  1CYC A;  2YQB A;  3ZOW A;  4U3F D;  4EIE A;  1CIF A;  2D0W A;  5KLV D;  1KIB A;  4EIC A;  1DVV A;  1CYI A;  4FA4 A;  4FA5 A;  5KLI B;  1HJ5 A;  1YCC A;  4WQE A;  5DJQ C;  1FOC A;  2B10 B;  5B66 V;  1DVH A;  3PXT A;  2C1D A;  3A0B V;  2CE1 A;  3WFB C;  3VMA A;  1C6O A;  3WU2 V;  4FA1 A;  4EIF A;  1F1F A;  1LFM A;  2FRC A;  2LIT A;  1K3H A;  4PW9 B;  1NTK D;  3HQ9 A;  1I6D A;  4RJT A;  2YK3 A;  3H1J D;  1RZ6 A;  1QL3 A;  2RN0 A;  1EB7 A;  5DFS A;  1C2N A;  1QL4 A;  2N9J A;  5DJQ B;  3C2C A;  3TGU D;  1AOQ A;  3NBS A;  2B0Z B;  1H31 B;  1CSW A;  1S6V B;  1HZU A;  4FA9 A;  2I8F A;  1L9J C;  1WVE C;  1ETP A;  1FJ0 A;  1CED A;  1IRV A;  1CCR A;  1H1O A;  4PWA A;  1SQV D;  2D0S A;  1AKK A;  5CIB B;  4WQA A;  4AAL A;  1PPJ D;  1YNR A;  2Y0C A;  4AAN A;  1H9Y A;  5H2F V;  2XTS B;  3CWB D;  1CYJ A;  4MU8 A;  2BH4 X;  4J20 A;  3ZOO A;  3VNW A;  5IY5 1;  3ZIY A;  4O1Q A;  2K9J B;  1KYO W;  2A06 D;  5EXQ A;  3GW6 A;  3H1L D;  3KZI V;  1YEA A;  2GB8 B;  2N18 B;  3L74 D;  3NWV A;  2FYU D;  3WFC C;  1YEB A;  2CXB A;  5CIC B;  1I8O A;  1QN2 A;  1KX2 A;  3PXW A;  4KMG A;  3O20 A;  2PAC A;  1WEJ F;  3O5C A;  2LIR A;  1FI3 A;  1SQQ D;  1ZRT D;  2FWL A;  3L75 D;  2FYN B;  3JBT B;  1RAQ A;  3HQ8 A;  3SLE A;  4QAO A;  4XXL A;  1CRC A;  1CO6 A;  1CHJ A;  3MK7 B;  1NNO A;  2C2C A;  1N50 A;  4AX3 A;  4NFG B;  3ZCF A;  1HRC A;  3OA8 A;  1RZ5 A;  1BCC D;  3H1H D;  1AYG A;  1HJ4 A;  4WQ7 A;  2ZXY A;  1SQX D;  1CTY A;  3CXH W;  3CX5 D;  1CRG A;  3L73 D;  2BH5 X;  1C75 A;  1N9C A;  3O1Y A;  1CCH A;  1MG3 D;  5E79 V;  1CRY A;  4V2K A;  4A7P A;  4P4Q B;  5TJH A;  1LC1 A;  4WQD A;  1DT1 A;  3L70 D;  4L3H A;  4PJ0 V;  2AIU A;  3NBT A;  3HQ7 A;  2JTI B;  1C6R A;  1CRJ A;  3GG2 A;  1CRI A;  1B7V A;  3ZBM A;  2RMZ A;  2EXV A;  2N3B A;  1CSX A;  1OAE A;  1KYO D;  4UB6 V;  1DW0 A;  1GJQ A;  5CID B;  2B11 B;  2ZBO A;  2ZOO A;  3ZOY A;  2OZ1 B;  1GIW A;  2B4Z A;  2N9Y B;  1DW1 A;  1BL9 A;  1KB0 A;  3PHL A;  2C1V A;  5DF5 A;  1H32 B;  1SQB D;  1PP9 D;  1QKS A;  4WQ8 A;  2PCB B;  1A8C A;  3PLN A;  1GDV A;  3CYT I;  1I8P A;  1N15 A;  5B6Q A;  1KV9 A;  1KX7 A;  5GTI V;  3A0H V;  3PTZ A;  1H33 B;  451C A;  1H31 A;  1A2S A; 
#chains in the Genus database with same CATH topology
 1ZV8 A;  1OMI A;  3H32 B;  1QX8 A;  3Q5P A;  3H1L J;  2E75 D;  2QSI A;  3OCD B;  3L4M A;  2HR3 A;  2W6J H;  3HUS C;  2ZYG A;  3MUD A;  1HRO A;  2KS1 A;  2YXQ B;  3CCL P;  4HJG H;  1LT9 B;  3L72 J;  3PRJ A;  5AVW B;  1NTM E;  2OGU A;  3R2P A;  1SQP E;  3NTN A;  4PJ0 H;  3C9I A;  2RH0 A;  4IL6 X;  1YQ4 C;  2XDJ A;  1GK6 A;  1CNO A;  4EI2 A;  3RBZ A;  4Y5R A;  1E29 A;  2L91 A;  3SSU A;  3T97 B;  1KYO E;  1QYZ A;  2IBZ I;  3X39 A;  2KYV A;  1LWU B;  3HRN A;  1W2E A;  3RN1 A;  1AA0 A;  4LC1 A;  3CU4 A;  4BRY B;  1CSU A;  2YXR B;  4PD4 D;  4RSZ A;  1JB0 J;  3SVW A;  3TK1 A;  1FDO A;  4W7Z A;  2PAJ A;  3USS A;  1BCC J;  5TIS H;  3VN0 A;  2C1D B;  2P7J A;  4M3L A;  2CE0 A;  2V7Q H;  4LJI A;  3L4O A;  2KZJ A;  1ZZH A;  3DP5 A;  1RAP A;  1GKS A;  4FB1 A;  1AQ5 A;  2BCC E;  1NTM D;  3RMZ A;  1SQP D;  3H1I G;  1ZR4 A;  1MZ4 A;  2B12 B;  1QGK B;  1VL2 A;  1N7S B;  1X0T A;  2KLU A;  3L75 G;  1CIE A;  5APQ A;  2QJY C;  1HTL C;  1LTJ C;  3BAT A;  2WPV B;  1E2R A;  2AI5 A;  1RF1 B;  1N73 B;  1N7L A;  1A02 J;  1SVF A;  2YKP A;  3WUI A;  1JMB A;  3G4S P;  5DJT B;  2HYN A;  3PXS A;  1CIG A;  4JQ0 D;  3RL0 g;  3FXE A;  1MG2 D;  3BCC D;  2YMK A;  4WBA A;  2P58 A;  3LID A;  2QJP B;  5TIS V;  2HPC A;  1NWQ A;  1IRW A;  2WSE H;  3HE5 A;  3AE6 C;  4C7R A;  1CHI A;  1AQT A;  2M5A A;  1Z56 A;  1HH7 A;  5BVZ A;  1M1J A;  1R5L A;  3I56 P;  1DIQ C;  5GTH V;  1S2E A;  1I6E A;  2QM7 A;  3C1L A;  2Z5H A;  3GLM A;  3M97 X;  5KJ7 C;  5CCG C;  1C2R A;  2XU6 A;  2E76 B;  3GHG C;  1X22 A;  3HE4 B;  1K3G A;  1BGY D;  1RF0 C;  2GUS A;  1VQL P;  2R3S A;  2G3A A;  1YIC A;  5C9M A;  4EDF A;  1P84 E;  2ZYA A;  1U75 B;  3WC8 A;  4GIF A;  4NPE A;  2N1T B;  4XA4 A;  1LMS A;  1RHZ B;  3RLM A;  1CHH A;  1NO4 A;  5CCH C;  2QEX P;  4H13 C;  5B66 E;  2P67 A;  5E79 E;  3V2N A;  1KD1 Q;  2C8S A;  5CBO A;  2WSS H;  2NRG A;  1PPJ G;  3P8C E;  1PGJ A;  1CIH A;  3OA8 B;  1ZME C;  1K8A Q;  3H1J E;  1J1D C;  1L0N G;  1IO3 A;  2K37 A;  5M1B A;  4FAV A;  2ZVO B;  2Q3I A;  1L0L D;  2Q9I A;  2FYU G;  3P32 A;  5AW1 B;  1VQK P;  1IJD B;  3U59 A;  3HUS A;  5KTB A;  1DVV A;  1CYI A;  1YCC A;  5DJQ C;  1SQV E;  1SQQ G;  1NU1 J;  3CC2 P;  2E74 D;  2K88 A;  3E1I A;  3WFB C;  3WU2 V;  1GL2 D;  3QWO C;  2ZJS E;  4EIF A;  1LFM A;  1JCC A;  3HTK B;  4OVN F;  2A06 E;  4H0L B;  1FS0 E;  1IFP A;  1NTZ E;  5AW4 B;  4R4L A;  4RJT A;  1RE4 C;  5APY A;  1EZV G;  1FU1 A;  3H1J D;  4LLH A;  1RZ6 A;  1QL3 A;  2RN0 A;  2FYU K;  3GF7 A;  3L72 E;  1D7M A;  4OGQ D;  3L71 E;  3K5B A;  2YO3 A;  1GW4 A;  1DIP A;  1Q82 Q;  1BSN A;  1SQQ K;  3O6Q A;  1L9J C;  1VQO P;  4WVZ A;  3VOP A;  5B5E E;  1FJ0 A;  1CED A;  1JY2 P;  1IRV A;  1CCR A;  1S5L E;  1SFC D;  1S4X A;  3Q3D A;  3PJS K;  2WT7 B;  3CME P;  4PWA A;  1LTT C;  1SQV D;  2GA1 A;  2KS1 B;  5CIB B;  4AAL A;  5H2F V;  1EXJ A;  1NYH A;  2L5G B;  3ZOO A;  1L4A A;  1BCC E;  1S72 P;  1FZG A;  2A06 D;  3GW6 A;  3H1L D;  3CX5 E;  2WTY A;  3KZI V;  1YEA A;  2MKV A;  2HOD B;  3L74 D;  3NWV A;  2WPR A;  3V4W A;  4HKZ H;  1YEB A;  3RK3 E;  5CIC B;  1M8O B;  1QN2 A;  5KAI E;  1LJ2 A;  1NAY A;  1KMI Z;  1CW5 A;  2KIK A;  3I55 P;  2QM8 A;  1DH3 A;  1VQ7 P;  2GUV A;  2K9J A;  2FYN B;  1S5L X;  4OWF A;  3RL0 C;  1H88 A;  3MK7 B;  2NPS A;  4ZMD A;  5AVR B;  5KJ7 A;  2E74 B;  3M9B A;  3WUT A;  2E5Y A;  4RO0 A;  3GHG A;  1BCC D;  2Z5I A;  4ZKP A;  3S1K A;  1VQP P;  1FC2 C;  2IYO A;  1EDK A;  3CXH W;  3CX5 D;  4Y99 B;  2H7H A;  2BH5 X;  3KPE A;  2D2C C;  2C0X A;  1CCH A;  5C39 A;  1CRY A;  3AE4 C;  4KJM A;  1KYO I;  1MKM A;  5TJH A;  3RK3 D;  1LC1 A;  5CCH A;  1T3U A;  3L70 D;  3CC7 P;  1BE3 G;  3HQ7 A;  2H89 C;  3Q5S A;  2KSJ A;  1OX3 A;  1U57 A;  2HPC B;  3L35 A;  1HF9 A;  3HE5 B;  3ZBM A;  3BCC J;  1ZR2 A;  2EXV A;  2WMM A;  2IBZ G;  1IZN B;  1Y9B A;  4D6T G;  1JCD A;  1GJQ A;  3IR9 A;  5CID B;  1IFI A;  2ZOO A;  4U3F G;  2N9Y B;  1DW1 A;  3LW5 H;  1FDI A;  3KDP B;  1N8R Q;  3G9R A;  3PHL A;  3KYQ A;  4HYT B;  1A8C A;  1MUU A;  4AYC A;  1M1K Q;  4UB8 H;  2XKM A;  3H1K G;  3AE3 C;  2Q1K A;  1ZW0 A;  4AUW A;  3CCV P;  1BGY J;  1KB9 I;  1NTK G;  3V4Q A;  1CTJ A;  1KIL E;  1HUC A;  2IZ0 A;  1RE4 A;  4L1Q A;  3DR0 A;  1DW2 A;  5CIG B;  1JDL A;  2BEZ F;  4PV1 C;  1IK7 A;  4Q5P A;  2BCN B;  1NU1 E;  2P1J A;  2C1U A;  1FZB A;  2C9L Y;  1EZV I;  1SQQ J;  1S3J A;  1K04 A;  155C A;  2GM4 A;  1VPC A;  4WQB A;  1KYO H;  3VRD A;  5KKZ B;  4UB6 H;  5AW7 B;  3GMA A;  4JCG A;  4UB8 V;  1M57 D;  5CIH B;  2N9I A;  1L0L J;  2CA3 B;  3HUS B;  1JY3 O;  1S9K E;  2JWA A;  1P84 I;  3H1H J;  4BXL A;  1LP1 A;  2W83 C;  1MFT A;  2NZ2 A;  4OGQ C;  2Q7C A;  2QVA A;  1L2P A;  3B71 A;  3JCU E;  4GOF A;  2H88 C;  1CI6 A;  1ZLL A;  2BGV X;  2DW3 A;  2W6B A;  2G8Y A;  3AE7 C;  3FXD A;  1NU1 D;  3D70 A;  4K35 A;  1R0Q A;  4GT1 A;  3LIE A;  3OJA B;  1RQV A;  4EOT A;  1SFC C;  3OW2 O;  5KAF E;  2OQQ A;  2PGD A;  1OVR A;  3RBX A;  4I7Z C;  4ZKU A;  3TF5 A;  1KB9 H;  1N7S D;  2ZON G;  3O6Q B;  2FFD A;  3WUV A;  1KC8 Q;  1OIP A;  5KLV G;  1S9K D;  2L4D A;  1JY2 N;  4JYB A;  2QJK C;  3SWK A;  3B5N C;  1GZL A;  1HGZ A;  3VMX A;  2PRR A;  1VF5 D;  5AVQ B;  1J1E B;  2QJY B;  1L4A B;  5AW3 B;  2V7Q J;  3L36 A;  2R44 A;  1QEX A;  5AW9 B;  5C0Z A;  3TYY A;  4WQ9 A;  1I55 A;  2Q6Q A;  2WWW A;  4AQR D;  4ZNC A;  2CA4 B;  3L74 J;  1KV4 A;  1BSH A;  2V08 A;  3HD7 A;  3AE2 C;  5KLV K;  3MTU E;  3TGU G;  2Y9Z A;  1AOF A;  3CD6 P;  1HZV A;  5AW6 B;  1FI7 A;  3A9F A;  3VYM A;  3L37 A;  2E76 D;  3II6 A;  5CJ4 A;  1ZP0 C;  1DD4 A;  1GQ1 A;  2AEJ A;  1DEE G;  4C7N A;  2OTL P;  1PP9 G;  3ORV A;  2NPS B;  1HJ3 A;  2WPS A;  2PCC B;  2N1T D;  4XYD B;  5CIE B;  1C6S A;  5EFW B;  4YE1 A;  3CCM P;  4GOE A;  1YFC A;  3RK3 C;  3H1I D;  2WSE J;  3CWB G;  1NJI Q;  5DJU B;  2DVH A;  3BCC E;  1CZQ A;  3TDK A;  1M70 A;  2J59 M;  4AAM A;  1CXC A;  3DMI A;  1U7M A;  3V2R A;  1YTC A;  2IDB A;  1YHQ P;  2MJZ A;  2JQR A;  4D6T J;  4HH2 A;  3G6E P;  3ZOW A;  1CIF A;  3TNU A;  2D0W A;  4NPD A;  3MZW B;  3P7K A;  1KIB A;  4JBZ A;  1AFO A;  4B86 A;  3L70 J;  5GTH H;  5KLI B;  1HJ5 A;  1FBM A;  1IFM A;  1OW6 A;  2I8D A;  4CPG A;  1CSB A;  2B10 B;  1T8Z A;  5B66 V;  1DVH A;  5AW8 B;  1PPJ E;  3PXT A;  1J1D B;  2ZVN B;  1HVV A;  3H1K J;  3VMA A;  3CXH H;  1FZC C;  2OTJ P;  1BGY E;  3A0H E;  2FRC A;  4PW9 B;  2ZT9 C;  2KLV A;  3Q2Y A;  3MIW A;  1VF5 B;  3W67 A;  4DOJ A;  2CPB A;  3CCR P;  4WY4 C;  1NGM B;  1C2N A;  2FXM A;  1X9V A;  4H44 C;  1QL4 A;  3P8M C;  4H0L D;  2N9J A;  5DJQ B;  1AOQ A;  1G2C B;  3D0W A;  1SQQ E;  1ZRT E;  1HZU A;  2I8F A;  4WB4 A;  1H1O A;  4JYC A;  3VTP C;  1LT9 C;  2XZR A;  1HH0 A;  2D0S A;  1L0L E;  2Y0C A;  1PPJ D;  4AAN A;  1IFN A;  3O8Z A;  3RK2 B;  1RE3 C;  5IY5 1;  3H1H E;  1JM0 A;  2B87 A;  2FXO A;  1KYO W;  1JUN A;  3NFQ A;  2FY8 A;  1GTW A;  4OH8 B;  2N18 B;  1Q2N A;  3FWN A;  2FYU D;  3WFC C;  3WU2 H;  1VQ6 P;  1KQS O;  1I8O A;  1KIL C;  1KX2 A;  3B5N A;  2PAC A;  3O5C A;  4N3Y B;  3AEB C;  3B8E B;  2KNC A;  4PJ0 E;  1SQQ D;  5AW5 B;  1ZRT D;  1QVF O;  2FWL A;  1LP1 B;  2BCC G;  1URQ A;  3HQ8 A;  3SLE A;  2WQY C;  1YIJ P;  1CHJ A;  1T2K C;  1NNO A;  1N50 A;  1CI6 B;  4AX3 A;  1HBW A;  3ZCF A;  1HRC A;  3M91 A;  1N7S C;  1NHL A;  4C46 A;  5KLV J;  4Y28 J;  3H1H D;  1YTZ T;  3ABV C;  1RF1 C;  1N73 C;  1FDM A;  2KP8 A;  1CTY A;  2KZI A;  5H2F H;  1L0N K;  2FFD B;  3Q5R A;  2AXT H;  1R8E A;  2AIU A;  1MFZ A;  3NBT A;  3H1L E;  3KZI H;  2WSF J;  1H89 A;  3L74 E;  4DCK A;  2RMZ A;  1USD A;  2E75 C;  4DT0 A;  2JKV A;  4I2L C;  2N3B A;  1UIX A;  2OYI C;  2W27 A;  3D6Z A;  3BVH A;  3F89 A;  1JOC A;  3V6I A;  2Y9Y A;  3TGU J;  2D2C B;  1OW7 A;  2OYO A;  3MD0 A;  2CPS A;  2E76 C;  5DF5 A;  3AEF C;  4WQ8 A;  3CYT I;  3HD7 B;  1N15 A;  1PGP A;  4GDO A;  2SPZ A;  1R5S A;  1HJ0 A;  2KUB A;  1SLQ A;  2N1T C;  3CWB J;  3PTZ A;  3M9H A;  4W80 A;  3V5B A;  4ASW A;  1H31 A;  1LTJ A;  1FZA A;  3AE1 C;  3CMA P;  1OVU A;  2AXT V;  3CP5 A;  3MHV A;  3O0R C;  2QG4 A;  2IBZ E;  1L9B C;  4C7N B;  3OAK A;  4D6T E;  1A56 A;  3IFM A;  3CCJ P;  1DW3 A;  2ITA A;  4WY4 A;  1DEB A;  4EID A;  3KHU A;  1H9X A;  1G1J A;  2O1J A;  3L70 E;  3CXH D;  1OVV A;  2V07 A;  3H1I J;  4PD4 I;  3H1K E;  3CI9 A;  4I6M C;  3H32 A;  3JSV C;  1LTI C;  3CPW O;  3L75 J;  3OA7 A;  4YXD C;  3U1A A;  3OCD A;  3LW5 J;  3A3Y B;  3N4X A;  4I1L A;  2B9B A;  3SWS A;  3TNU B;  4GOD A;  1LT9 A;  1GK4 A;  3B4S A;  5BU8 B;  1C52 A;  5CCG A;  3PP5 A;  3D71 A;  2VRS A;  3GF3 A;  4K3I A;  1JNM A;  1U74 B;  1J2J B;  3SWY A;  2A06 G;  1ZOY C;  1RF0 A;  1NTZ G;  2IBZ D;  4D6T D;  3JC2 2;  4H0L C;  3BRV B;  1NMI A;  3BRT B;  1LTB C;  3AE5 C;  3L72 G;  2AEF A;  4L73 A;  4AAO A;  3L71 G;  1RY3 A;  1KIL A;  1USE A;  2Q3E A;  1DD3 A;  5BU5 A;  2FYZ A;  5KAF H;  1LC2 A;  3H1K D;  1E79 H;  2YIU B;  3ITK A;  2M5A B;  2O3J A;  2KK7 A;  1U7J A;  4IL6 H;  1M1J B;  1NKZ B;  4WWI A;  1A02 F;  3VMY A;  1NTZ K;  1GU2 A;  1HCM A;  4DY9 A;  1YYC A;  1BCC G;  1FAV A;  1M6Z A;  3I5C A;  2O01 H;  2MHM A;  3TYI A;  1PIX A;  4PD4 H;  3FWL A;  1FJK A;  1GW3 A;  2B87 B;  1AV1 A;  3CX5 W;  1Y8A A;  2POH A;  1YBK A;  2OZ1 A;  1L0N J;  2LXB A;  2KI7 B;  4FAN A;  3WFE C;  3CL3 D;  1GU5 A;  1C7M A;  1L4A D;  1CXA A;  5KAF V;  1G1I A;  3CCQ P;  5AW2 B;  1YJW P;  2QJK B;  2FYU J;  1YJN P;  1FOS E;  3MGN A;  5KLV E;  1CSV A;  5APW A;  2KNC B;  3AEA C;  1H33 A;  4K3A A;  2C9X B;  2OYI A;  5CBN A;  4IL6 V;  2E42 A;  1JY3 N;  1URQ B;  4L74 A;  1H0T A;  3A7O A;  5CYT R;  3MK7 C;  2CK3 H;  2YO2 A;  3A0B E;  4W7Y A;  5AVY B;  1YIQ A;  2E74 C;  1EC5 A;  5AW0 B;  1FJP A;  1FHB A;  3AEC C;  2OAR A;  3WMM 0;  1GL2 C;  1GDT A;  2UWJ E;  2HV4 A;  2ORL A;  1NTK K;  1I54 A;  2NPS D;  2N3Y A;  3VYI A;  3CLQ A;  2GC7 D;  1VQM P;  2WZ7 A;  5KJ7 D;  2O1K A;  4H0J A;  2YMY A;  2BPB B;  3TGU E;  5K5G B;  1ZXG A;  1IZL 0;  2K3R A;  3IAO A;  1CYC A;  1Q81 Q;  3W68 A;  2C9N Y;  4EIE A;  3A5T A;  5KLV D;  3IN6 A;  1NAF A;  4EIC A;  1WT6 A;  5CCH D;  2Z4E A;  2OYH C;  4H13 D;  2JR8 A;  1VQ4 P;  4O9B A;  5L8R J;  1QLE D;  5CMZ A;  1M90 Q;  4FA1 A;  3A2A A;  1K9M Q;  1F1F A;  3EQ2 A;  2LIT A;  3ZDM A;  3NMD A;  1FZE A;  3M0A A;  1DX7 A;  1YQ3 C;  1PV3 A;  2HG5 D;  1I6D A;  1Q90 D;  4IFF A;  2V4H A;  1XTG B;  1EB7 A;  1SQX G;  2WSC H;  3L73 G;  3IF4 A;  3TGU D;  1MV8 A;  3H1I E;  1OZH A;  2B0Z B;  1H31 B;  1CSW A;  1LTJ B;  3AEG C;  4FA9 A;  1WVE C;  3L75 E;  3S9O A;  2FKW B;  1VQ5 P;  2ZT9 B;  1NU1 G;  1UII A;  4IFM A;  1AKK A;  5CHX A;  2AXC A;  4WQA A;  1LNQ A;  4UB8 E;  4WY4 B;  2IPP A;  3CWB D;  1CYJ A;  4MU8 A;  2BH4 X;  5AVX B;  1T6A A;  1BDD A;  3VNW A;  2K1A A;  1P84 H;  1KZU B;  2M8R A;  2WVR A;  2P2U A;  2PFX A;  1JY2 O;  5KKZ C;  2K9J B;  1SQX K;  1NVO A;  3AED C;  5B66 H;  1NTZ J;  2WT7 A;  5E79 H;  3RK2 D;  1M56 D;  1SQB G;  3PXW A;  4QMA A;  3KQG A;  3FX0 A;  3L71 J;  3O20 A;  3UIA A;  1BE3 J;  2QE7 H;  2LIR A;  1NU1 K;  1SS1 A;  1FI3 A;  4KHX A;  3GHG B;  3L75 D;  3E7K A;  4QAO A;  2ZXE B;  2HOD A;  3CX5 I;  2LKM A;  4L76 A;  3WUU A;  4UB6 E;  1N86 A;  2P10 A;  3EWK A;  4ASV A;  4H13 B;  1N2D C;  3PH0 A;  4JF7 A;  3EFG A;  2ZYD A;  4U3F J;  1KFN A;  1KIL B;  2BEQ D;  1Y47 A;  3E1R A;  1AYG A;  1HJ4 A;  1SQB K;  1HWT C;  2ZFC A;  1IFJ A;  1CRG A;  2PP6 A;  1N9C A;  3O1Y A;  1MG3 D;  5E79 V;  1HJB A;  1EDJ A;  4IOI H;  4A7P A;  1MZ9 A;  5GTI E;  2E5T A;  1L0N E;  1DT1 A;  4PJ0 V;  2W8Z A;  1VQ9 P;  1NTK J;  1GL2 A;  3RL0 D;  1J1E C;  3GG2 A;  2FYU E;  1L4A C;  1CSX A;  2M0B A;  1KYO D;  3Q1M A;  2H43 A;  2WPQ A;  2B11 B;  1IFD A;  1KB9 E;  2ZBO A;  3M06 A;  2OZ1 B;  5APX A;  1GIW A;  5B5E H;  3CCS P;  2B4Z A;  1S5L H;  1NTM G;  2R3C A;  1SQP G;  1NH4 A;  2D2C D;  1QKS A;  5APV A;  2PCB B;  1RQU A;  3PLN A;  3AEE C;  1EXI A;  2LR2 A;  3M0D C;  5B6Q A;  2OYH A;  1KV9 A;  1YJ9 P;  2A45 G;  1X79 B;  2E75 B;  2N9B A;  1H33 B;  1SFC A;  1EZV E;  2OYI B;  451C A;  3H6P A;  3EFF K;  1L0N D;  2BCC D;  1H0T B;  1COR A;  4N0K A;  3R4Y A;  2I1K A;  3CX5 H;  3HD7 D;  2NPS C;  2W6A A;  3CCU P;  2XV5 A;  4O1W A;  1LWU C;  2FBW C;  1PL5 A;  3BCC G;  5KAI H;  2VHD A;  4YPC A;  1FCD C;  3SXT A;  1W2L A;  1NTM K;  3G71 P;  1BDC A;  1SQP K;  2JO1 A;  3SFE C;  1KB9 D;  4L3G A;  2J5U A;  1Q86 Q;  1JY3 P;  5B5E V;  1S5L V;  4WQC A;  3M9Q A;  2GC4 D;  4U7J A;  3AE9 C;  4GED B;  1N90 A;  3NXS A;  5KLI C;  2GIW A;  2DGE A;  5AUR A;  1OCD A;  1QVG O;  3RN0 A;  1EZV D;  1BGY G;  5TIS E;  1SQX J;  3F5H A;  5APT A;  3L73 J;  1VQN P;  5KAI V;  1VF5 C;  2IFM A;  4PV1 D;  3RL0 B;  3HQ6 A;  1IC2 A;  2QJP C;  1EDL A;  1P84 D;  1J3S A;  1IO4 A;  5GTH E;  2KB7 P;  1DII C;  2QRX A;  2B89 A;  3C8V A;  2YCC A;  2MTA C;  4H0K A;  1KFM A;  4EYY Q;  1LT1 A;  2Y0D A;  4Z1M H;  3CXH E;  3V2P A;  2HFE D;  1CC5 A;  1L0L G;  1KQG B;  4GKG A;  2BLF B;  3P8C D;  4RES B;  1CRH A;  3CC4 P;  2W90 A;  3KXD A;  3H1H G;  1EQ7 A;  1IK9 A;  3VP8 A;  1NKN A;  1SQB J;  1PP9 J;  3PH2 B;  3RK2 C;  2FXP A;  5CJ0 A;  1BE3 E;  4EIJ A;  1JMM A;  3CCE P;  1W5C E;  3U1C A;  1JTH A;  2N18 C;  1NIR A;  1FZC A;  1PFI A;  5CIF B;  1F1C A;  4GYD A;  2K9Y A;  2IYP A;  3RGU A;  3SFD C;  1KQF B;  2ZZS 1;  1H32 A;  1E8E A;  2JJL A;  3H1J G;  1L0L K;  4BWN A;  1FI9 A;  4U3F E;  3FGA D;  1JEK A;  1GU4 A;  351C A;  4DJG A;  1I5T A;  1TU3 F;  3N7N A;  1M60 A;  4YTP C;  1LS9 A;  3SWF A;  1NTZ D;  3B5N D;  2KXP B;  1QL1 A;  3ZOX A;  2C0W A;  4XFJ A;  4LGD E;  3A0B H;  5AVT B;  4JPZ B;  4TT3 H;  1PGQ A;  3VMZ A;  3L72 D;  2JDI H;  1E5W A;  2Y0E A;  3L71 D;  1SQV G;  1URQ D;  2J58 A;  3BAS A;  3WU2 E;  1PZQ A;  1VYD A;  2XND H;  2WSF H;  1COT A;  1NTK E;  1BE3 D;  2O01 J;  3M0D A;  3WFD C;  2RKL A;  1WRG A;  2QIW A;  1NML A;  1W5C T;  4PV1 B;  1QL2 A;  1RE3 A;  3H1L G;  1CTZ A;  2JEE A;  3T97 A;  2FFD C;  5AVS B;  3SJL A;  1RH5 B;  2R5B A;  2A45 I;  2Q5U A;  1IQC A;  3L74 G;  3JCU H;  2YQB A;  1LWU A;  1OFC X;  1K05 A;  4U3F D;  1OWA A;  2ZAE B;  2YKO A;  4BRY A;  1GL2 B;  1NTM J;  4FA4 A;  4FA5 A;  1SQP J;  1OXZ A;  4WQE A;  2M3E A;  1FOC A;  1SQV K;  2C1D A;  3A0B V;  2CE1 A;  2QA4 P;  1C6O A;  5H2F E;  1LTA C;  1K3H A;  1YIT P;  2XNX A;  4OGQ B;  1NTK D;  2AXT E;  2KOG A;  3HQ9 A;  3MUD C;  3QH9 A;  2YK3 A;  3HD7 C;  3KZI E;  5AVZ B;  2M3B A;  5DFS A;  1N7S A;  2IFN A;  2OYH B;  1HGV A;  3C2C A;  5APU A;  1GD2 E;  1SFC B;  3NBS A;  1RF1 A;  1N73 A;  1PGO A;  1W2B O;  1EDI A;  1K73 Q;  1S6V B;  2E43 A;  1Q7Y Q;  2YKQ A;  4I7Z B;  1ETP A;  3L70 G;  2BCC J;  4HB1 A;  2I1J A;  4DZO A;  2OTK E;  3TSI A;  1NOH A;  1YNR A;  1H9Y A;  1YI2 P;  2XTS B;  1FE6 A;  2AEM A;  3B5N B;  4J20 A;  1JO5 A;  2ZT9 D;  1G2C A;  1AJY A;  2FYN C;  4N6J A;  2YNY A;  3ZIY A;  4O1Q A;  1SQX E;  4WY4 D;  5EXQ A;  1KN7 A;  1AVY A;  3L73 E;  2A45 H;  4XE5 B;  2R32 A;  4H44 D;  4MN4 C;  4YXW H;  5AVV B;  2GB8 B;  1X8Y A;  2CXB A;  1LTS C;  4IFD K;  4RKU J;  4KMG A;  3HE4 A;  1WEJ F;  1H8A A;  2WSC J;  2B88 A;  4Y99 C;  3D6Y A;  1YTZ I;  3JBT B;  4R4M A;  2N1T A;  1VDF A;  1RAQ A;  3S4R A;  3MP7 B;  1M7L A;  4NPF X;  4XXL A;  5CCG D;  2JWD A;  1CRC A;  1CO6 A;  1FZF A;  1KTM A;  1XTC C;  2C2C A;  1KQL A;  3V2Q A;  4NFG B;  1SP4 A;  1LGH B;  3OA8 A;  1RZ5 A;  4WQ7 A;  1SQB E;  1PP9 E;  3RK3 B;  3H25 A;  2ZXY A;  1FOS F;  2BAS A;  4L75 A;  2YIU C;  1SQX D;  3L73 D;  2LXC B;  1KIL D;  1C75 A;  1GMJ A;  1M1J C;  3CWB E;  4N78 E;  5APS A;  5GTI H;  1KOR A;  3A0H H;  4V2K A;  4P4Q B;  1LTG C;  2ZXX A;  4WQD A;  1S1C X;  2R5D A;  2IX7 C;  4L3H A;  2JP3 A;  2JTI B;  1C6R A;  2IZ1 A;  1CRJ A;  2HLO A;  1CRI A;  2O01 N;  1B7V A;  2H8P D;  3H1J J;  5AVU B;  3AE8 C;  1T2K D;  1OAE A;  4UB6 V;  1DW0 A;  2KSE A;  1JTH B;  3G3Z A;  3ZOY A;  4KT0 J;  1T3J A;  4IL6 E;  3HTK A;  4TLF A;  1FZC B;  3L4F A;  1BL9 A;  1ZN5 A;  1KB0 A;  2C1V A;  1H32 B;  1SQB D;  1PP9 D;  1VQ8 P;  1GDV A;  1OW8 A;  1WMK A;  1I8P A;  1SQV J;  3VP9 A;  1AVO A;  2WIT A;  1KX7 A;  4N78 D;  1URQ C;  5GTI V;  3A0H V;  4H44 B;  4PD4 E;  1A2S A;  3CXH I; 
#chains in the Genus database with same CATH homology
 1L0N D;  2BCC D;  2AXT V;  1COR A;  3CP5 A;  4N0K A;  3O0R C;  2QG4 A;  4O1W A;  1L9B C;  1CTJ A;  1A56 A;  3OCD B;  3L4M A;  1DW3 A;  1HRO A;  2VHD A;  2KS1 A;  4L1Q A;  4EID A;  3KHU A;  1H9X A;  3DR0 A;  1DW2 A;  3PRJ A;  1FCD C;  1JDL A;  5CIG B;  3CXH D;  3SXT A;  1W2L A;  4Q5P A;  2V07 A;  1KB9 D;  2BCN B;  4L3G A;  2C1U A;  5B5E V;  1CNO A;  155C A;  1S5L V;  4Y5R A;  4WQC A;  1E29 A;  2L91 A;  4WQB A;  2GC4 D;  3VRD A;  5KKZ B;  3OCD A;  1QYZ A;  4GED B;  3X39 A;  1N90 A;  4JCG A;  4UB8 V;  5CIH B;  3SWS A;  2N9I A;  3RN1 A;  2CA3 B;  2GIW A;  2DGE A;  3CU4 A;  1CSU A;  4PD4 D;  4RSZ A;  1C52 A;  1OCD A;  5AUR A;  3RN0 A;  3SVW A;  1EZV D;  2JWA A;  4K3I A;  1U74 B;  2C1D B;  2CE0 A;  2IBZ D;  4LJI A;  4D6T D;  3L4O A;  1ZZH A;  5KAI V;  1NMI A;  3DP5 A;  1RAP A;  1GKS A;  3HQ6 A;  4FB1 A;  4AAO A;  1NTM D;  2BGV X;  3RMZ A;  1SQP D;  1P84 D;  2Q3E A;  1MZ4 A;  2B12 B;  1J3S A;  1NU1 D;  1R0Q A;  1DII C;  1LC2 A;  3H1K D;  1CIE A;  2YCC A;  2MTA C;  4H0K A;  1E2R A;  2AI5 A;  2YIU B;  2Y0D A;  3ITK A;  3TF5 A;  1CC5 A;  2ZON G;  2O3J A;  3WUI A;  2BLF B;  3PXS A;  1CIG A;  1CRH A;  1GU2 A;  1MG2 D;  1HCM A;  2L4D A;  4DY9 A;  3BCC D;  2QJP B;  5TIS V;  1M6Z A;  1IRW A;  2MHM A;  3PH2 B;  3TYI A;  1CHI A;  2QJY B;  3FWL A;  3CX5 W;  1HH7 A;  2N18 C;  5C0Z A;  1NIR A;  2OZ1 A;  4WQ9 A;  5CIF B;  1F1C A;  4GYD A;  1DIQ C;  5GTH V;  4FAN A;  3WFE C;  1I55 A;  1I6E A;  1C7M A;  1CXA A;  5KAF V;  2ZZS 1;  1H32 A;  1E8E A;  3M97 X;  2CA4 B;  1FI9 A;  1C2R A;  2QJK B;  2V08 A;  351C A;  1K3G A;  1CSV A;  1I5T A;  1BGY D;  2KNC B;  1H33 A;  1YIC A;  5C9M A;  4EDF A;  1M60 A;  2C9X B;  1U75 B;  4IL6 V;  1LS9 A;  1AOF A;  3WC8 A;  1HZV A;  1FI7 A;  3A9F A;  1LMS A;  3VYM A;  3RLM A;  1NTZ D;  5CYT R;  3MK7 C;  1CHH A;  1GQ1 A;  3ZOX A;  1YIQ A;  3ORV A;  3L72 D;  1HJ3 A;  2PCC B;  1FHB A;  3L71 D;  2C8S A;  2Y0E A;  4XYD B;  5CIE B;  1VYD A;  1C6S A;  4YE1 A;  1COT A;  1YFC A;  1BE3 D;  3H1I D;  2HV4 A;  1CIH A;  2ORL A;  3OA8 B;  1I54 A;  2DVH A;  3WFD C;  2N3Y A;  1NML A;  1IO3 A;  2GC7 D;  1W5C T;  3TDK A;  1M70 A;  4AAM A;  1CXC A;  4FAV A;  3DMI A;  4H0J A;  1CTZ A;  2BPB B;  1YTC A;  1IZL 0;  3SJL A;  2JQR A;  1IQC A;  1L0L D;  1CYC A;  2YQB A;  3ZOW A;  4U3F D;  4EIE A;  1CIF A;  2D0W A;  5KLV D;  1KIB A;  4EIC A;  1DVV A;  1CYI A;  4FA4 A;  4FA5 A;  5KLI B;  1HJ5 A;  1YCC A;  4WQE A;  5DJQ C;  1FOC A;  2B10 B;  5B66 V;  1DVH A;  3PXT A;  2C1D A;  3A0B V;  2CE1 A;  3WFB C;  3VMA A;  1C6O A;  3WU2 V;  4FA1 A;  4EIF A;  1F1F A;  1LFM A;  2FRC A;  2LIT A;  1K3H A;  4PW9 B;  1NTK D;  3HQ9 A;  1I6D A;  4RJT A;  2YK3 A;  3H1J D;  1RZ6 A;  1QL3 A;  2RN0 A;  1EB7 A;  5DFS A;  1C2N A;  1QL4 A;  2N9J A;  5DJQ B;  3C2C A;  3TGU D;  1AOQ A;  3NBS A;  2B0Z B;  1H31 B;  1CSW A;  1S6V B;  1HZU A;  4FA9 A;  2I8F A;  1L9J C;  1WVE C;  1ETP A;  1FJ0 A;  1CED A;  1IRV A;  1CCR A;  1H1O A;  4PWA A;  1SQV D;  2D0S A;  1AKK A;  5CIB B;  4WQA A;  4AAL A;  1PPJ D;  1YNR A;  2Y0C A;  4AAN A;  1H9Y A;  5H2F V;  2XTS B;  3CWB D;  1CYJ A;  4MU8 A;  2BH4 X;  4J20 A;  3ZOO A;  3VNW A;  5IY5 1;  3ZIY A;  4O1Q A;  2K9J B;  1KYO W;  2A06 D;  5EXQ A;  3GW6 A;  3H1L D;  3KZI V;  1YEA A;  2GB8 B;  2N18 B;  3L74 D;  3NWV A;  2FYU D;  3WFC C;  1YEB A;  2CXB A;  5CIC B;  1I8O A;  1QN2 A;  1KX2 A;  3PXW A;  4KMG A;  3O20 A;  2PAC A;  1WEJ F;  3O5C A;  2LIR A;  1FI3 A;  1SQQ D;  1ZRT D;  2FWL A;  3L75 D;  2FYN B;  3JBT B;  1RAQ A;  3HQ8 A;  3SLE A;  4QAO A;  4XXL A;  1CRC A;  1CO6 A;  1CHJ A;  3MK7 B;  1NNO A;  2C2C A;  1N50 A;  4AX3 A;  4NFG B;  3ZCF A;  1HRC A;  3OA8 A;  1RZ5 A;  1BCC D;  3H1H D;  1AYG A;  1HJ4 A;  4WQ7 A;  2ZXY A;  1SQX D;  1CTY A;  3CXH W;  3CX5 D;  1CRG A;  3L73 D;  2BH5 X;  1C75 A;  1N9C A;  3O1Y A;  1CCH A;  1MG3 D;  5E79 V;  1CRY A;  4V2K A;  4A7P A;  4P4Q B;  5TJH A;  1LC1 A;  4WQD A;  1DT1 A;  3L70 D;  4L3H A;  4PJ0 V;  2AIU A;  3NBT A;  3HQ7 A;  2JTI B;  1C6R A;  1CRJ A;  3GG2 A;  1CRI A;  1B7V A;  3ZBM A;  2RMZ A;  2EXV A;  2N3B A;  1CSX A;  1OAE A;  1KYO D;  4UB6 V;  1DW0 A;  1GJQ A;  5CID B;  2B11 B;  2ZBO A;  2ZOO A;  3ZOY A;  2OZ1 B;  1GIW A;  2B4Z A;  2N9Y B;  1DW1 A;  1BL9 A;  1KB0 A;  3PHL A;  2C1V A;  5DF5 A;  1H32 B;  1SQB D;  1PP9 D;  1QKS A;  4WQ8 A;  2PCB B;  1A8C A;  3PLN A;  1GDV A;  3CYT I;  1I8P A;  1N15 A;  5B6Q A;  1KV9 A;  1KX7 A;  5GTI V;  3A0H V;  3PTZ A;  1H33 B;  451C A;  1H31 A;  1A2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...