2IBZD

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2ibzD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2ibzD02
1ZRTD 1NMIA 5CIFB 5CIBB 1IQCA 4EIEA 451CA 5E79V 5GTHV 1DW3A 5B5EV 1CC5A 1GJQA 4H0JA 1C52A 5DJQB 2DVHA 2XTSB 5KKZB 3ORVA 1S5LV 1CXAA 4WQBA 4L1QA 1CYIA 1HH7A 2C1VA 2C2CA 4XXLA 4WQ7A 1WEJF 3DR0A 1FOCA 1A8CA 1KYOW 2C9XB 2BCCD 2C1UA 1CIGA 4WQCA 1H9YA 3O5CA 1I8PA 4V2KA 4YE1A 5C0ZA 1CTZA 3CX5W 1OAEA 3H1KD 5B6QA 4FA1A 1LS9A 4PWAA 3CXHD 4AAOA 1GDVA 3TF5A 3CWBD 1VYDA 1RAQA 1M70A 4FANA 1M6ZA 1YCCA 2HV4A 2N3BA 3PXTA 1H9XA 1RAPA 3SXTA 3PTZA 1HJ3A 3VMAA 1NMLA 1CYJA 4WQDA 3ZCFA 4WQAA 2YQBA 1F1CA 3PRJA 2L4DA 2B0ZB 4PW9B 1GKSA 1PP9D 1W5CT 3OCDB 1KB0A 1C6OA 1YEBA 1C6SA 4AAMA 1U74B 5IY51 1AYGA 3KHUA 4FA5A 1N50A 2Y0EA 1DW0A 1N90A 1DVVA 2L91A 2LIRA 4O1QA 4Q5PA 1I6DA 5KLIB 3WFEC 1CSVA 2LITA 1CXCA 5CIEB 1IO3A 3O0RC 1YFCA 2AI5A 3M97X 3ZOOA 1NTKD 1MZ4A 2C8SA 4J20A 1FHBA 1A2SA 3A0BV 3L4MA 2JWAA 3HQ9A 3TDKA 1SQXD 5TISV 3OA8A 2RN0A 3SWSA 1CORA 1GIWA 3VRDA 1H1OA 1CCHA 3JBTB 5KLVD 3CX5D 2JTIB 2CE0A 1ETPA 1L9JC 1YEAA 4FB1A 1GQ1A 1CEDA 1AOQA 1L0ND 3WFBC 1FCDC 2C1DB 3FWLA 3WU2V 4H0KA 4AALA 1HZUA 4K3IA 1YNRA 3SVWA 1DIIC 4IL6V 1E8EA 2OZ1B 2N18C 3ZIYA 1KB9D 4EIFA 1CHHA 1CHJA 1MG3D 2FYUD 1BL9A 1COTA 4AX3A 1YTCA 1L0LD 1JDLA 1OCDA 3O1YA 5TJHA 2GB8B 1DW1A 3CU4A 1NU1D 1BCCD 4U3FD 3RN1A 2EXVA 2PCBB 1IRWA 2V07A 3BCCD 4XYDB 4FAVA 4MU8A 1CNOA 3ITKA 5AURA 1QN2A 1U75B 2DGEA 5CIHB 5B66V 1K3GA 1E2RA 1H32A 2GC7D 1KIBA 5CYTR 1FJ0A 1PPJD 1H31B 3L73D 4EICA 1CRJA 2D0WA 1I5TA 2PACA 1KX2A 2MHMA 2FRCA 2BPBB 4EDFA 2ZXYA 3PH2B 2D0SA 2CXBA 3ZOXA 1AKKA 4DY9A 1E29A 1CIEA 1DT1A 3L70D 4NFGB 2N18B 4EIDA 3RMZA 1HRCA 3ZOWA 1LC1A 3RN0A 1B7VA 1LMSA 2VHDA 2KNCB 3MK7C 2FYNB 1BE3D 2ZBOA 2GIWA 351CA 2FWLA 4PD4D 3A9FA 1KYOD 5C9MA 1C2NA 3MK7B 3NBTA 2MTAC 1QKSA 1GU2A 3L4OA 2QG4A 1FI7A 1QL3A 3WC8A 3PXWA 1CSWA 5CIGB 1CRCA 1CIFA 1NTZD 3TGUD 1YICA 1CRGA 2ZOOA 2BH5X 3DMIA 2ZONG 1F1FA 3KZIV 3PHLA 3HQ7A 2K9JB 2AIUA 4RSZA 4O1WA 1P84D 5GTIV 1W2LA 2B10B 2QJYB 3WFCC 1C7MA 2V08A 4GYDA 1EZVD 1HZVA 3L71D 1NIRA 3CP5A 2B12B 1NNOA 4AANA 1CTJA 5DJQC 4GEDB 4WQ8A 1N9CA 2Y0CA 4L3HA 2BLFB 3H1LD 1FI9A 1ZZHA 1J3SA 1C75A 2N3YA 2N9YB 2QJPB 3PLNA 3SLEA 2JQRA 1KV9A 2BGVX 3OCDA 1HJ4A 1KX7A 1IRVA 2YK3A 2IBZD 1I8OA 1CYCA 3X39A 5H2FV 1H33B 1YIQA 1HROA 2ORLA 1CIHA 3GG2A 4P4QB 3ZOYA 2O3JA 3VNWA 2A06D 4LJIA 2QJKB 1NTMD 4FA9A 4RJTA 1DVHA 1H33A 3C2CA 4UB6V 2YIUB 1WVEC 1DIQC 1A56A 4WQEA 1SQBD 1SQQD 3GW6A 3H1HD 2GC4D 2BH4X 2ZZS1 1IZL0 3OA8B 1HCMA 1K3HA 3VYMA 3CXHW 1H31A 2B4ZA 2CE1A 5CIDB 2B11B 4L3GA 5DF5A 2C1DA 1BGYD 1S6VB 2CA4B 3O20A 1CHIA 1L9BC 4N0KA 5DFSA 3L75D 2OZ1A 5CICB 1QL4A 2N9IA 2Q3EA 1DW2A 1LFMA 1EB7A 1CRYA 4Y5RA 3NWVA 2KS1A 2BCNB 155CA 3H1JD 1RZ6A 1CTYA 2AXTV 1LC2A 3SJLA 3WFDC 4WQ9A 3A0HV 1SQPD 1C2RA 5EXQA 1CRHA 3NBSA 3CYTI 3L74D 2I8FA 3RLMA 5KAFV 1HJ5A 2N9JA 1CRIA 4JCGA 4PJ0V 2RMZA 1C6RA 1I54A 1R0QA 3HQ8A 1M60A 4D6TD 1RZ5A 3DP5A 4A7PA 3H1ID 1QYZA 4UB8V 1CSXA 2CA3B 3PXSA 4KMGA 3TYIA 1H32B 1SQVD 3HQ6A 5KAIV 2PCCB 1I6EA 2Y0DA 1CSUA 1MG2D 4QAOA 4FA4A 1I55A 3ZBMA 1FI3A 2YCCA 1AOFA 1CO6A 1CCRA 3WUIA 3L72D 1N15A
chains in the Genus database with same CATH superfamily
5KJ7C 1H8AA 451CA 1DW3A 1CC5A 1L2PA 1C52A 2K1AA 3RK2C 1T2KD 3ORVA 3M91A 4EIJA 3L72E 5B66E 3KQGA 1M56D 3L75J 4L1QA 1CYIA 4WQ7A 1EC5A 1RE4A 2HR3A 1BGYE 1GL2D 1IFJA 4Z1MH 3CCQP 2C9XB 1L0NG 4WQCA 2B87B 4YE1A 1N2DC 1LS9A 3W68A 5AW2B 1CSBA 3L71G 1M70A 1YCCA 5AVSB 4JQ0D 1JY3P 4L76A 3PXTA 1H9XA 2OGUA 3OW2O 1NO4A 4U3FE 3PTZA 3CLQA 1CYJA 2P67A 1DD4A 4I6MC 1BE3G 4H0LC 1OVVA 3M0DA 1EZVI 1YEBA 2WMMA 4DT0A 3KPEA 1H0TA 1N50A 2FKWB 1SQBJ 2L91A 1JY2P 3B71A 4B86A 3AEFC 1YTZI 2M8RA 1L4AA 2IX7C 3KDPB 1NOHA 2M5AB 3WFEC 2IYOA 1HJBA 1CXCA 1SQXE 2O01J 5CIEB 1SFCD 3CCMP 3KZIE 3ZOOA 4N78E 4J20A 1BGYG 2IBZE 2IFMA 3HUSB 4DZOA 2M5AA 4C7RA 3L4MA 2BCCG 1P84H 3N7NA 3TDKA 5KAFH 5TISV 1PZQA 1VF5B 1LTIC 3ABVC 2YIUC 1NTKE 3G3ZA 4H13D 1SQPE 3NTNA 3HUSA 2CE0A 1FU1A 1K05A 3TSIA 3RBXA 5CCGD 3A2AA 1FCDC 3G71P 2FYNC 4H0KA 1YYCA 1HZUA 1LTGC 1DIIC 4IL6V 1UIIA 1E8EA 2K3RA 2N18C 1PGQA 4GIFA 3ZIYA 3D6ZA 3CCEP 1SQQG 2D2CC 5KLIC 3RK2D 1T2KC 1WRGA 2YXQB 3S9OA 2QRXA 2FYUD 3CPWO 1L0LD 1ZV8A 1OCDA 1R5LA 2GB8B 3AECC 1DW1A 1GU5A 2E76C 1NU1D 3CCLP 4U3FD 1AA0A 2IDBA 3RN1A 1LWUA 1QX8A 2EXVA 2JKVA 3BVHA 4BWNA 1IRWA 4JBZA 1FE6A 1URQB 3F89A 3L75E 1CNOA 1N7SA 3ITKA 1QN2A 3JCUH 2C9LY 2YKQA 1U75B 3L73E 1K3GA 2IBZG 1FJ0A 1PPJD 1NTZG 3TNUB 4EICA 3RGUA 1KX2A 2XU6A 5AW1B 4WBAA 4EDFA 2G3AA 1CZQA 3PH2B 2D0SA 2CXBA 1FAVA 1AKKA 1LTJA 2IPPA 3PP5A 1E29A 1M1KQ 1HTLC 3RMZA 5AVQB 1G1JA 2OYOA 1LMSA 2KNCB 1BE3D 351CA 4PD4D 5CCGA 3A9FA 3VYIA 1KYOD 3U1CA 5B5EE 3MK7B 1L0LE 2AXCA 2MTAC 3L71E 2C9NY 1GU2A 1FI7A 1SLQA 2D2CD 2ZJSE 3MZWB 5B66H 4OWFA 3KXDA 3BASA 3A0HH 2ZOOA 1S5LH 1MV8A 5AW4B 4N6JA 1S1CX 3UIAA 2K9JB 3H1HE 4H13C 3BRVB 1SQQJ 3L74E 2PFXA 2CK3H 2FXPA 3JSVC 4TLFA 1AVOA 1C7MA 2K37A 3O6QB 1IJDB 2V7QJ 1NNOA 1YJWP 1JY2O 1BE3J 3V2RA 4WQ8A 2Y0CA 2W6BA 1FI9A 1Z56A 4W80A 2N9YB 2AEMA 1FZCC 1HUCA 3OCDA 3V4QA 3N4XA 2YO3A 1S3JA 5AW0B 3AE8C 1K9MQ 5H2FV 1YQ3C 3HE4B 2A06G 1RF1B 1YIQA 1NTKK 1HROA 2FYUE 4O9BA 1YI2P 1JO5A 2P7JA 1ZLLA 2A06D 1VQPP 2FFDB 1YHQP 1NTMD 1VQ6P 4FA9A 1HF9A 2ZYAA 4PV1D 5GTIE 4R4LA 1H33A 2MKVA 1NU1G 3C2CA 3MD0A 1WVEC 4Y28J 3VMZA 3HUSC 1N7SB 3HTKA 1SQBD 2BH4X 1IZL0 5AVZB 1EZVE 3EFFK 1K3HA 4M3LA 1VQMP 2B4ZA 3M9BA 3Q5PA 3TNUA 3IF4A 3AE5C 2CE1A 1BDDA 5CIDB 1GL2B 5APUA 3H25A 1SQXK 5APTA 5DF5A 3QH9A 2L5GB 2CA4B 3O20A 5CCHD 3II6A 3L71J 5CICB 2Q3EA 5C39A 2KI7B 3WUTA 2Z5HA 1CRYA 5CBNA 3VP8A 3JC22 1MFTA 3D0WA 2E76D 1NTZK 1CTYA 1IFPA 1LNQA 3GF7A 1VQ9P 1JTHB 4WQ9A 1IFIA 1H88A 1VQNP 4OGQD 2I8FA 3AE9C 2KK7A 1HJ5A 1R0QA 4A7PA 3P8CE 1LT9B 2W90A 2A45G 2OYIC 1QYZA 1L0NJ 3TYIA 1H32B 2R3CA 1N73A 5KAIV 2N1TD 2K9JA 2R5DA 2NPSD 1BDCA 1I55A 1RQVA 3O6QA 1NH4A 1CCRA 3WUIA 1N15A 5AW5B 1H89A 1KYOI 1N73B 3F5HA 3RK3D 4EIEA 2QJYC 3ZDMA 5E79V 5GTHV 5B5EV 2WPRA 2YNYA 1GJQA 1JCDA 4H0JA 2DVHA 3RK3E 3RK2B 2YMYA 2KYVA 2I1KA 5DJTB 3S4RA 4WQBA 4IL6H 3B8EB 1ZOYC 1HH7A 3G9RA 2C2CA 4XXLA 1L4AC 1KYOH 1FOCA 1KYOW 1SQPK 1LGHB 1FJKA 1W5CE 1A02J 4V2KA 1VF5D 5C0ZA 3AE1C 1XTCC 2LKMA 4IFMA 1FBMA 1SQVE 4H0LD 3TF5A 1GDVA 1N7LA 4FANA 1ZP0C 3V6IA 1ZXGA 2HV4A 1KFMA 5BVZA 3HD7B 1FC2C 2H88C 4I1LA 5TISH 3VMAA 3L70G 2J58A 3RL0C 4WQAA 1F1CA 2GUVA 1KB9I 2L4DA 1YTZT 2B0ZB 2ZT9C 1GL2A 2QEXP 4WY4D 3HD7A 2YKOA 2WQYC 5AVUB 1IFMA 1M57D 2J5UA 2YXRB 3H32B 3SSUA 4DCKA 1C6OA 1L0LJ 4WVZA 1SP4A 2Y0EA 1DW0A 1EZVG 5KKZC 1DX7A 1E5WA 2LIRA 1GU4A 1NU1J 1GL2C 2YMKA 4Q5PA 1KILA 3NXSA 1CSVA 2LITA 1EDIA 2W6AA 4K3AA 5APVA 2FYZA 3Q3DA 3OAKA 1ZR2A 2I1JA 1MZ4A 4JYCA 2FY8A 2YKPA 1A2SA 3A0BV 3HQ9A 1N7SC 3HD7D 2RN0A 5KJ7D 4PD4I 1CORA 2WPSA 1GIWA 3VRDA 3FWNA 3H1JG 5KLVD 2JTIB 1L9JC 2P58A 4FB1A 1GQ1A 1CEDA 1L0ND 4AALA 5KLVG 2W27A 4K3IA 3SVWA 3RBZA 3H1IG 4EIFA 2PRRA 1P84I 2P2UA 4AX3A 3D71A 4IL6X 1J1EC 4WB4A 3HE5A 2NZ2A 2KIKA 4KJMA 2WSFJ 1YBKA 4EOTA 1AVYA 3B5ND 3I56P 1AFOA 3L72J 3CCSP 1NAYA 2JEEA 2ZT9B 4L73A 4MU8A 3GHGB 4IOIH 1FDMA 1X9VA 3USSA 5AURA 2DGEA 5CIHB 1KIBA 1MFZA 3AEBC 2W6JH 4H13B 3L73D 1PGOA 2G8YA 4EYYQ 3CCVP 3MGNA 1NU1K 2MHMA 2FRCA 2AEJA 1D7MA 3C9IA 4EI2A 4NPDA 4DY9A 2JJLA 1CIEA 1YIJP 2WSEH 3L70D 4Y99C 1RY3A 4EIDA 3MTUE 1M8OB 2NRGA 3RN0A 2VHDA 2QE7H 3MK7C 2KS1B 1NWQA 2GIWA 2FWLA 4UB6E 5C9MA 4QMAA 1C2NA 5APXA 1QLED 1XTGB 1VQLP 1QKSA 2QG4A 1EQ7A 5AW9B 3EWKA 3TGUG 3PXWA 1CSWA 5L8RJ 1L0LG 2JWDA 3TGUD 1Y9BA 2WSCH 3LIEA 2QM8A 3PHLA 3HQ7A 2AIUA 2M3BA 3CX5E 3CI9A 1R8EA 1P84D 2J59M 2M0BA 1W2LA 2XNDH 4I2LC 4AQRD 3WFCC 1HGVA 1HZVA 3L71D 5KAIH 2ZAEB 1KV4A 3O8ZA 4AANA 2KUBA 2OYIA 4GEDB 1KQFB 1PFIA 2R3SA 1CI6B 2BLFB 1PP9G 2W83C 4UB8E 2R44A 2WT7B 2QJPB 2KXPB 2JQRA 1VQ4P 4CPGA 2E5TA 4BXLA 1NTME 2YK3A 2IBZD 2ZXXA 1I8OA 3B5NA 2V4HA 1BCCE 2WT7A 2N1TB 2Y9YA 2KNCA 1U7JA 1DH3A 3GG2A 4P4QB 4D6TG 1RF0A 1Q82Q 1T6AA 3VNWA 2M3EA 4RJTA 3V5BA 1DVHA 2N1TA 1S5LE 4UB6V 4YXDC 2YIUB 4TT3H 1FZEA 2OYHC 1LP1B 1A56A 3Q1MA 1LT9C 3V4WA 3GHGA 4N3YB 1JOCA 3IAOA 3GW6A 2GC4D 1LTJC 2ZZS1 3A5TA 4PV1B 3VYMA 2OTJP 3GHGC 1VQKP 1RH5B 2KLVA 4HKZH 4ZNCA 4PJ0E 4L3GA 2WPVB 1BGYD 1MZ9A 1S6VB 1NU1E 5DJUB 1L9BC 3GF3A 1EDJA 2BEZF 2OZ1A 2D2CB 4H44B 2O1KA 2N9IA 3H1JE 4Y5RA 2WITA 4PD4H 4ASVA 155CA 3CC4P 2AXTV 4C7NB 3H1KJ 3SJLA 3GMAA 2K9YA 3AEDC 2BASA 3CYTI 3V2QA 3H1HG 2JR8A 3RLMA 5KAFV 2P1JA 3VP9A 4PJ0V 1FDOA 1C6RA 1I54A 2E74D 1RZ5A 3DP5A 1X22A 4UB8V 1K8AQ 1CSXA 3CCUP 2A45I 3U59A 1I6EA 2Y0DA 1G2CA 1MG2D 3Q5RA 3L75G 2QSIA 1ZW0A 3AE6C 1FI3A 2YCCA 3L72D 3IFMA 1NMIA 3AE7C 1M1JB 1JY3O 5CIFB 5CIBB 1SQPG 4H44D 3M9HA 3R2PA 1K73Q 4U3FJ 2H7HA 2XTSB 5KKZB 1J1DC 5AVVB 1QVGO 1JCCA 1S5LV 2H89C 3VN0A 2B87A 1FZAA 3JCUE 2C1VA 1SQVG 5AW3B 1FDIA 3DR0A 2PP6A 3AEGC 4XA4A 1A8CA 1OMIA 2B88A 2E74B 1CIGA 3O5CA 3OA7A 2XKMA 1SQQK 2GA1A 1QVFO 1NYHA 4AAOA 3CWBD 2HYNA 3D70A 1M6ZA 3B4SA 1LT9A 3E1IA 2QVAA 3H1LG 1BSHA 3CWBG 1YQ4C 3H1LJ 3L36A 3CXHH 1RE3C 1HJ3A 4UB6H 1NMLA 1HVVA 1DEEG 3ZCFA 4U7JA 1NTMJ 3PRJA 1URQC 1LJ2A 4PW9B 3H1LE 1W5CT 3OCDB 2P10A 1KB0A 1GK6A 4HJGH 5EFWB 5E79H 3B5NB 4AAMA 5GTHH 5IY51 2B9BA 1N90A 1DVVA 3H1JJ 3CX5I 4W7ZA 2OQQA 1URQD 4RESB 3L37A 4O1QA 1OW7A 1FZCA 2QJPC 1I6DA 1LTAC 2E43A 4HB1A 2AI5A 3C8VA 1NTKD 2NPSA 1NHLA 3G4SP 1FHBA 2FYUG 1Q2NA 1TU3F 2FXOA 1JMMA 3A0BE 5APWA 1NTMK 2JWAA 1S5LX 2JP3A 3RL0g 1YJ9P 3EQ2A 3CXHE 5APQA 3SWSA 4GT1A 4JPZB 1UIXA 1L0LK 1SFCB 4IFDK 4U3FG 1SQQE 1H1OA 3SWFA 1ZN5A 3JBTB 1PV3A 4HH2A 1QEXA 2VRSA 2C0WA 3FXDA 2ITAA 1AOQA 2HPCB 2C1DB 2O01N 3FWLA 1BE3E 1YNRA 1P84E 1T3UA 4DOJA 1HBWA 2IFNA 3BCCE 1KILC 2OZ1B 5KTBA 1KB9D 3GLMA 1CHHA 3V2PA 1MG3D 2ZVNB 1AJYA 3M9QA 2SPZA 3D6YA 1VL2A 4H44C 3AE4C 5CMZA 1KB9E 1YTCA 3K5BA 1FS0E 1JDLA 2LR2A 4C7NA 1S2EA 3Q2YA 1U57A 5TJHA 2E75B 5AW7B 3V2NA 1X0TA 3P8CD 3WMM0 1IFNA 2PCBB 4XYDB 1RHZB 3H1KE 4FAVA 1X79B 1KILB 2WSFH 3U1AA 1LTJB 5APYA 4NPEA 1VPCA 2ZXEB 1H32A 5AVRB 2GC7D 5CYTR 1G2CB 1H31B 2FYUK 3MUDA 1MUUA 3BRTB 1CRJA 2PACA 1I5TA 1G1IA 2BPBB 3ZOXA 2FFDC 2H8PD 4N78D 1GZLA 2Q6QA 2JO1A 1L0NK 2WZ7A 1DT1A 4UB8H 2BCCJ 1PL5A 5E79E 5GTHE 3MIWA 1PIXA 2OARA 1HRCA 1JB0J 5KLVE 1B7VA 2ZBOA 1KILE 1JMBA 2N9BA 2Z4EA 4AYCA 1EDLA 1GMJA 5BU8B 3NBTA 1LT1A 1USEA 2AXTH 1QL3A 3EFGA 4DJGA 1SQBE 3WC8A 5CIGB 3MUDC 2IZ1A 3CWBE 2WWWA 1RE3A 2LXCB 2A45H 1NKNA 1FZCB 1KYOE 5H2FE 3A0BH 1CRGA 5AW6B 3WU2E 3KZIV 5CBOA 3CD6P 4RSZA 1LWUC 2E42A 1IO4A 4PJ0H 1OFCX 4OVNF 3I55P 5GTIV 3S1KA 2QJYB 1NTZE 2WSCJ 2KZIA 2V08A 4BRYB 4GYDA 3T97A 2LXBA 2E75D 2KLUA 4L74A 3VTPC 4LC1A 2E75C 5DJQC 3VOPA 4K35A 4L3HA 1ZZHA 1J3SA 3HE4A 2HFED 1IK9A 3SLEA 1RF0C 2KZJA 2I8DA 1PGJA 2E76B 4BRYA 2IBZI 5GTIH 2HPCA 5AVTB 3CWBJ 1FJPA 1IRVA 2QA4P 1OIPA 3RK3B 1H0TB 4ASWA 2QM7A 3L70E 1SQXJ 1H33B 4ZMDA 1CIHA 2CPSA 2DW3A 1KQLA 2O3JA 1SVFA 2QJKB 3HTKB 1YITP 1SS1A 3HRNA 1ZMEC 4WQEA 2FXMA 1FOSF 5AVYB 2RKLA 3AE3C 1SQQD 3H1HD 3Q5SA 3OA8B 1HCMA 1M1JA 2Q5UA 1GK4A 1H31A 1N8RQ 2C0XA 1VQ5P 1HWTC 1PP9J 1NTZJ 2E5YA 2B11B 1DD3A 1FZFA 4WY4C 5BU5A 2C1DA 1LTTC 1NTKJ 3H32A 2QIWA 2HLOA 1LTBC 1BSNA 4N0KA 5DFSA 1JTHA 3RL0D 3L75D 4I7ZC 1KD1Q 1DW2A 2Y9ZA 1YJNP 3L72G 1LFMA 1J1DB 3P32A 3NWVA 2BCNB 4IFFA 4WY4A 3H1JD 2B89A 1LC2A 3WFDC 1S9KE 4KT0J 4H0LB 1NGMB 2AEFA 2OYHB 5EXQA 1CRHA 3NBSA 2CPBA 4D6TE 5APSA 3L74D 1KZUB 3H1HJ 2A06E 2ZYDA 2N9JA 4I7ZB 1CRIA 3I5CA 4JCGA 2RMZA 1M60A 4D6TD 2KOGA 3L35A 3H1ID 5AVWB 4MN4C 1KILD 1PPJG 3L74G 2CA3B 3E1RA 3PXSA 4KMGA 3M0AA 2OYHA 1NKZB 1Q81Q 2WVRA 2H43A 4OGQB 4QAOA 4FA4A 3H1IJ 1ZRTE 2JDIH 3PH0A 1AOFA 3T97B 1ZRTD 3CCRP 1IQCA 3NMDA 1M7LA 1SQVK 5DJQB 3CMAP 1CXAA 1QL1A 3LW5J 3LW5H 1EXJA 4JYBA 4YXWH 3BATA 1WEJF 2GUSA 1IC2A 5CJ4A 1RF1A 2Q9IA 2BCCD 2C1UA 1S4XA 2BEQD 1GTWA 2Z5IA 3L74J 1H9YA 1OWAA 1I8PA 1FZGA 3M0DC 3CX5H 1CTZA 3CX5W 1OAEA 3HD7C 4D6TJ 3H1KD 5B6QA 4FA1A 1U7MA 4PWAA 3CXHD 1VYDA 4LLHA 2O1JA 1RAQA 1NVOA 1QL2A 1IZNB 3H1KG 1J1EB 1EDKA 2N3BA 1NTKG 1RAPA 5KAFE 1AV1A 1Y47A 3SXTA 4NPFX 1RQUA 2WTYA 4YTPC 4WQDA 3CL3D 2XZRA 1JNMA 2YQBA 1QGKB 1M90Q 2HODA 5AW8B 1GKSA 1GDTA 1PP9D 1DEBA 2HG5D 3L4FA 1C6SA 1PP9E 1U74B 1AYGA 3KHUA 4FA5A 1OXZA 2HODB 2ZT9D 2KSJA 4JF7A 2O01H 1URQA 3FGAD 5KLIB 4WY4B 1KB9H 1HH0A 3KYQA 1IO3A 3O0RC 1YFCA 3RL0B 3M97X 4GKGA 3P8MC 1Q90D 2C8SA 1BGYJ 4GODA 1N73C 4PV1C 1SQBG 1KORA 3WUUA 1OZHA 1Q86Q 3H1IE 2KSEA 1IFDA 1SQXD 1L0NE 3OA8A 1VF5C 1Q7YQ 1JY3N 2OYIB 1CI6A 1JM0A 1CCHA 1SQXG 3CX5D 3E7KA 1ETPA 1S72P 1YEAA 1KMIZ 1KQSO 1L4AD 2R5BA 3WFBC 3WU2V 1OW8A 3C1LA 1CW5A 4IL6E 1S9KD 1FOSE 1CHJA 2E74C 3G6EP 4GDOA 2XDJA 4OH8B 1USDA 1BL9A 3AEAC 1COTA 4LGDE 4RO0A 1BCCG 3RK3C 3R4YA 3BCCJ 3MP7B 3O1YA 3BCCG 4R4MA 3TK1A 1W2EA 3CU4A 4KHXA 1BCCD 3AE2C 3FX0A 3TGUJ 1Y8AA 4W7YA 1LP1A 2V07A 3BCCD 1AQTA 4ZKUA 1MKMA 5B66V 1VQOP 2V7QH 1E2RA 1AQ5A 2ZVOB 1NJIQ 1VDFA 1IK7A 2KP8A 3SWYA 2D0WA 4XE5B 2ZXYA 5M1BA 1R5SA 4OGQC 3CC2P 5KLVJ 3CCJP 1JY2N 2W8ZA 4NFGB 1EXIA 1GW4A 2N18B 3B5NC 3ZOWA 1LC1A 1RF1C 2FYNB 1OVUA 1ZR4A 3IR9A 2KB7P 2Q3IA 4AUWA 4L75A 2ZFCA 2FFDA 4Y99B 5CCHC 1GW3A 2PAJA 3L4OA 3AEEC 2Q7CA 1CRCA 3IN6A 3A7OA 1CIFA 1NTZD 1KQGB 3OJAB 1YICA 1KC8Q 2BH5X 5KJ7A 3DMIA 4GOFA 4WWIA 2ZONG 1F1FA 2YO2A 3CC7P 5KLVK 2PGDA 1LWUB 4O1WA 4C46A 1X8YA 2GM4A 2FBWC 2MJZA 2B10B 5CJ0A 4ZKPA 5K5GB 1N7SD 3P7KA 3M06A 3L73J 3LIDA 1EZVD 1NIRA 3CP5A 2B12B 1CTJA 1T8ZA 2WSSH 3A3YB 1N9CA 3H1LD 1C75A 2N3YA 3PLNA 3VMYA 3L70J 1DIPA 1KV9A 5CCGC 2BGVX 1JUNA 4YPCA 1HJ4A 1KX7A 1K04A 1LTSC 1SQBK 2WPQA 1A02F 1CYCA 3X39A 4PD4E 2ORLA 1SQVJ 3ZOYA 1L4AB 1PPJE 2POHA 3KZIH 2Q1KA 2K88A 5CCHA 2R32A 4LJIA 2RH0A 2FYUJ 3VMXA 3WU2H 5TISE 1SFCC 1W2BO 1DIQC 3QWOC 1SQPJ 1VQ8P 1KN7A 1M1JC 3A0HE 3FXEA 1WT6A 3CXHW 2XV5A 1E79H 1GD2E 5H2FH 1PGPA 1KFNA 3SWKA 1CHIA 1JEKA 4HYTB 1HGZA 1RE4C 3W67A 5B5EH 2BCCE 2OTLP 4RKUJ 4GOEA 2QJKC 2AXTE 1QL4A 1NTMG 1OVRA 1EB7A 2KS1A 3CXHI 1OW6A 3TGUE 3HE5B 1RZ6A 3L73G 1KTMA 3H6PA 1J2JB 1WMKA 1BCCJ 2OTKE 3A0HV 5AVXB 1SQPD 2IYPA 1C2RA 3SFEC 1HJ0A 2NPSB 4XFJA 3WUVA 2XNXA 3HQ8A 5CHXA 1FZBA 1OX3A 2UWJE 5KAIE 1SQVD 2NPSC 3TYYA 3HQ6A 1SFCA 3SFDC 2PCCB 2IZ0A 3CMEP 1CSUA 3MHVA 3PJSK 1N86A 1NAFA 2N1TC 2WSEJ 1T3JA 3ZBMA 1VQ7P 2ZYGA 1CO6A 3NFQA
chains in the Genus database with same CATH topology
1ZRTD 1NMIA 5CIFB 5CIBB 1IQCA 4EIEA 451CA 5E79V 5GTHV 1DW3A 5B5EV 1CC5A 1GJQA 4H0JA 1C52A 5DJQB 2DVHA 2XTSB 5KKZB 3ORVA 1S5LV 1CXAA 4WQBA 4L1QA 1CYIA 1HH7A 2C1VA 2C2CA 4XXLA 4WQ7A 1WEJF 3DR0A 1FOCA 1A8CA 1KYOW 2C9XB 2BCCD 2C1UA 1CIGA 4WQCA 1H9YA 3O5CA 1I8PA 4V2KA 4YE1A 5C0ZA 1CTZA 3CX5W 1OAEA 3H1KD 5B6QA 4FA1A 1LS9A 4PWAA 3CXHD 4AAOA 1GDVA 3TF5A 3CWBD 1VYDA 1RAQA 1M70A 4FANA 1M6ZA 1YCCA 2HV4A 2N3BA 3PXTA 1H9XA 1RAPA 3SXTA 3PTZA 1HJ3A 3VMAA 1NMLA 1CYJA 4WQDA 3ZCFA 4WQAA 2YQBA 1F1CA 3PRJA 2L4DA 2B0ZB 4PW9B 1GKSA 1PP9D 1W5CT 3OCDB 1KB0A 1C6OA 1YEBA 1C6SA 4AAMA 1U74B 5IY51 1AYGA 3KHUA 4FA5A 1N50A 2Y0EA 1DW0A 1N90A 1DVVA 2L91A 2LIRA 4O1QA 4Q5PA 1I6DA 5KLIB 3WFEC 1CSVA 2LITA 1CXCA 5CIEB 1IO3A 3O0RC 1YFCA 2AI5A 3M97X 3ZOOA 1NTKD 1MZ4A 2C8SA 4J20A 1FHBA 1A2SA 3A0BV 3L4MA 2JWAA 3HQ9A 3TDKA 1SQXD 5TISV 3OA8A 2RN0A 3SWSA 1CORA 1GIWA 3VRDA 1H1OA 1CCHA 3JBTB 5KLVD 3CX5D 2JTIB 2CE0A 1ETPA 1L9JC 1YEAA 4FB1A 1GQ1A 1CEDA 1AOQA 1L0ND 3WFBC 1FCDC 2C1DB 3FWLA 3WU2V 4H0KA 4AALA 1HZUA 4K3IA 1YNRA 3SVWA 1DIIC 4IL6V 1E8EA 2OZ1B 2N18C 3ZIYA 1KB9D 4EIFA 1CHHA 1CHJA 1MG3D 2FYUD 1BL9A 1COTA 4AX3A 1YTCA 1L0LD 1JDLA 1OCDA 3O1YA 5TJHA 2GB8B 1DW1A 3CU4A 1NU1D 1BCCD 4U3FD 3RN1A 2EXVA 2PCBB 1IRWA 2V07A 3BCCD 4XYDB 4FAVA 4MU8A 1CNOA 3ITKA 5AURA 1QN2A 1U75B 2DGEA 5CIHB 5B66V 1K3GA 1E2RA 1H32A 2GC7D 1KIBA 5CYTR 1FJ0A 1PPJD 1H31B 3L73D 4EICA 1CRJA 2D0WA 1I5TA 2PACA 1KX2A 2MHMA 2FRCA 2BPBB 4EDFA 2ZXYA 3PH2B 2D0SA 2CXBA 3ZOXA 1AKKA 4DY9A 1E29A 1CIEA 1DT1A 3L70D 4NFGB 2N18B 4EIDA 3RMZA 1HRCA 3ZOWA 1LC1A 3RN0A 1B7VA 1LMSA 2VHDA 2KNCB 3MK7C 2FYNB 1BE3D 2ZBOA 2GIWA 351CA 2FWLA 4PD4D 3A9FA 1KYOD 5C9MA 1C2NA 3MK7B 3NBTA 2MTAC 1QKSA 1GU2A 3L4OA 2QG4A 1FI7A 1QL3A 3WC8A 3PXWA 1CSWA 5CIGB 1CRCA 1CIFA 1NTZD 3TGUD 1YICA 1CRGA 2ZOOA 2BH5X 3DMIA 2ZONG 1F1FA 3KZIV 3PHLA 3HQ7A 2K9JB 2AIUA 4RSZA 4O1WA 1P84D 5GTIV 1W2LA 2B10B 2QJYB 3WFCC 1C7MA 2V08A 4GYDA 1EZVD 1HZVA 3L71D 1NIRA 3CP5A 2B12B 1NNOA 4AANA 1CTJA 5DJQC 4GEDB 4WQ8A 1N9CA 2Y0CA 4L3HA 2BLFB 3H1LD 1FI9A 1ZZHA 1J3SA 1C75A 2N3YA 2N9YB 2QJPB 3PLNA 3SLEA 2JQRA 1KV9A 2BGVX 3OCDA 1HJ4A 1KX7A 1IRVA 2YK3A 2IBZD 1I8OA 1CYCA 3X39A 5H2FV 1H33B 1YIQA 1HROA 2ORLA 1CIHA 3GG2A 4P4QB 3ZOYA 2O3JA 3VNWA 2A06D 4LJIA 2QJKB 1NTMD 4FA9A 4RJTA 1DVHA 1H33A 3C2CA 4UB6V 2YIUB 1WVEC 1DIQC 1A56A 4WQEA 1SQBD 1SQQD 3GW6A 3H1HD 2GC4D 2BH4X 2ZZS1 1IZL0 3OA8B 1HCMA 1K3HA 3VYMA 3CXHW 1H31A 2B4ZA 2CE1A 5CIDB 2B11B 4L3GA 5DF5A 2C1DA 1BGYD 1S6VB 2CA4B 3O20A 1CHIA 1L9BC 4N0KA 5DFSA 3L75D 2OZ1A 5CICB 1QL4A 2N9IA 2Q3EA 1DW2A 1LFMA 1EB7A 1CRYA 4Y5RA 3NWVA 2KS1A 2BCNB 155CA 3H1JD 1RZ6A 1CTYA 2AXTV 1LC2A 3SJLA 3WFDC 4WQ9A 3A0HV 1SQPD 1C2RA 5EXQA 1CRHA 3NBSA 3CYTI 3L74D 2I8FA 3RLMA 5KAFV 1HJ5A 2N9JA 1CRIA 4JCGA 4PJ0V 2RMZA 1C6RA 1I54A 1R0QA 3HQ8A 1M60A 4D6TD 1RZ5A 3DP5A 4A7PA 3H1ID 1QYZA 4UB8V 1CSXA 2CA3B 3PXSA 4KMGA 3TYIA 1H32B 1SQVD 3HQ6A 5KAIV 2PCCB 1I6EA 2Y0DA 1CSUA 1MG2D 4QAOA 4FA4A 1I55A 3ZBMA 1FI3A 2YCCA 1AOFA 1CO6A 1CCRA 3WUIA 3L72D 1N15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT D;  1NMI A;  5CIF B;  5CIB B;  1IQC A;  4EIE A;  451C A;  5E79 V;  5GTH V;  1DW3 A;  5B5E V;  1CC5 A;  1GJQ A;  4H0J A;  1C52 A;  5DJQ B;  2DVH A;  2XTS B;  5KKZ B;  3ORV A;  1S5L V;  1CXA A;  4WQB A;  4L1Q A;  1CYI A;  1HH7 A;  2C1V A;  2C2C A;  4XXL A;  4WQ7 A;  1WEJ F;  3DR0 A;  1FOC A;  1A8C A;  1KYO W;  2C9X B;  2BCC D;  2C1U A;  1CIG A;  4WQC A;  1H9Y A;  3O5C A;  1I8P A;  4V2K A;  4YE1 A;  5C0Z A;  1CTZ A;  3CX5 W;  1OAE A;  3H1K D;  5B6Q A;  4FA1 A;  1LS9 A;  4PWA A;  3CXH D;  4AAO A;  1GDV A;  3TF5 A;  3CWB D;  1VYD A;  1RAQ A;  1M70 A;  4FAN A;  1M6Z A;  1YCC A;  2HV4 A;  2N3B A;  3PXT A;  1H9X A;  1RAP A;  3SXT A;  3PTZ A;  1HJ3 A;  3VMA A;  1NML A;  1CYJ A;  4WQD A;  3ZCF A;  4WQA A;  2YQB A;  1F1C A;  3PRJ A;  2L4D A;  2B0Z B;  4PW9 B;  1GKS A;  1PP9 D;  1W5C T;  3OCD B;  1KB0 A;  1C6O A;  1YEB A;  1C6S A;  4AAM A;  1U74 B;  5IY5 1;  1AYG A;  3KHU A;  4FA5 A;  1N50 A;  2Y0E A;  1DW0 A;  1N90 A;  1DVV A;  2L91 A;  2LIR A;  4O1Q A;  4Q5P A;  1I6D A;  5KLI B;  3WFE C;  1CSV A;  2LIT A;  1CXC A;  5CIE B;  1IO3 A;  3O0R C;  1YFC A;  2AI5 A;  3M97 X;  3ZOO A;  1NTK D;  1MZ4 A;  2C8S A;  4J20 A;  1FHB A;  1A2S A;  3A0B V;  3L4M A;  2JWA A;  3HQ9 A;  3TDK A;  1SQX D;  5TIS V;  3OA8 A;  2RN0 A;  3SWS A;  1COR A;  1GIW A;  3VRD A;  1H1O A;  1CCH A;  3JBT B;  5KLV D;  3CX5 D;  2JTI B;  2CE0 A;  1ETP A;  1L9J C;  1YEA A;  4FB1 A;  1GQ1 A;  1CED A;  1AOQ A;  1L0N D;  3WFB C;  1FCD C;  2C1D B;  3FWL A;  3WU2 V;  4H0K A;  4AAL A;  1HZU A;  4K3I A;  1YNR A;  3SVW A;  1DII C;  4IL6 V;  1E8E A;  2OZ1 B;  2N18 C;  3ZIY A;  1KB9 D;  4EIF A;  1CHH A;  1CHJ A;  1MG3 D;  2FYU D;  1BL9 A;  1COT A;  4AX3 A;  1YTC A;  1L0L D;  1JDL A;  1OCD A;  3O1Y A;  5TJH A;  2GB8 B;  1DW1 A;  3CU4 A;  1NU1 D;  1BCC D;  4U3F D;  3RN1 A;  2EXV A;  2PCB B;  1IRW A;  2V07 A;  3BCC D;  4XYD B;  4FAV A;  4MU8 A;  1CNO A;  3ITK A;  5AUR A;  1QN2 A;  1U75 B;  2DGE A;  5CIH B;  5B66 V;  1K3G A;  1E2R A;  1H32 A;  2GC7 D;  1KIB A;  5CYT R;  1FJ0 A;  1PPJ D;  1H31 B;  3L73 D;  4EIC A;  1CRJ A;  2D0W A;  1I5T A;  2PAC A;  1KX2 A;  2MHM A;  2FRC A;  2BPB B;  4EDF A;  2ZXY A;  3PH2 B;  2D0S A;  2CXB A;  3ZOX A;  1AKK A;  4DY9 A;  1E29 A;  1CIE A;  1DT1 A;  3L70 D;  4NFG B;  2N18 B;  4EID A;  3RMZ A;  1HRC A;  3ZOW A;  1LC1 A;  3RN0 A;  1B7V A;  1LMS A;  2VHD A;  2KNC B;  3MK7 C;  2FYN B;  1BE3 D;  2ZBO A;  2GIW A;  351C A;  2FWL A;  4PD4 D;  3A9F A;  1KYO D;  5C9M A;  1C2N A;  3MK7 B;  3NBT A;  2MTA C;  1QKS A;  1GU2 A;  3L4O A;  2QG4 A;  1FI7 A;  1QL3 A;  3WC8 A;  3PXW A;  1CSW A;  5CIG B;  1CRC A;  1CIF A;  1NTZ D;  3TGU D;  1YIC A;  1CRG A;  2ZOO A;  2BH5 X;  3DMI A;  2ZON G;  1F1F A;  3KZI V;  3PHL A;  3HQ7 A;  2K9J B;  2AIU A;  4RSZ A;  4O1W A;  1P84 D;  5GTI V;  1W2L A;  2B10 B;  2QJY B;  3WFC C;  1C7M A;  2V08 A;  4GYD A;  1EZV D;  1HZV A;  3L71 D;  1NIR A;  3CP5 A;  2B12 B;  1NNO A;  4AAN A;  1CTJ A;  5DJQ C;  4GED B;  4WQ8 A;  1N9C A;  2Y0C A;  4L3H A;  2BLF B;  3H1L D;  1FI9 A;  1ZZH A;  1J3S A;  1C75 A;  2N3Y A;  2N9Y B;  2QJP B;  3PLN A;  3SLE A;  2JQR A;  1KV9 A;  2BGV X;  3OCD A;  1HJ4 A;  1KX7 A;  1IRV A;  2YK3 A;  2IBZ D;  1I8O A;  1CYC A;  3X39 A;  5H2F V;  1H33 B;  1YIQ A;  1HRO A;  2ORL A;  1CIH A;  3GG2 A;  4P4Q B;  3ZOY A;  2O3J A;  3VNW A;  2A06 D;  4LJI A;  2QJK B;  1NTM D;  4FA9 A;  4RJT A;  1DVH A;  1H33 A;  3C2C A;  4UB6 V;  2YIU B;  1WVE C;  1DIQ C;  1A56 A;  4WQE A;  1SQB D;  1SQQ D;  3GW6 A;  3H1H D;  2GC4 D;  2BH4 X;  2ZZS 1;  1IZL 0;  3OA8 B;  1HCM A;  1K3H A;  3VYM A;  3CXH W;  1H31 A;  2B4Z A;  2CE1 A;  5CID B;  2B11 B;  4L3G A;  5DF5 A;  2C1D A;  1BGY D;  1S6V B;  2CA4 B;  3O20 A;  1CHI A;  1L9B C;  4N0K A;  5DFS A;  3L75 D;  2OZ1 A;  5CIC B;  1QL4 A;  2N9I A;  2Q3E A;  1DW2 A;  1LFM A;  1EB7 A;  1CRY A;  4Y5R A;  3NWV A;  2KS1 A;  2BCN B;  155C A;  3H1J D;  1RZ6 A;  1CTY A;  2AXT V;  1LC2 A;  3SJL A;  3WFD C;  4WQ9 A;  3A0H V;  1SQP D;  1C2R A;  5EXQ A;  1CRH A;  3NBS A;  3CYT I;  3L74 D;  2I8F A;  3RLM A;  5KAF V;  1HJ5 A;  2N9J A;  1CRI A;  4JCG A;  4PJ0 V;  2RMZ A;  1C6R A;  1I54 A;  1R0Q A;  3HQ8 A;  1M60 A;  4D6T D;  1RZ5 A;  3DP5 A;  4A7P A;  3H1I D;  1QYZ A;  4UB8 V;  1CSX A;  2CA3 B;  3PXS A;  4KMG A;  3TYI A;  1H32 B;  1SQV D;  3HQ6 A;  5KAI V;  2PCC B;  1I6E A;  2Y0D A;  1CSU A;  1MG2 D;  4QAO A;  4FA4 A;  1I55 A;  3ZBM A;  1FI3 A;  2YCC A;  1AOF A;  1CO6 A;  1CCR A;  3WUI A;  3L72 D;  1N15 A; 
#chains in the Genus database with same CATH topology
 5KJ7 C;  1H8A A;  451C A;  1DW3 A;  1CC5 A;  1L2P A;  1C52 A;  2K1A A;  3RK2 C;  1T2K D;  3ORV A;  3M91 A;  4EIJ A;  3L72 E;  5B66 E;  3KQG A;  1M56 D;  3L75 J;  4L1Q A;  1CYI A;  4WQ7 A;  1EC5 A;  1RE4 A;  2HR3 A;  1BGY E;  1GL2 D;  1IFJ A;  4Z1M H;  3CCQ P;  2C9X B;  1L0N G;  4WQC A;  2B87 B;  4YE1 A;  1N2D C;  1LS9 A;  3W68 A;  5AW2 B;  1CSB A;  3L71 G;  1M70 A;  1YCC A;  5AVS B;  4JQ0 D;  1JY3 P;  4L76 A;  3PXT A;  1H9X A;  2OGU A;  3OW2 O;  1NO4 A;  4U3F E;  3PTZ A;  3CLQ A;  1CYJ A;  2P67 A;  1DD4 A;  4I6M C;  1BE3 G;  4H0L C;  1OVV A;  3M0D A;  1EZV I;  1YEB A;  2WMM A;  4DT0 A;  3KPE A;  1H0T A;  1N50 A;  2FKW B;  1SQB J;  2L91 A;  1JY2 P;  3B71 A;  4B86 A;  3AEF C;  1YTZ I;  2M8R A;  1L4A A;  2IX7 C;  3KDP B;  1NOH A;  2M5A B;  3WFE C;  2IYO A;  1HJB A;  1CXC A;  1SQX E;  2O01 J;  5CIE B;  1SFC D;  3CCM P;  3KZI E;  3ZOO A;  4N78 E;  4J20 A;  1BGY G;  2IBZ E;  2IFM A;  3HUS B;  4DZO A;  2M5A A;  4C7R A;  3L4M A;  2BCC G;  1P84 H;  3N7N A;  3TDK A;  5KAF H;  5TIS V;  1PZQ A;  1VF5 B;  1LTI C;  3ABV C;  2YIU C;  1NTK E;  3G3Z A;  4H13 D;  1SQP E;  3NTN A;  3HUS A;  2CE0 A;  1FU1 A;  1K05 A;  3TSI A;  3RBX A;  5CCG D;  3A2A A;  1FCD C;  3G71 P;  2FYN C;  4H0K A;  1YYC A;  1HZU A;  1LTG C;  1DII C;  4IL6 V;  1UII A;  1E8E A;  2K3R A;  2N18 C;  1PGQ A;  4GIF A;  3ZIY A;  3D6Z A;  3CCE P;  1SQQ G;  2D2C C;  5KLI C;  3RK2 D;  1T2K C;  1WRG A;  2YXQ B;  3S9O A;  2QRX A;  2FYU D;  3CPW O;  1L0L D;  1ZV8 A;  1OCD A;  1R5L A;  2GB8 B;  3AEC C;  1DW1 A;  1GU5 A;  2E76 C;  1NU1 D;  3CCL P;  4U3F D;  1AA0 A;  2IDB A;  3RN1 A;  1LWU A;  1QX8 A;  2EXV A;  2JKV A;  3BVH A;  4BWN A;  1IRW A;  4JBZ A;  1FE6 A;  1URQ B;  3F89 A;  3L75 E;  1CNO A;  1N7S A;  3ITK A;  1QN2 A;  3JCU H;  2C9L Y;  2YKQ A;  1U75 B;  3L73 E;  1K3G A;  2IBZ G;  1FJ0 A;  1PPJ D;  1NTZ G;  3TNU B;  4EIC A;  3RGU A;  1KX2 A;  2XU6 A;  5AW1 B;  4WBA A;  4EDF A;  2G3A A;  1CZQ A;  3PH2 B;  2D0S A;  2CXB A;  1FAV A;  1AKK A;  1LTJ A;  2IPP A;  3PP5 A;  1E29 A;  1M1K Q;  1HTL C;  3RMZ A;  5AVQ B;  1G1J A;  2OYO A;  1LMS A;  2KNC B;  1BE3 D;  351C A;  4PD4 D;  5CCG A;  3A9F A;  3VYI A;  1KYO D;  3U1C A;  5B5E E;  3MK7 B;  1L0L E;  2AXC A;  2MTA C;  3L71 E;  2C9N Y;  1GU2 A;  1FI7 A;  1SLQ A;  2D2C D;  2ZJS E;  3MZW B;  5B66 H;  4OWF A;  3KXD A;  3BAS A;  3A0H H;  2ZOO A;  1S5L H;  1MV8 A;  5AW4 B;  4N6J A;  1S1C X;  3UIA A;  2K9J B;  3H1H E;  4H13 C;  3BRV B;  1SQQ J;  3L74 E;  2PFX A;  2CK3 H;  2FXP A;  3JSV C;  4TLF A;  1AVO A;  1C7M A;  2K37 A;  3O6Q B;  1IJD B;  2V7Q J;  1NNO A;  1YJW P;  1JY2 O;  1BE3 J;  3V2R A;  4WQ8 A;  2Y0C A;  2W6B A;  1FI9 A;  1Z56 A;  4W80 A;  2N9Y B;  2AEM A;  1FZC C;  1HUC A;  3OCD A;  3V4Q A;  3N4X A;  2YO3 A;  1S3J A;  5AW0 B;  3AE8 C;  1K9M Q;  5H2F V;  1YQ3 C;  3HE4 B;  2A06 G;  1RF1 B;  1YIQ A;  1NTK K;  1HRO A;  2FYU E;  4O9B A;  1YI2 P;  1JO5 A;  2P7J A;  1ZLL A;  2A06 D;  1VQP P;  2FFD B;  1YHQ P;  1NTM D;  1VQ6 P;  4FA9 A;  1HF9 A;  2ZYA A;  4PV1 D;  5GTI E;  4R4L A;  1H33 A;  2MKV A;  1NU1 G;  3C2C A;  3MD0 A;  1WVE C;  4Y28 J;  3VMZ A;  3HUS C;  1N7S B;  3HTK A;  1SQB D;  2BH4 X;  1IZL 0;  5AVZ B;  1EZV E;  3EFF K;  1K3H A;  4M3L A;  1VQM P;  2B4Z A;  3M9B A;  3Q5P A;  3TNU A;  3IF4 A;  3AE5 C;  2CE1 A;  1BDD A;  5CID B;  1GL2 B;  5APU A;  3H25 A;  1SQX K;  5APT A;  5DF5 A;  3QH9 A;  2L5G B;  2CA4 B;  3O20 A;  5CCH D;  3II6 A;  3L71 J;  5CIC B;  2Q3E A;  5C39 A;  2KI7 B;  3WUT A;  2Z5H A;  1CRY A;  5CBN A;  3VP8 A;  3JC2 2;  1MFT A;  3D0W A;  2E76 D;  1NTZ K;  1CTY A;  1IFP A;  1LNQ A;  3GF7 A;  1VQ9 P;  1JTH B;  4WQ9 A;  1IFI A;  1H88 A;  1VQN P;  4OGQ D;  2I8F A;  3AE9 C;  2KK7 A;  1HJ5 A;  1R0Q A;  4A7P A;  3P8C E;  1LT9 B;  2W90 A;  2A45 G;  2OYI C;  1QYZ A;  1L0N J;  3TYI A;  1H32 B;  2R3C A;  1N73 A;  5KAI V;  2N1T D;  2K9J A;  2R5D A;  2NPS D;  1BDC A;  1I55 A;  1RQV A;  3O6Q A;  1NH4 A;  1CCR A;  3WUI A;  1N15 A;  5AW5 B;  1H89 A;  1KYO I;  1N73 B;  3F5H A;  3RK3 D;  4EIE A;  2QJY C;  3ZDM A;  5E79 V;  5GTH V;  5B5E V;  2WPR A;  2YNY A;  1GJQ A;  1JCD A;  4H0J A;  2DVH A;  3RK3 E;  3RK2 B;  2YMY A;  2KYV A;  2I1K A;  5DJT B;  3S4R A;  4WQB A;  4IL6 H;  3B8E B;  1ZOY C;  1HH7 A;  3G9R A;  2C2C A;  4XXL A;  1L4A C;  1KYO H;  1FOC A;  1KYO W;  1SQP K;  1LGH B;  1FJK A;  1W5C E;  1A02 J;  4V2K A;  1VF5 D;  5C0Z A;  3AE1 C;  1XTC C;  2LKM A;  4IFM A;  1FBM A;  1SQV E;  4H0L D;  3TF5 A;  1GDV A;  1N7L A;  4FAN A;  1ZP0 C;  3V6I A;  1ZXG A;  2HV4 A;  1KFM A;  5BVZ A;  3HD7 B;  1FC2 C;  2H88 C;  4I1L A;  5TIS H;  3VMA A;  3L70 G;  2J58 A;  3RL0 C;  4WQA A;  1F1C A;  2GUV A;  1KB9 I;  2L4D A;  1YTZ T;  2B0Z B;  2ZT9 C;  1GL2 A;  2QEX P;  4WY4 D;  3HD7 A;  2YKO A;  2WQY C;  5AVU B;  1IFM A;  1M57 D;  2J5U A;  2YXR B;  3H32 B;  3SSU A;  4DCK A;  1C6O A;  1L0L J;  4WVZ A;  1SP4 A;  2Y0E A;  1DW0 A;  1EZV G;  5KKZ C;  1DX7 A;  1E5W A;  2LIR A;  1GU4 A;  1NU1 J;  1GL2 C;  2YMK A;  4Q5P A;  1KIL A;  3NXS A;  1CSV A;  2LIT A;  1EDI A;  2W6A A;  4K3A A;  5APV A;  2FYZ A;  3Q3D A;  3OAK A;  1ZR2 A;  2I1J A;  1MZ4 A;  4JYC A;  2FY8 A;  2YKP A;  1A2S A;  3A0B V;  3HQ9 A;  1N7S C;  3HD7 D;  2RN0 A;  5KJ7 D;  4PD4 I;  1COR A;  2WPS A;  1GIW A;  3VRD A;  3FWN A;  3H1J G;  5KLV D;  2JTI B;  1L9J C;  2P58 A;  4FB1 A;  1GQ1 A;  1CED A;  1L0N D;  4AAL A;  5KLV G;  2W27 A;  4K3I A;  3SVW A;  3RBZ A;  3H1I G;  4EIF A;  2PRR A;  1P84 I;  2P2U A;  4AX3 A;  3D71 A;  4IL6 X;  1J1E C;  4WB4 A;  3HE5 A;  2NZ2 A;  2KIK A;  4KJM A;  2WSF J;  1YBK A;  4EOT A;  1AVY A;  3B5N D;  3I56 P;  1AFO A;  3L72 J;  3CCS P;  1NAY A;  2JEE A;  2ZT9 B;  4L73 A;  4MU8 A;  3GHG B;  4IOI H;  1FDM A;  1X9V A;  3USS A;  5AUR A;  2DGE A;  5CIH B;  1KIB A;  1MFZ A;  3AEB C;  2W6J H;  4H13 B;  3L73 D;  1PGO A;  2G8Y A;  4EYY Q;  3CCV P;  3MGN A;  1NU1 K;  2MHM A;  2FRC A;  2AEJ A;  1D7M A;  3C9I A;  4EI2 A;  4NPD A;  4DY9 A;  2JJL A;  1CIE A;  1YIJ P;  2WSE H;  3L70 D;  4Y99 C;  1RY3 A;  4EID A;  3MTU E;  1M8O B;  2NRG A;  3RN0 A;  2VHD A;  2QE7 H;  3MK7 C;  2KS1 B;  1NWQ A;  2GIW A;  2FWL A;  4UB6 E;  5C9M A;  4QMA A;  1C2N A;  5APX A;  1QLE D;  1XTG B;  1VQL P;  1QKS A;  2QG4 A;  1EQ7 A;  5AW9 B;  3EWK A;  3TGU G;  3PXW A;  1CSW A;  5L8R J;  1L0L G;  2JWD A;  3TGU D;  1Y9B A;  2WSC H;  3LIE A;  2QM8 A;  3PHL A;  3HQ7 A;  2AIU A;  2M3B A;  3CX5 E;  3CI9 A;  1R8E A;  1P84 D;  2J59 M;  2M0B A;  1W2L A;  2XND H;  4I2L C;  4AQR D;  3WFC C;  1HGV A;  1HZV A;  3L71 D;  5KAI H;  2ZAE B;  1KV4 A;  3O8Z A;  4AAN A;  2KUB A;  2OYI A;  4GED B;  1KQF B;  1PFI A;  2R3S A;  1CI6 B;  2BLF B;  1PP9 G;  2W83 C;  4UB8 E;  2R44 A;  2WT7 B;  2QJP B;  2KXP B;  2JQR A;  1VQ4 P;  4CPG A;  2E5T A;  4BXL A;  1NTM E;  2YK3 A;  2IBZ D;  2ZXX A;  1I8O A;  3B5N A;  2V4H A;  1BCC E;  2WT7 A;  2N1T B;  2Y9Y A;  2KNC A;  1U7J A;  1DH3 A;  3GG2 A;  4P4Q B;  4D6T G;  1RF0 A;  1Q82 Q;  1T6A A;  3VNW A;  2M3E A;  4RJT A;  3V5B A;  1DVH A;  2N1T A;  1S5L E;  4UB6 V;  4YXD C;  2YIU B;  4TT3 H;  1FZE A;  2OYH C;  1LP1 B;  1A56 A;  3Q1M A;  1LT9 C;  3V4W A;  3GHG A;  4N3Y B;  1JOC A;  3IAO A;  3GW6 A;  2GC4 D;  1LTJ C;  2ZZS 1;  3A5T A;  4PV1 B;  3VYM A;  2OTJ P;  3GHG C;  1VQK P;  1RH5 B;  2KLV A;  4HKZ H;  4ZNC A;  4PJ0 E;  4L3G A;  2WPV B;  1BGY D;  1MZ9 A;  1S6V B;  1NU1 E;  5DJU B;  1L9B C;  3GF3 A;  1EDJ A;  2BEZ F;  2OZ1 A;  2D2C B;  4H44 B;  2O1K A;  2N9I A;  3H1J E;  4Y5R A;  2WIT A;  4PD4 H;  4ASV A;  155C A;  3CC4 P;  2AXT V;  4C7N B;  3H1K J;  3SJL A;  3GMA A;  2K9Y A;  3AED C;  2BAS A;  3CYT I;  3V2Q A;  3H1H G;  2JR8 A;  3RLM A;  5KAF V;  2P1J A;  3VP9 A;  4PJ0 V;  1FDO A;  1C6R A;  1I54 A;  2E74 D;  1RZ5 A;  3DP5 A;  1X22 A;  4UB8 V;  1K8A Q;  1CSX A;  3CCU P;  2A45 I;  3U59 A;  1I6E A;  2Y0D A;  1G2C A;  1MG2 D;  3Q5R A;  3L75 G;  2QSI A;  1ZW0 A;  3AE6 C;  1FI3 A;  2YCC A;  3L72 D;  3IFM A;  1NMI A;  3AE7 C;  1M1J B;  1JY3 O;  5CIF B;  5CIB B;  1SQP G;  4H44 D;  3M9H A;  3R2P A;  1K73 Q;  4U3F J;  2H7H A;  2XTS B;  5KKZ B;  1J1D C;  5AVV B;  1QVG O;  1JCC A;  1S5L V;  2H89 C;  3VN0 A;  2B87 A;  1FZA A;  3JCU E;  2C1V A;  1SQV G;  5AW3 B;  1FDI A;  3DR0 A;  2PP6 A;  3AEG C;  4XA4 A;  1A8C A;  1OMI A;  2B88 A;  2E74 B;  1CIG A;  3O5C A;  3OA7 A;  2XKM A;  1SQQ K;  2GA1 A;  1QVF O;  1NYH A;  4AAO A;  3CWB D;  2HYN A;  3D70 A;  1M6Z A;  3B4S A;  1LT9 A;  3E1I A;  2QVA A;  3H1L G;  1BSH A;  3CWB G;  1YQ4 C;  3H1L J;  3L36 A;  3CXH H;  1RE3 C;  1HJ3 A;  4UB6 H;  1NML A;  1HVV A;  1DEE G;  3ZCF A;  4U7J A;  1NTM J;  3PRJ A;  1URQ C;  1LJ2 A;  4PW9 B;  3H1L E;  1W5C T;  3OCD B;  2P10 A;  1KB0 A;  1GK6 A;  4HJG H;  5EFW B;  5E79 H;  3B5N B;  4AAM A;  5GTH H;  5IY5 1;  2B9B A;  1N90 A;  1DVV A;  3H1J J;  3CX5 I;  4W7Z A;  2OQQ A;  1URQ D;  4RES B;  3L37 A;  4O1Q A;  1OW7 A;  1FZC A;  2QJP C;  1I6D A;  1LTA C;  2E43 A;  4HB1 A;  2AI5 A;  3C8V A;  1NTK D;  2NPS A;  1NHL A;  3G4S P;  1FHB A;  2FYU G;  1Q2N A;  1TU3 F;  2FXO A;  1JMM A;  3A0B E;  5APW A;  1NTM K;  2JWA A;  1S5L X;  2JP3 A;  3RL0 g;  1YJ9 P;  3EQ2 A;  3CXH E;  5APQ A;  3SWS A;  4GT1 A;  4JPZ B;  1UIX A;  1L0L K;  1SFC B;  4IFD K;  4U3F G;  1SQQ E;  1H1O A;  3SWF A;  1ZN5 A;  3JBT B;  1PV3 A;  4HH2 A;  1QEX A;  2VRS A;  2C0W A;  3FXD A;  2ITA A;  1AOQ A;  2HPC B;  2C1D B;  2O01 N;  3FWL A;  1BE3 E;  1YNR A;  1P84 E;  1T3U A;  4DOJ A;  1HBW A;  2IFN A;  3BCC E;  1KIL C;  2OZ1 B;  5KTB A;  1KB9 D;  3GLM A;  1CHH A;  3V2P A;  1MG3 D;  2ZVN B;  1AJY A;  3M9Q A;  2SPZ A;  3D6Y A;  1VL2 A;  4H44 C;  3AE4 C;  5CMZ A;  1KB9 E;  1YTC A;  3K5B A;  1FS0 E;  1JDL A;  2LR2 A;  4C7N A;  1S2E A;  3Q2Y A;  1U57 A;  5TJH A;  2E75 B;  5AW7 B;  3V2N A;  1X0T A;  3P8C D;  3WMM 0;  1IFN A;  2PCB B;  4XYD B;  1RHZ B;  3H1K E;  4FAV A;  1X79 B;  1KIL B;  2WSF H;  3U1A A;  1LTJ B;  5APY A;  4NPE A;  1VPC A;  2ZXE B;  1H32 A;  5AVR B;  2GC7 D;  5CYT R;  1G2C B;  1H31 B;  2FYU K;  3MUD A;  1MUU A;  3BRT B;  1CRJ A;  2PAC A;  1I5T A;  1G1I A;  2BPB B;  3ZOX A;  2FFD C;  2H8P D;  4N78 D;  1GZL A;  2Q6Q A;  2JO1 A;  1L0N K;  2WZ7 A;  1DT1 A;  4UB8 H;  2BCC J;  1PL5 A;  5E79 E;  5GTH E;  3MIW A;  1PIX A;  2OAR A;  1HRC A;  1JB0 J;  5KLV E;  1B7V A;  2ZBO A;  1KIL E;  1JMB A;  2N9B A;  2Z4E A;  4AYC A;  1EDL A;  1GMJ A;  5BU8 B;  3NBT A;  1LT1 A;  1USE A;  2AXT H;  1QL3 A;  3EFG A;  4DJG A;  1SQB E;  3WC8 A;  5CIG B;  3MUD C;  2IZ1 A;  3CWB E;  2WWW A;  1RE3 A;  2LXC B;  2A45 H;  1NKN A;  1FZC B;  1KYO E;  5H2F E;  3A0B H;  1CRG A;  5AW6 B;  3WU2 E;  3KZI V;  5CBO A;  3CD6 P;  4RSZ A;  1LWU C;  2E42 A;  1IO4 A;  4PJ0 H;  1OFC X;  4OVN F;  3I55 P;  5GTI V;  3S1K A;  2QJY B;  1NTZ E;  2WSC J;  2KZI A;  2V08 A;  4BRY B;  4GYD A;  3T97 A;  2LXB A;  2E75 D;  2KLU A;  4L74 A;  3VTP C;  4LC1 A;  2E75 C;  5DJQ C;  3VOP A;  4K35 A;  4L3H A;  1ZZH A;  1J3S A;  3HE4 A;  2HFE D;  1IK9 A;  3SLE A;  1RF0 C;  2KZJ A;  2I8D A;  1PGJ A;  2E76 B;  4BRY A;  2IBZ I;  5GTI H;  2HPC A;  5AVT B;  3CWB J;  1FJP A;  1IRV A;  2QA4 P;  1OIP A;  3RK3 B;  1H0T B;  4ASW A;  2QM7 A;  3L70 E;  1SQX J;  1H33 B;  4ZMD A;  1CIH A;  2CPS A;  2DW3 A;  1KQL A;  2O3J A;  1SVF A;  2QJK B;  3HTK B;  1YIT P;  1SS1 A;  3HRN A;  1ZME C;  4WQE A;  2FXM A;  1FOS F;  5AVY B;  2RKL A;  3AE3 C;  1SQQ D;  3H1H D;  3Q5S A;  3OA8 B;  1HCM A;  1M1J A;  2Q5U A;  1GK4 A;  1H31 A;  1N8R Q;  2C0X A;  1VQ5 P;  1HWT C;  1PP9 J;  1NTZ J;  2E5Y A;  2B11 B;  1DD3 A;  1FZF A;  4WY4 C;  5BU5 A;  2C1D A;  1LTT C;  1NTK J;  3H32 A;  2QIW A;  2HLO A;  1LTB C;  1BSN A;  4N0K A;  5DFS A;  1JTH A;  3RL0 D;  3L75 D;  4I7Z C;  1KD1 Q;  1DW2 A;  2Y9Z A;  1YJN P;  3L72 G;  1LFM A;  1J1D B;  3P32 A;  3NWV A;  2BCN B;  4IFF A;  4WY4 A;  3H1J D;  2B89 A;  1LC2 A;  3WFD C;  1S9K E;  4KT0 J;  4H0L B;  1NGM B;  2AEF A;  2OYH B;  5EXQ A;  1CRH A;  3NBS A;  2CPB A;  4D6T E;  5APS A;  3L74 D;  1KZU B;  3H1H J;  2A06 E;  2ZYD A;  2N9J A;  4I7Z B;  1CRI A;  3I5C A;  4JCG A;  2RMZ A;  1M60 A;  4D6T D;  2KOG A;  3L35 A;  3H1I D;  5AVW B;  4MN4 C;  1KIL D;  1PPJ G;  3L74 G;  2CA3 B;  3E1R A;  3PXS A;  4KMG A;  3M0A A;  2OYH A;  1NKZ B;  1Q81 Q;  2WVR A;  2H43 A;  4OGQ B;  4QAO A;  4FA4 A;  3H1I J;  1ZRT E;  2JDI H;  3PH0 A;  1AOF A;  3T97 B;  1ZRT D;  3CCR P;  1IQC A;  3NMD A;  1M7L A;  1SQV K;  5DJQ B;  3CMA P;  1CXA A;  1QL1 A;  3LW5 J;  3LW5 H;  1EXJ A;  4JYB A;  4YXW H;  3BAT A;  1WEJ F;  2GUS A;  1IC2 A;  5CJ4 A;  1RF1 A;  2Q9I A;  2BCC D;  2C1U A;  1S4X A;  2BEQ D;  1GTW A;  2Z5I A;  3L74 J;  1H9Y A;  1OWA A;  1I8P A;  1FZG A;  3M0D C;  3CX5 H;  1CTZ A;  3CX5 W;  1OAE A;  3HD7 C;  4D6T J;  3H1K D;  5B6Q A;  4FA1 A;  1U7M A;  4PWA A;  3CXH D;  1VYD A;  4LLH A;  2O1J A;  1RAQ A;  1NVO A;  1QL2 A;  1IZN B;  3H1K G;  1J1E B;  1EDK A;  2N3B A;  1NTK G;  1RAP A;  5KAF E;  1AV1 A;  1Y47 A;  3SXT A;  4NPF X;  1RQU A;  2WTY A;  4YTP C;  4WQD A;  3CL3 D;  2XZR A;  1JNM A;  2YQB A;  1QGK B;  1M90 Q;  2HOD A;  5AW8 B;  1GKS A;  1GDT A;  1PP9 D;  1DEB A;  2HG5 D;  3L4F A;  1C6S A;  1PP9 E;  1U74 B;  1AYG A;  3KHU A;  4FA5 A;  1OXZ A;  2HOD B;  2ZT9 D;  2KSJ A;  4JF7 A;  2O01 H;  1URQ A;  3FGA D;  5KLI B;  4WY4 B;  1KB9 H;  1HH0 A;  3KYQ A;  1IO3 A;  3O0R C;  1YFC A;  3RL0 B;  3M97 X;  4GKG A;  3P8M C;  1Q90 D;  2C8S A;  1BGY J;  4GOD A;  1N73 C;  4PV1 C;  1SQB G;  1KOR A;  3WUU A;  1OZH A;  1Q86 Q;  3H1I E;  2KSE A;  1IFD A;  1SQX D;  1L0N E;  3OA8 A;  1VF5 C;  1Q7Y Q;  1JY3 N;  2OYI B;  1CI6 A;  1JM0 A;  1CCH A;  1SQX G;  3CX5 D;  3E7K A;  1ETP A;  1S72 P;  1YEA A;  1KMI Z;  1KQS O;  1L4A D;  2R5B A;  3WFB C;  3WU2 V;  1OW8 A;  3C1L A;  1CW5 A;  4IL6 E;  1S9K D;  1FOS E;  1CHJ A;  2E74 C;  3G6E P;  4GDO A;  2XDJ A;  4OH8 B;  1USD A;  1BL9 A;  3AEA C;  1COT A;  4LGD E;  4RO0 A;  1BCC G;  3RK3 C;  3R4Y A;  3BCC J;  3MP7 B;  3O1Y A;  3BCC G;  4R4M A;  3TK1 A;  1W2E A;  3CU4 A;  4KHX A;  1BCC D;  3AE2 C;  3FX0 A;  3TGU J;  1Y8A A;  4W7Y A;  1LP1 A;  2V07 A;  3BCC D;  1AQT A;  4ZKU A;  1MKM A;  5B66 V;  1VQO P;  2V7Q H;  1E2R A;  1AQ5 A;  2ZVO B;  1NJI Q;  1VDF A;  1IK7 A;  2KP8 A;  3SWY A;  2D0W A;  4XE5 B;  2ZXY A;  5M1B A;  1R5S A;  4OGQ C;  3CC2 P;  5KLV J;  3CCJ P;  1JY2 N;  2W8Z A;  4NFG B;  1EXI A;  1GW4 A;  2N18 B;  3B5N C;  3ZOW A;  1LC1 A;  1RF1 C;  2FYN B;  1OVU A;  1ZR4 A;  3IR9 A;  2KB7 P;  2Q3I A;  4AUW A;  4L75 A;  2ZFC A;  2FFD A;  4Y99 B;  5CCH C;  1GW3 A;  2PAJ A;  3L4O A;  3AEE C;  2Q7C A;  1CRC A;  3IN6 A;  3A7O A;  1CIF A;  1NTZ D;  1KQG B;  3OJA B;  1YIC A;  1KC8 Q;  2BH5 X;  5KJ7 A;  3DMI A;  4GOF A;  4WWI A;  2ZON G;  1F1F A;  2YO2 A;  3CC7 P;  5KLV K;  2PGD A;  1LWU B;  4O1W A;  4C46 A;  1X8Y A;  2GM4 A;  2FBW C;  2MJZ A;  2B10 B;  5CJ0 A;  4ZKP A;  5K5G B;  1N7S D;  3P7K A;  3M06 A;  3L73 J;  3LID A;  1EZV D;  1NIR A;  3CP5 A;  2B12 B;  1CTJ A;  1T8Z A;  2WSS H;  3A3Y B;  1N9C A;  3H1L D;  1C75 A;  2N3Y A;  3PLN A;  3VMY A;  3L70 J;  1DIP A;  1KV9 A;  5CCG C;  2BGV X;  1JUN A;  4YPC A;  1HJ4 A;  1KX7 A;  1K04 A;  1LTS C;  1SQB K;  2WPQ A;  1A02 F;  1CYC A;  3X39 A;  4PD4 E;  2ORL A;  1SQV J;  3ZOY A;  1L4A B;  1PPJ E;  2POH A;  3KZI H;  2Q1K A;  2K88 A;  5CCH A;  2R32 A;  4LJI A;  2RH0 A;  2FYU J;  3VMX A;  3WU2 H;  5TIS E;  1SFC C;  1W2B O;  1DIQ C;  3QWO C;  1SQP J;  1VQ8 P;  1KN7 A;  1M1J C;  3A0H E;  3FXE A;  1WT6 A;  3CXH W;  2XV5 A;  1E79 H;  1GD2 E;  5H2F H;  1PGP A;  1KFN A;  3SWK A;  1CHI A;  1JEK A;  4HYT B;  1HGZ A;  1RE4 C;  3W67 A;  5B5E H;  2BCC E;  2OTL P;  4RKU J;  4GOE A;  2QJK C;  2AXT E;  1QL4 A;  1NTM G;  1OVR A;  1EB7 A;  2KS1 A;  3CXH I;  1OW6 A;  3TGU E;  3HE5 B;  1RZ6 A;  3L73 G;  1KTM A;  3H6P A;  1J2J B;  1WMK A;  1BCC J;  2OTK E;  3A0H V;  5AVX B;  1SQP D;  2IYP A;  1C2R A;  3SFE C;  1HJ0 A;  2NPS B;  4XFJ A;  3WUV A;  2XNX A;  3HQ8 A;  5CHX A;  1FZB A;  1OX3 A;  2UWJ E;  5KAI E;  1SQV D;  2NPS C;  3TYY A;  3HQ6 A;  1SFC A;  3SFD C;  2PCC B;  2IZ0 A;  3CME P;  1CSU A;  3MHV A;  3PJS K;  1N86 A;  1NAF A;  2N1T C;  2WSE J;  1T3J A;  3ZBM A;  1VQ7 P;  2ZYG A;  1CO6 A;  3NFQ A; 
#chains in the Genus database with same CATH homology
 1ZRT D;  1NMI A;  5CIF B;  5CIB B;  1IQC A;  4EIE A;  451C A;  5E79 V;  5GTH V;  1DW3 A;  5B5E V;  1CC5 A;  1GJQ A;  4H0J A;  1C52 A;  5DJQ B;  2DVH A;  2XTS B;  5KKZ B;  3ORV A;  1S5L V;  1CXA A;  4WQB A;  4L1Q A;  1CYI A;  1HH7 A;  2C1V A;  2C2C A;  4XXL A;  4WQ7 A;  1WEJ F;  3DR0 A;  1FOC A;  1A8C A;  1KYO W;  2C9X B;  2BCC D;  2C1U A;  1CIG A;  4WQC A;  1H9Y A;  3O5C A;  1I8P A;  4V2K A;  4YE1 A;  5C0Z A;  1CTZ A;  3CX5 W;  1OAE A;  3H1K D;  5B6Q A;  4FA1 A;  1LS9 A;  4PWA A;  3CXH D;  4AAO A;  1GDV A;  3TF5 A;  3CWB D;  1VYD A;  1RAQ A;  1M70 A;  4FAN A;  1M6Z A;  1YCC A;  2HV4 A;  2N3B A;  3PXT A;  1H9X A;  1RAP A;  3SXT A;  3PTZ A;  1HJ3 A;  3VMA A;  1NML A;  1CYJ A;  4WQD A;  3ZCF A;  4WQA A;  2YQB A;  1F1C A;  3PRJ A;  2L4D A;  2B0Z B;  4PW9 B;  1GKS A;  1PP9 D;  1W5C T;  3OCD B;  1KB0 A;  1C6O A;  1YEB A;  1C6S A;  4AAM A;  1U74 B;  5IY5 1;  1AYG A;  3KHU A;  4FA5 A;  1N50 A;  2Y0E A;  1DW0 A;  1N90 A;  1DVV A;  2L91 A;  2LIR A;  4O1Q A;  4Q5P A;  1I6D A;  5KLI B;  3WFE C;  1CSV A;  2LIT A;  1CXC A;  5CIE B;  1IO3 A;  3O0R C;  1YFC A;  2AI5 A;  3M97 X;  3ZOO A;  1NTK D;  1MZ4 A;  2C8S A;  4J20 A;  1FHB A;  1A2S A;  3A0B V;  3L4M A;  2JWA A;  3HQ9 A;  3TDK A;  1SQX D;  5TIS V;  3OA8 A;  2RN0 A;  3SWS A;  1COR A;  1GIW A;  3VRD A;  1H1O A;  1CCH A;  3JBT B;  5KLV D;  3CX5 D;  2JTI B;  2CE0 A;  1ETP A;  1L9J C;  1YEA A;  4FB1 A;  1GQ1 A;  1CED A;  1AOQ A;  1L0N D;  3WFB C;  1FCD C;  2C1D B;  3FWL A;  3WU2 V;  4H0K A;  4AAL A;  1HZU A;  4K3I A;  1YNR A;  3SVW A;  1DII C;  4IL6 V;  1E8E A;  2OZ1 B;  2N18 C;  3ZIY A;  1KB9 D;  4EIF A;  1CHH A;  1CHJ A;  1MG3 D;  2FYU D;  1BL9 A;  1COT A;  4AX3 A;  1YTC A;  1L0L D;  1JDL A;  1OCD A;  3O1Y A;  5TJH A;  2GB8 B;  1DW1 A;  3CU4 A;  1NU1 D;  1BCC D;  4U3F D;  3RN1 A;  2EXV A;  2PCB B;  1IRW A;  2V07 A;  3BCC D;  4XYD B;  4FAV A;  4MU8 A;  1CNO A;  3ITK A;  5AUR A;  1QN2 A;  1U75 B;  2DGE A;  5CIH B;  5B66 V;  1K3G A;  1E2R A;  1H32 A;  2GC7 D;  1KIB A;  5CYT R;  1FJ0 A;  1PPJ D;  1H31 B;  3L73 D;  4EIC A;  1CRJ A;  2D0W A;  1I5T A;  2PAC A;  1KX2 A;  2MHM A;  2FRC A;  2BPB B;  4EDF A;  2ZXY A;  3PH2 B;  2D0S A;  2CXB A;  3ZOX A;  1AKK A;  4DY9 A;  1E29 A;  1CIE A;  1DT1 A;  3L70 D;  4NFG B;  2N18 B;  4EID A;  3RMZ A;  1HRC A;  3ZOW A;  1LC1 A;  3RN0 A;  1B7V A;  1LMS A;  2VHD A;  2KNC B;  3MK7 C;  2FYN B;  1BE3 D;  2ZBO A;  2GIW A;  351C A;  2FWL A;  4PD4 D;  3A9F A;  1KYO D;  5C9M A;  1C2N A;  3MK7 B;  3NBT A;  2MTA C;  1QKS A;  1GU2 A;  3L4O A;  2QG4 A;  1FI7 A;  1QL3 A;  3WC8 A;  3PXW A;  1CSW A;  5CIG B;  1CRC A;  1CIF A;  1NTZ D;  3TGU D;  1YIC A;  1CRG A;  2ZOO A;  2BH5 X;  3DMI A;  2ZON G;  1F1F A;  3KZI V;  3PHL A;  3HQ7 A;  2K9J B;  2AIU A;  4RSZ A;  4O1W A;  1P84 D;  5GTI V;  1W2L A;  2B10 B;  2QJY B;  3WFC C;  1C7M A;  2V08 A;  4GYD A;  1EZV D;  1HZV A;  3L71 D;  1NIR A;  3CP5 A;  2B12 B;  1NNO A;  4AAN A;  1CTJ A;  5DJQ C;  4GED B;  4WQ8 A;  1N9C A;  2Y0C A;  4L3H A;  2BLF B;  3H1L D;  1FI9 A;  1ZZH A;  1J3S A;  1C75 A;  2N3Y A;  2N9Y B;  2QJP B;  3PLN A;  3SLE A;  2JQR A;  1KV9 A;  2BGV X;  3OCD A;  1HJ4 A;  1KX7 A;  1IRV A;  2YK3 A;  2IBZ D;  1I8O A;  1CYC A;  3X39 A;  5H2F V;  1H33 B;  1YIQ A;  1HRO A;  2ORL A;  1CIH A;  3GG2 A;  4P4Q B;  3ZOY A;  2O3J A;  3VNW A;  2A06 D;  4LJI A;  2QJK B;  1NTM D;  4FA9 A;  4RJT A;  1DVH A;  1H33 A;  3C2C A;  4UB6 V;  2YIU B;  1WVE C;  1DIQ C;  1A56 A;  4WQE A;  1SQB D;  1SQQ D;  3GW6 A;  3H1H D;  2GC4 D;  2BH4 X;  2ZZS 1;  1IZL 0;  3OA8 B;  1HCM A;  1K3H A;  3VYM A;  3CXH W;  1H31 A;  2B4Z A;  2CE1 A;  5CID B;  2B11 B;  4L3G A;  5DF5 A;  2C1D A;  1BGY D;  1S6V B;  2CA4 B;  3O20 A;  1CHI A;  1L9B C;  4N0K A;  5DFS A;  3L75 D;  2OZ1 A;  5CIC B;  1QL4 A;  2N9I A;  2Q3E A;  1DW2 A;  1LFM A;  1EB7 A;  1CRY A;  4Y5R A;  3NWV A;  2KS1 A;  2BCN B;  155C A;  3H1J D;  1RZ6 A;  1CTY A;  2AXT V;  1LC2 A;  3SJL A;  3WFD C;  4WQ9 A;  3A0H V;  1SQP D;  1C2R A;  5EXQ A;  1CRH A;  3NBS A;  3CYT I;  3L74 D;  2I8F A;  3RLM A;  5KAF V;  1HJ5 A;  2N9J A;  1CRI A;  4JCG A;  4PJ0 V;  2RMZ A;  1C6R A;  1I54 A;  1R0Q A;  3HQ8 A;  1M60 A;  4D6T D;  1RZ5 A;  3DP5 A;  4A7P A;  3H1I D;  1QYZ A;  4UB8 V;  1CSX A;  2CA3 B;  3PXS A;  4KMG A;  3TYI A;  1H32 B;  1SQV D;  3HQ6 A;  5KAI V;  2PCC B;  1I6E A;  2Y0D A;  1CSU A;  1MG2 D;  4QAO A;  4FA4 A;  1I55 A;  3ZBM A;  1FI3 A;  2YCC A;  1AOF A;  1CO6 A;  1CCR A;  3WUI A;  3L72 D;  1N15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...