2IBZE

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
total genus 45
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2ibzE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2ibzE02
4NBAD 1SQXE 1VCKA 1VM9A 3GB4A 2E4PA 4NBBD 4NBDD 2XSOA 1P84E 1G8JB 2CKFA 3N0QA 3L73E 4HKVA 2NUMA 3H1HE 3FOUA 4OGQD 3CXHE 2DE5D 4AIVA 4QDFA 4U3FE 2A06E 1ULIA 4QDCA 3GZXA 2XR8A 3TGUE 5AEWA 3EN1A 4HM1A 4NBED 2NWFA 4PD4E 4HM3A 4HJLA 4QDDA 3L72E 3CWBE 1L0NE 1SQQE 2ZYLA 3L74E 3GOBA 1SQPE 2HMLA 3H1IE 2B24A 2FYNC 3CX5E 4HM7A 4NBGD 1NU1E 4NBCD 4P1CH 4QUPA 4NBHD 3GZYA 3H1KE 2GBXA 2BMQA 2YFIA 3GCEA 1SQVE 1O7GA 2BMOA 2JO6A 3C0DA 1ZRTE 5BOKA 4P1BH 3VMHD 1O7PA 1VF5D 1SQBE 2HMOA 3VMID 2NUKA 2Q3WA 2XSHA 2HMMA 1NDOA 1SJGA 1PP9E 2FYUE 2YFJA 2YIUC 1O7WA 3GTSA 4HM4A 1RIEA 1UUWA 1UUVA 3VMGD 2E4QA 2JZAA 2QPZA 1FQTA 1BGYE 2YFLA 4PV1D 4NB8D 2B1XA 5KLVE 2QJYC 4HM2A 2IBZE 2NVEA 1L0LE 1NYKA 2E75D 1KB9E 3GL0A 1NTME 3EQQA 2NVGA 4HM0A 2ZT9D 1JM1A 2GBWA 2HMNA 1O7MA 2YVJB 4H13D 1ULJA 2QJKC 5AEUA 1G8KB 2BMRA 5CXMA 2HMKA 1O7HA 4QUQA 3L70E 1BE3E 2E76D 1EZVE 4EMJB 4NB9D 3L71E 1O7NA 1EG9A 2DE6D 3L75E 1WQLA 3AZCA 4HM6A 2HMJA 1RFSA 3BCCE 3GTEA 2BCCE 4HM8A 3D89A 1PPJE 3GL2A 2E74D 2NVFA 4QDFB 2D2CD 4HM5A 3VCAA 4QURA 5KLIC 5HL4A 4AAYB 3H1JE 4H44D 4NBFD 1NTKE 4D6TE 4QCKA 2XRXA 3VCPA 5KKZC 1BCCE 3H1LE 1Q90C 1NTZE 2DE7D 4H0LD 1KYOE 2QJPC 3GKEA 2I7FA 3DQYA
chains in the Genus database with same CATH superfamily
4GOEA 1GD2E 4WBAA 3L75G 1LP1A 1P84E 1HF9A 4KHXA 1XTCC 3RK3C 2E5YA 2DE5D 4DCKA 2M5AA 3HE4B 1L4AD 5APSA 3WUVA 1LTBC 4I7ZC 1JCCA 3GMAA 1M90Q 3H25A 2Q7CA 2Q3EA 1KYOD 2K3RA 2IPPA 2GBXA 4L75A 3GCEA 2KYVA 1LWUA 3CL3D 1NTKK 2WSCH 3MIWA 5BOKA 1RE4C 1SQBE 1NU1D 1LWUB 3VMGD 2LXBA 3EQQA 1JM1A 2NPSC 2WSFH 3D71A 3R4YA 1VQPP 1LTIC 3AE3C 1PGOA 2W27A 2FYUK 2OYOA 1OX3A 2IFMA 3KHUA 3PH0A 5C39A 1RFSA 2Q5UA 3L73G 1OXZA 2ZFCA 1YTZI 5KLIC 2OYHC 1NTZE 1PZQA 3M0DC 3A2AA 3USSA 3AEAC 1M1KQ 1J1EB 1S5LH 3WU2H 2WPVB 2DW3A 2Q6QA 5APWA 3CCUP 1N7SD 2XKMA 3TGUJ 3BCCJ 1NH4A 3II6A 5H2FE 4QDCA 2WT7A 2NZ2A 3GF7A 5AEWA 3TGUG 5KJ7A 4HH2A 4R4MA 4NBED 4YXWH 1OMIA 1FJKA 1L0NE 1BCCD 3L74E 1G1IA 2IBZG 3KZIE 3H1KE 4AQRD 5KAFH 1KQGB 3CCJP 2XDJA 3HUSB 5BVZA 1PP9J 3H1ID 1PP9G 1T2KC 1RE3C 1SFCA 3L74G 3HUSA 4BRYA 4PV1D 4HM2A 3H32B 2IBZE 2WPRA 3P8MC 2K9YA 1LTJB 1AVOA 1VQMP 1OWAA 1BE3E 1SQVD 3H1JD 1O7NA 2P58A 2D2CC 1EG9A 1YQ4C 3L75E 2WMMA 2HYNA 4IL6E 3C1LA 2PP6A 1RF1A 1PGQA 2POHA 4QMAA 4QURA 3RL0B 1NTKE 1L0ND 1SQPD 2XNXA 2C9NY 4H0LD 2J58A 4NPEA 4OVNF 5CBNA 1KMIZ 1KQFB 4AYCA 4HKVA 3GHGC 1K04A 2K9JB 2Y0DA 3VN0A 2KI7B 2JWDA 4IFMA 1OZHA 5AVSB 3TDKA 1S2EA 3L72J 2OYHA 2M5AB 2QJPB 3H1IE 2PGDA 2O3JA 2B87B 1MV8A 1W2EA 2YO3A 1BE3D 1NU1K 1MFZA 2OTKE 2A45G 2N1TB 1FDMA 2QM8A 4OH8B 2Z4EA 3N7NA 3HD7A 2QPZA 3H1IG 2N1TA 1SQVJ 1YQ3C 2P2UA 2QJKB 3W67A 1ZR4A 1SQQD 2HMNA 2WVRA 4JQ0D 1O7MA 4U3FG 1OW8A 3CLQA 3PJSK 1NTKD 3RK2B 1VQKP 2WSEH 3AE4C 3BCCE 2BCCE 4C7RA 5E79E 3BATA 1SFCD 1JY3N 1BDCA 5APUA 4HM5A 3RGUA 1IFDA 3ABVC 1KN7A 3RK3B 2ZYAA 2A45I 2XRXA 5KKZC 2KXPB 3LW5J 1BCCG 3P8CE 2IYOA 3FWLA 2P7JA 1VQ6P 2LXCB 5APTA 1L2PA 4H44C 2R44A 1VQ5P 1PL5A 1G2CA 2AEMA 2J5UA 2KNCB 2KP8A 4DJGA 3EN1A 1G2CB 1P84D 1S9KD 5M1BA 1KB9D 2WT7B 1SQQE 3GOBA 3G3ZA 5CJ4A 2PFXA 2L91A 3TGUD 4O9BA 1JMBA 2E75B 2E76C 2ZXEB 2RH0A 1HVVA 5KJ7D 4I2LC 4C7NA 3O6QB 2KZIA 4JPZB 2YIUC 1SQQG 5CCHD 3KXDA 2QVAA 1U57A 2E74B 5L8RJ 4NB8D 1M1JA 1IFNA 2GBWA 2WWWA 3PLNA 1KILE 1PP9D 1EXJA 1UIXA 3H1KJ 3AEGC 1EDKA 1WQLA 4BXLA 3HE5B 2WSFJ 5CMZA 3E1IA 4L76A 3L70D 1HGVA 2Y0EA 3GHGB 4PJ0E 3O8ZA 5CJ0A 2ZYDA 2H8PD 1Y47A 1WT6A 3CX5D 3HRNA 4NBAD 1SQBK 3FWNA 1DD4A 1S1CX 5AVTB 5EFWB 1FS0E 3IAOA 1D7MA 1OVVA 4CPGA 3H1LJ 1RQVA 1IZNB 4QDFA 3SFEC 2E5TA 1T3UA 3TSIA 2JJLA 4RKUJ 1RH5B 4HJLA 1L4AC 3CWBE 3HE4A 3MP7B 2W83C 2Y9YA 2FYZA 1M8OB 2JO6A 1OW6A 1LTJC 2B9BA 2E43A 3VMID 1BGYJ 2XU6A 2Q3WA 1KILD 2XSHA 1ZP0C 2W8ZA 4HB1A 1LNQA 2YO2A 2JZAA 4ASWA 1BGYG 3I56P 4N78D 2P10A 4HJGH 4PD4D 3N4XA 1GK4A 2FXPA 2KLVA 2A06G 1PGJA 1URQD 2E76B 1M7LA 1LTJA 3B8EB 2BMRA 3RL0C 2YKPA 1GU5A 3L75J 4NB9D 2QJYB 1N73B 1S5LE 2M3BA 1X8YA 3D6ZA 4I1LA 2DE6D 2IZ1A 2QA4P 3VCAA 2H43A 3VCPA 4A7PA 1KFNA 1JMMA 1VL2A 1IFPA 4K35A 3KZIH 3N0QA 1EZVD 1FOSF 2D2CB 1HGZA 4H0LC 1KTMA 2E42A 2FFDC 3AE7C 3RK3E 1IFIA 1GL2A 1ULIA 2KUBA 4PD4E 2GA1A 1GL2B 3WMM0 2YIUB 1FZGA 1VQOP 3MZWB 3JC22 4L73A 3S1KA 4W7YA 1BDDA 3M9BA 4BWNA 1JO5A 4UB6E 3UIAA 1YJNP 1O7GA 1FZCA 3B5ND 4N78E 2HFED 3C0DA 4EYYQ 2BEQD 3RBXA 4HM4A 3GTSA 3V2QA 1UUVA 2FYNB 5CBOA 1Q90D 1NTMJ 2O01N 2QEXP 1FZEA 1NYKA 3GL0A 3TNUA 1G1JA 2KSEA 1DEEG 3AE5C 1OVUA 5KAFE 4GKGA 2CPBA 3JSVC 1EZVE 1NTKJ 4D6TD 1KC8Q 3U1CA 1X9VA 5TJHA 1JY3P 3Q3DA 1PPJE 2FYUD 2I8DA 5HL4A 1FZBA 2M0BA 1LT9C 4PD4I 3TF5A 3WUTA 3RK3D 2O01H 2Z5IA 3CCLP 1EDJA 2E4PA 1URQB 2V7QH 2B87A 2FY8A 1SVFA 3JCUH 1Q2NA 5CCGC 5GTIH 1QEXA 1YHQP 3V2NA 3L70G 1VQ7P 1X22A 1N7SC 1IK9A 1FBMA 4QDDA 2JO1A 3CD6P 1M57D 1QL1A 2K1AA 1JOCA 2KS1A 3AEFC 3GZYA 4WWIA 1SQVE 1AFOA 5APVA 1ZRTE 4EDFA 2N1TD 1OFCX 1YITP 2ZXXA 1AA0A 2HMOA 5B66E 4C7NB 1DEBA 4PD4H 3R2PA 4R4LA 1Z56A 1CI6B 5E79H 1E5WA 3VMYA 2XV5A 2YKQA 3A3YB 3QH9A 2E75D 1RF0C 4HM0A 3L74D 1FE6A 2K37A 4UB6H 1PPJD 4H13D 5B5EH 1BGYD 2BASA 4QUQA 3KPEA 1PGPA 1FZCC 1VPCA 3B5NB 1T6AA 1GW4A 2RKLA 3AZCA 4Y28J 3T97B 1FZAA 2KOGA 4OGQB 2ZT9B 2NPSB 1HUCA 3A0HH 3K5BA 2J59M 3H1JE 4H0LB 3L75D 1VQ9P 3LIDA 2IX7C 1YJ9P 4U3FD 3OAKA 3MTUE 2IBZI 2O01J 3ZDMA 1GL2C 1VF5C 2RN0A 1HBWA 2I1KA 2QG4A 1A02F 1SQBD 1NKZB 3H1HE 1JUNA 2ZYGA 5KAIE 2V7QJ 3GZXA 2H88C 3RK2D 1H89A 3V4QA 1GL2D 3M9QA 3FXEA 3PRJA 4TT3H 2Y9ZA 3B5NA 4HM1A 5AVZB 5AW4B 1LTTC 1KD1Q 3L71G 4HM3A 2KNCA 1RF1C 1YBKA 1SQPE 3RL0D 2HMLA 3NXSA 2FYNC 1VDFA 4L74A 1IC2A 1NAYA 2O1KA 1J1DC 5GTIE 2PAJA 1N8RQ 4D6TG 4WY4A 1N7LA 1EDIA 2BCCD 3CXHD 4WB4A 1UUWA 2E4QA 1FQTA 1LTAC 1RF1B 1L0LG 3CC4P 4H13C 2ZVNB 3HUSC 1K05A 3M0DA 3MD0A 2FFDA 4PJ0H 2XZRA 3U59A 1PFIA 2YVJB 1U7MA 5AEUA 1G8KB 1KYOI 2M3EA 2WSCJ 4JYBA 2HG5D 2JDIH 1NTMD 3AECC 3G4SP 1IO4A 3L4FA 1FOSE 2E74D 1H0TB 2WSEJ 1KB9H 1S9KE 3IFMA 3NFQA 5AW6B 1TU3F 3H1LE 3BCCD 1U7JA 3AE2C 3DQYA 1KFMA 3U1AA 2V4HA 1VM9A 1N73C 5AW3B 1FJPA 3CWBJ 3P8CD 3CXHE 4AIVA 1A02J 3VP8A 3B4SA 3SFDC 2FXMA 1ZXGA 3PP5A 4IOIH 2L5GB 2ZYLA 1DX7A 4RO0A 1LP1B 2H7HA 5DJUB 2IBZD 2K9JA 5KAIH 2N9BA 1SQXK 1AV1A 1DH3A 2SPZA 1GK6A 1NYHA 2JKVA 3WUUA 3B5NC 1M1JC 1HJ0A 4JBZA 2NVEA 3H1JJ 2WTYA 3CX5H 3H6PA 2NVGA 2QIWA 1RQUA 1Q81Q 4YXDC 3G6EP 1GZLA 1M56D 5CXMA 2QM7A 3PTZA 3CCMP 1OW7A 4EMJB 1YJWP 1J2JB 2IFNA 4JF7A 1NVOA 1LWUC 4IL6X 3P7KA 4EIJA 3CXHI 2D2CD 5BU8B 3KDPB 4MN4C 3D70A 3HTKA 3AE9C 1LGHB 5KLVD 3L71D 4YPCA 3CWBD 1Q90C 1VQLP 1S4XA 2DE7D 2QJPC 3GKEA 2ZVOB 2B88A 3KYQA 2Z5HA 1KILC 1YYCA 4PV1B 1R5SA 1CZQA 1W2BO 2OGUA 5KLIB 4EI2A 1R5LA 4H44B 3SWYA 1L0LD 1LT9A 2B24A 2YNYA 1T3JA 1P84H 3A0BE 3MHVA 1KORA 2BMQA 1E79H 5TISH 2R32A 1USEA 1RHZB 1O7PA 1SQBG 5AW1B 3Q2YA 1NOHA 3G71P 3M91A 5AVQB 3S9OA 1QVFO 5KLVE 4Z1MH 1N7SB 3V2RA 1NU1G 3AE1C 3D6YA 2ZT9D 5DJTB 4HKZH 2OYIB 1KZUB 2KIKA 5GTHE 1LTGC 3BRVB 5KLVJ 4W80A 3BRTB 3C9IA 1BSHA 5CCGD 5AW0B 5KLVG 3BCCG 1JY2P 2YXRB 2WQYC 3JCUE 2YXQB 3M06A 4ZMDA 1KQLA 1HWTC 4IFDK 4NBFD 4QCKA 1IFMA 1NTZG 2JWAA 2OYIC 3E7KA 3QWOC 1FU1A 1YIJP 3GHGA 2VRSA 1S3JA 3GB4A 1SQPK 4NBBD 1K9MQ 4NBDD 2XSOA 3H1HJ 4HYTB 2LR2A 2R3CA 4ASVA 2NUMA 3HD7D 4U3FE 3CCVP 3TGUE 3V6IA 5B66H 1OIPA 1Y9BA 4GIFA 1L0NG 1BCCJ 1S72P 5AW8B 1J1EC 2C0XA 1JB0J 4HM7A 2ZAEB 4NBHD 1SFCB 2AEFA 3ITKA 3AEDC 1ZR2A 4DT0A 4UB8H 5H2FH 1AQ5A 1NTKG 2OTJP 4GT1A 3CCRP 1JTHB 1CW5A 1L4AB 2JEEA 2HMMA 1GW3A 1NDOA 1PP9E 4XA4A 1ZMEC 3TYYA 4GOFA 3VMZA 2JR8A 3V5BA 1YI2P 3O6QA 1P84I 2OARA 3L72D 1KB9I 4N3YB 5K5GB 2KZJA 1JY3O 3C8VA 3FX0A 3BVHA 1Q86Q 3H1KD 1O7HA 1BE3G 1SQQK 2Q9IA 2FYUG 1BE3J 3CC7P 2HMJA 2C0WA 3SWFA 1QL2A 2C9LY 2YMYA 2NVFA 3Q5PA 3L70J 4H44D 3EWKA 1JTHA 1OVRA 1L4AA 5B5EE 1KYOE 1MFTA 5AVXB 3RK2C 5CCHC 3A0HE 4U7JA 4Y99B 3E1RA 1RE4A 2NRGA 4DOJA 1JY2N 1H88A 3VP9A 2E74C 5AVWB 3AEBC 4OWFA 2G3AA 3SWKA 3TNUB 5AVVB 1NU1E 3CX5I 1JNMA 1SQXD 2B89A 1HH0A 1GDTA 1NO4A 2BMOA 3CMAP 4GDOA 4BRYB 2AXTH 1SJGA 4OGQC 1ZN5A 1SS1A 1MKMA 4DZOA 2WSSH 3BASA 2FXOA 1L0LJ 1VQ4P 3CCQP 1ULJA 3VOPA 4WY4D 1KV4A 2Y0CA 5AVYB 3Q1MA 2HMKA 1FAVA 1W5CE 1VF5B 2FKWB 4ZNCA 2XNDH 1NTZD 2BCCG 3RBZA 3IF4A 1AQTA 3CXHH 1DD3A 1EDLA 1BCCE 4KT0J 3M0AA 1SQXE 2N1TC 3FGAD 5CCGA 2CKFA 1PIXA 1T8ZA 2KB7P 4ZKUA 3Q5SA 1FZFA 4YTPC 1SQXJ 3IR9A 1JM0A 1LJ2A 1ZOYC 2W90A 2NWFA 3A7OA 2IYPA 1URQC 1CI6A 1KYOH 1SQXG 5APXA 1FDIA 3OW2O 3MUDA 2LKMA 1VQ8P 1Q82Q 1EQ7A 4QUPA 4NBCD 2OQQA 1JEKA 1URQA 1NWQA 2GUVA 5AVUB 3VYIA 2AXCA 3EFGA 2YFIA 1IJDB 1KILB 4PV1C 3GLMA 3VMHD 2IZ0A 3H1HD 3B71A 2R3SA 5APQA 2YFJA 2FYUE 2A06D 1KILA 1RF0A 4KJMA 1AJYA 2NPSD 2Q1KA 4WVZA 2W6AA 1PV3A 1LTSC 3V4WA 1UIIA 2WITA 3HTKB 3LW5H 2KS1B 4XFJA 3NMDA 2HODB 3HD7C 1R8EA 2MJZA 3L73J 3CWBG 1QVGO 4HM6A 2OYIA 3GTEA 4HM8A 3WU2E 1L0NK 3I55P 1NTMG 3A5TA 4I7ZB 3CCEP 4N6JA 5AW5B 1USDA 3MUDC 2E75C 3TK1A 5AW9B 2R5BA 3CCSP 1G8JB 3A0BH 1ZRTD 2OTLP 1MZ9A 3H1LD 3AEEC 4GODA 3VMXA 1FZCB 1K73Q 1S5LX 2A06E 3M9HA 1NJIQ 1ZW0A 2A45H 3W68A 3VTPC 2QSIA 1NGMB 1EZVG 2I1JA 2ZT9C 3CMEP 3EQ2A 3EFFK 1EXIA 3P32A 3L36A 4IFFA 3PHLA 1CSBA 4XE5B 1YTZT 1VF5D 1FC2C 3L74J 2IDBA 5CCHA 1M1JB 3IN6A 1RIEA 2M8RA 4C46A 4WY4B 3HE5A 3L72G 1BGYE 1H0TA 1HJBA 5CHXA 4IL6H 3CI9A 1KQSO 3Q5RA 4W7ZA 2AEJA 4NPFX 1QX8A 2BEZF 5TISE 2QJKC 1RE3A 1SFCC 1EZVI 2PRRA 2KLUA 2UWJE 1HTLC 3S4RA 5BU5A 2G8YA 1N2DC 1ZLLA 3H32A 4QDFB 3V2PA 1NAFA 3F5HA 2KSJA 1SQVG 2WPQA 1EC5A 1DIPA 3OA7A 1SLQA 5GTHH 1N86A 1NTZJ 1BSNA 1LT1A 1VCKA 1NHLA 3KQGA 2Q3IA 1SQVK 1T2KD 2OYHB 1GU4A 1SQBJ 3H1HG 1L0LK 1NTZK 3GW6A 4I6MC 2P67A 4Y99C 1MUUA 2O1JA 1QLED 2YMKA 1NU1J 3L37A 2R5DA 4P1CH 4M3LA 2QRXA 4LGDE 1JCDA 3CPWO 3H1IJ 2NUKA 1GMJA 2W6BA 1O7WA 3SSUA 5KJ7C 5KLVK 2QJYC 5KTBA 2NPSA 1L0LE 5AW2B 1KB9E 4U3FJ 1NTME 3F89A 1Y8AA 4TLFA 2JP3A 1JY2O 4UB8E 1N73A 3L70E 2E76D 4D6TJ 2YKOA 3NTNA 4ZKPA 2KK7A 1PPJG 3D89A 2WZ7A 2FYUJ 2P1JA 1WMKA 1SQQJ 2H89C 3GG2A 1X0TA 3LIEA 5AVRB 4RJTA 1K8AQ 1NKNA 1XTGB 4D6TE 2CPSA 2FBWC 2N9YB 2CK3H 1L0NJ 1IFJA 2GUSA 2W6JH 3T97A 2WPSA 1FDOA 3L73E 1NTMK 4OGQD 3FOUA 1Q7YQ 3MGNA 2XR8A 4LC1A 2AXTE 2HLOA 3I5CA 1AVYA 4RESB 3L72E 4H13B 1RY3A 4WY4C 3CX5E 4NBGD 3AE8C 3G9RA 3H1LG 4P1BH 2MKVA 4JYCA 1VQNP 2GM4A 4NPDA 4B86A 4AUWA 2K88A 1LT9B 2YFLA 2B1XA 2HR3A 4K3AA 2HPCA 3RL0g 5KKZB 3H1KG 3L35A 2ITAA 3FXDA 1J1DB 2HPCB 1SQPJ 3L73D 2HODA 3L71E 1H8AA 3VMAA 1SP4A 4EOTA 1SQPG 4LLHA 3HD7B 1ZV8A 5APYA 3GL2A 2RMZA 2BCCJ 1N7SA 3AE6C 3H1JG 4AAYB 1IK7A 3OJAB 2FFDB 3L71J 1QGKB 3GF3A 5AW7B 1WRGA 2QE7H 1GTWA 1X79B 2ZJSE 3CC2P 2I7FA
chains in the Genus database with same CATH topology
4NBAD 1SQXE 1VCKA 1VM9A 3GB4A 2E4PA 4NBBD 4NBDD 2XSOA 1P84E 1G8JB 2CKFA 3N0QA 3L73E 4HKVA 2NUMA 3H1HE 3FOUA 4OGQD 3CXHE 2DE5D 4AIVA 4QDFA 4U3FE 2A06E 1ULIA 4QDCA 3GZXA 2XR8A 3TGUE 5AEWA 3EN1A 4HM1A 4NBED 2NWFA 4PD4E 4HM3A 4HJLA 4QDDA 3L72E 3CWBE 1L0NE 1SQQE 2ZYLA 3L74E 3GOBA 1SQPE 2HMLA 3H1IE 2B24A 2FYNC 3CX5E 4HM7A 4NBGD 1NU1E 4NBCD 4P1CH 4QUPA 4NBHD 3GZYA 3H1KE 2GBXA 2BMQA 2YFIA 3GCEA 1SQVE 1O7GA 2BMOA 2JO6A 3C0DA 1ZRTE 5BOKA 4P1BH 3VMHD 1O7PA 1VF5D 1SQBE 2HMOA 3VMID 2NUKA 2Q3WA 2XSHA 2HMMA 1NDOA 1SJGA 1PP9E 2FYUE 2YFJA 2YIUC 1O7WA 3GTSA 4HM4A 1RIEA 1UUWA 1UUVA 3VMGD 2E4QA 2JZAA 2QPZA 1FQTA 1BGYE 2YFLA 4PV1D 4NB8D 2B1XA 5KLVE 2QJYC 4HM2A 2IBZE 2NVEA 1L0LE 1NYKA 2E75D 1KB9E 3GL0A 1NTME 3EQQA 2NVGA 4HM0A 2ZT9D 1JM1A 2GBWA 2HMNA 1O7MA 2YVJB 4H13D 1ULJA 2QJKC 5AEUA 1G8KB 2BMRA 5CXMA 2HMKA 1O7HA 4QUQA 3L70E 1BE3E 2E76D 1EZVE 4EMJB 4NB9D 3L71E 1O7NA 1EG9A 2DE6D 3L75E 1WQLA 3AZCA 4HM6A 2HMJA 1RFSA 3BCCE 3GTEA 2BCCE 4HM8A 3D89A 1PPJE 3GL2A 2E74D 2NVFA 4QDFB 2D2CD 4HM5A 3VCAA 4QURA 5KLIC 5HL4A 4AAYB 3H1JE 4H44D 4NBFD 1NTKE 4D6TE 4QCKA 2XRXA 3VCPA 5KKZC 1BCCE 3H1LE 1Q90C 1NTZE 2DE7D 4H0LD 1KYOE 2QJPC 3GKEA 2I7FA 3DQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBA D;  1SQX E;  1VCK A;  1VM9 A;  3GB4 A;  2E4P A;  4NBB D;  4NBD D;  2XSO A;  1P84 E;  1G8J B;  2CKF A;  3N0Q A;  3L73 E;  4HKV A;  2NUM A;  3H1H E;  3FOU A;  4OGQ D;  3CXH E;  2DE5 D;  4AIV A;  4QDF A;  4U3F E;  2A06 E;  1ULI A;  4QDC A;  3GZX A;  2XR8 A;  3TGU E;  5AEW A;  3EN1 A;  4HM1 A;  4NBE D;  2NWF A;  4PD4 E;  4HM3 A;  4HJL A;  4QDD A;  3L72 E;  3CWB E;  1L0N E;  1SQQ E;  2ZYL A;  3L74 E;  3GOB A;  1SQP E;  2HML A;  3H1I E;  2B24 A;  2FYN C;  3CX5 E;  4HM7 A;  4NBG D;  1NU1 E;  4NBC D;  4P1C H;  4QUP A;  4NBH D;  3GZY A;  3H1K E;  2GBX A;  2BMQ A;  2YFI A;  3GCE A;  1SQV E;  1O7G A;  2BMO A;  2JO6 A;  3C0D A;  1ZRT E;  5BOK A;  4P1B H;  3VMH D;  1O7P A;  1VF5 D;  1SQB E;  2HMO A;  3VMI D;  2NUK A;  2Q3W A;  2XSH A;  2HMM A;  1NDO A;  1SJG A;  1PP9 E;  2FYU E;  2YFJ A;  2YIU C;  1O7W A;  3GTS A;  4HM4 A;  1RIE A;  1UUW A;  1UUV A;  3VMG D;  2E4Q A;  2JZA A;  2QPZ A;  1FQT A;  1BGY E;  2YFL A;  4PV1 D;  4NB8 D;  2B1X A;  5KLV E;  2QJY C;  4HM2 A;  2IBZ E;  2NVE A;  1L0L E;  1NYK A;  2E75 D;  1KB9 E;  3GL0 A;  1NTM E;  3EQQ A;  2NVG A;  4HM0 A;  2ZT9 D;  1JM1 A;  2GBW A;  2HMN A;  1O7M A;  2YVJ B;  4H13 D;  1ULJ A;  2QJK C;  5AEU A;  1G8K B;  2BMR A;  5CXM A;  2HMK A;  1O7H A;  4QUQ A;  3L70 E;  1BE3 E;  2E76 D;  1EZV E;  4EMJ B;  4NB9 D;  3L71 E;  1O7N A;  1EG9 A;  2DE6 D;  3L75 E;  1WQL A;  3AZC A;  4HM6 A;  2HMJ A;  1RFS A;  3BCC E;  3GTE A;  2BCC E;  4HM8 A;  3D89 A;  1PPJ E;  3GL2 A;  2E74 D;  2NVF A;  4QDF B;  2D2C D;  4HM5 A;  3VCA A;  4QUR A;  5KLI C;  5HL4 A;  4AAY B;  3H1J E;  4H44 D;  4NBF D;  1NTK E;  4D6T E;  4QCK A;  2XRX A;  3VCP A;  5KKZ C;  1BCC E;  3H1L E;  1Q90 C;  1NTZ E;  2DE7 D;  4H0L D;  1KYO E;  2QJP C;  3GKE A;  2I7F A;  3DQY A; 
#chains in the Genus database with same CATH topology
 4GOE A;  1GD2 E;  4WBA A;  3L75 G;  1LP1 A;  1P84 E;  1HF9 A;  4KHX A;  1XTC C;  3RK3 C;  2E5Y A;  2DE5 D;  4DCK A;  2M5A A;  3HE4 B;  1L4A D;  5APS A;  3WUV A;  1LTB C;  4I7Z C;  1JCC A;  3GMA A;  1M90 Q;  3H25 A;  2Q7C A;  2Q3E A;  1KYO D;  2K3R A;  2IPP A;  2GBX A;  4L75 A;  3GCE A;  2KYV A;  1LWU A;  3CL3 D;  1NTK K;  2WSC H;  3MIW A;  5BOK A;  1RE4 C;  1SQB E;  1NU1 D;  1LWU B;  3VMG D;  2LXB A;  3EQQ A;  1JM1 A;  2NPS C;  2WSF H;  3D71 A;  3R4Y A;  1VQP P;  1LTI C;  3AE3 C;  1PGO A;  2W27 A;  2FYU K;  2OYO A;  1OX3 A;  2IFM A;  3KHU A;  3PH0 A;  5C39 A;  1RFS A;  2Q5U A;  3L73 G;  1OXZ A;  2ZFC A;  1YTZ I;  5KLI C;  2OYH C;  1NTZ E;  1PZQ A;  3M0D C;  3A2A A;  3USS A;  3AEA C;  1M1K Q;  1J1E B;  1S5L H;  3WU2 H;  2WPV B;  2DW3 A;  2Q6Q A;  5APW A;  3CCU P;  1N7S D;  2XKM A;  3TGU J;  3BCC J;  1NH4 A;  3II6 A;  5H2F E;  4QDC A;  2WT7 A;  2NZ2 A;  3GF7 A;  5AEW A;  3TGU G;  5KJ7 A;  4HH2 A;  4R4M A;  4NBE D;  4YXW H;  1OMI A;  1FJK A;  1L0N E;  1BCC D;  3L74 E;  1G1I A;  2IBZ G;  3KZI E;  3H1K E;  4AQR D;  5KAF H;  1KQG B;  3CCJ P;  2XDJ A;  3HUS B;  5BVZ A;  1PP9 J;  3H1I D;  1PP9 G;  1T2K C;  1RE3 C;  1SFC A;  3L74 G;  3HUS A;  4BRY A;  4PV1 D;  4HM2 A;  3H32 B;  2IBZ E;  2WPR A;  3P8M C;  2K9Y A;  1LTJ B;  1AVO A;  1VQM P;  1OWA A;  1BE3 E;  1SQV D;  3H1J D;  1O7N A;  2P58 A;  2D2C C;  1EG9 A;  1YQ4 C;  3L75 E;  2WMM A;  2HYN A;  4IL6 E;  3C1L A;  2PP6 A;  1RF1 A;  1PGQ A;  2POH A;  4QMA A;  4QUR A;  3RL0 B;  1NTK E;  1L0N D;  1SQP D;  2XNX A;  2C9N Y;  4H0L D;  2J58 A;  4NPE A;  4OVN F;  5CBN A;  1KMI Z;  1KQF B;  4AYC A;  4HKV A;  3GHG C;  1K04 A;  2K9J B;  2Y0D A;  3VN0 A;  2KI7 B;  2JWD A;  4IFM A;  1OZH A;  5AVS B;  3TDK A;  1S2E A;  3L72 J;  2OYH A;  2M5A B;  2QJP B;  3H1I E;  2PGD A;  2O3J A;  2B87 B;  1MV8 A;  1W2E A;  2YO3 A;  1BE3 D;  1NU1 K;  1MFZ A;  2OTK E;  2A45 G;  2N1T B;  1FDM A;  2QM8 A;  4OH8 B;  2Z4E A;  3N7N A;  3HD7 A;  2QPZ A;  3H1I G;  2N1T A;  1SQV J;  1YQ3 C;  2P2U A;  2QJK B;  3W67 A;  1ZR4 A;  1SQQ D;  2HMN A;  2WVR A;  4JQ0 D;  1O7M A;  4U3F G;  1OW8 A;  3CLQ A;  3PJS K;  1NTK D;  3RK2 B;  1VQK P;  2WSE H;  3AE4 C;  3BCC E;  2BCC E;  4C7R A;  5E79 E;  3BAT A;  1SFC D;  1JY3 N;  1BDC A;  5APU A;  4HM5 A;  3RGU A;  1IFD A;  3ABV C;  1KN7 A;  3RK3 B;  2ZYA A;  2A45 I;  2XRX A;  5KKZ C;  2KXP B;  3LW5 J;  1BCC G;  3P8C E;  2IYO A;  3FWL A;  2P7J A;  1VQ6 P;  2LXC B;  5APT A;  1L2P A;  4H44 C;  2R44 A;  1VQ5 P;  1PL5 A;  1G2C A;  2AEM A;  2J5U A;  2KNC B;  2KP8 A;  4DJG A;  3EN1 A;  1G2C B;  1P84 D;  1S9K D;  5M1B A;  1KB9 D;  2WT7 B;  1SQQ E;  3GOB A;  3G3Z A;  5CJ4 A;  2PFX A;  2L91 A;  3TGU D;  4O9B A;  1JMB A;  2E75 B;  2E76 C;  2ZXE B;  2RH0 A;  1HVV A;  5KJ7 D;  4I2L C;  4C7N A;  3O6Q B;  2KZI A;  4JPZ B;  2YIU C;  1SQQ G;  5CCH D;  3KXD A;  2QVA A;  1U57 A;  2E74 B;  5L8R J;  4NB8 D;  1M1J A;  1IFN A;  2GBW A;  2WWW A;  3PLN A;  1KIL E;  1PP9 D;  1EXJ A;  1UIX A;  3H1K J;  3AEG C;  1EDK A;  1WQL A;  4BXL A;  3HE5 B;  2WSF J;  5CMZ A;  3E1I A;  4L76 A;  3L70 D;  1HGV A;  2Y0E A;  3GHG B;  4PJ0 E;  3O8Z A;  5CJ0 A;  2ZYD A;  2H8P D;  1Y47 A;  1WT6 A;  3CX5 D;  3HRN A;  4NBA D;  1SQB K;  3FWN A;  1DD4 A;  1S1C X;  5AVT B;  5EFW B;  1FS0 E;  3IAO A;  1D7M A;  1OVV A;  4CPG A;  3H1L J;  1RQV A;  1IZN B;  4QDF A;  3SFE C;  2E5T A;  1T3U A;  3TSI A;  2JJL A;  4RKU J;  1RH5 B;  4HJL A;  1L4A C;  3CWB E;  3HE4 A;  3MP7 B;  2W83 C;  2Y9Y A;  2FYZ A;  1M8O B;  2JO6 A;  1OW6 A;  1LTJ C;  2B9B A;  2E43 A;  3VMI D;  1BGY J;  2XU6 A;  2Q3W A;  1KIL D;  2XSH A;  1ZP0 C;  2W8Z A;  4HB1 A;  1LNQ A;  2YO2 A;  2JZA A;  4ASW A;  1BGY G;  3I56 P;  4N78 D;  2P10 A;  4HJG H;  4PD4 D;  3N4X A;  1GK4 A;  2FXP A;  2KLV A;  2A06 G;  1PGJ A;  1URQ D;  2E76 B;  1M7L A;  1LTJ A;  3B8E B;  2BMR A;  3RL0 C;  2YKP A;  1GU5 A;  3L75 J;  4NB9 D;  2QJY B;  1N73 B;  1S5L E;  2M3B A;  1X8Y A;  3D6Z A;  4I1L A;  2DE6 D;  2IZ1 A;  2QA4 P;  3VCA A;  2H43 A;  3VCP A;  4A7P A;  1KFN A;  1JMM A;  1VL2 A;  1IFP A;  4K35 A;  3KZI H;  3N0Q A;  1EZV D;  1FOS F;  2D2C B;  1HGZ A;  4H0L C;  1KTM A;  2E42 A;  2FFD C;  3AE7 C;  3RK3 E;  1IFI A;  1GL2 A;  1ULI A;  2KUB A;  4PD4 E;  2GA1 A;  1GL2 B;  3WMM 0;  2YIU B;  1FZG A;  1VQO P;  3MZW B;  3JC2 2;  4L73 A;  3S1K A;  4W7Y A;  1BDD A;  3M9B A;  4BWN A;  1JO5 A;  4UB6 E;  3UIA A;  1YJN P;  1O7G A;  1FZC A;  3B5N D;  4N78 E;  2HFE D;  3C0D A;  4EYY Q;  2BEQ D;  3RBX A;  4HM4 A;  3GTS A;  3V2Q A;  1UUV A;  2FYN B;  5CBO A;  1Q90 D;  1NTM J;  2O01 N;  2QEX P;  1FZE A;  1NYK A;  3GL0 A;  3TNU A;  1G1J A;  2KSE A;  1DEE G;  3AE5 C;  1OVU A;  5KAF E;  4GKG A;  2CPB A;  3JSV C;  1EZV E;  1NTK J;  4D6T D;  1KC8 Q;  3U1C A;  1X9V A;  5TJH A;  1JY3 P;  3Q3D A;  1PPJ E;  2FYU D;  2I8D A;  5HL4 A;  1FZB A;  2M0B A;  1LT9 C;  4PD4 I;  3TF5 A;  3WUT A;  3RK3 D;  2O01 H;  2Z5I A;  3CCL P;  1EDJ A;  2E4P A;  1URQ B;  2V7Q H;  2B87 A;  2FY8 A;  1SVF A;  3JCU H;  1Q2N A;  5CCG C;  5GTI H;  1QEX A;  1YHQ P;  3V2N A;  3L70 G;  1VQ7 P;  1X22 A;  1N7S C;  1IK9 A;  1FBM A;  4QDD A;  2JO1 A;  3CD6 P;  1M57 D;  1QL1 A;  2K1A A;  1JOC A;  2KS1 A;  3AEF C;  3GZY A;  4WWI A;  1SQV E;  1AFO A;  5APV A;  1ZRT E;  4EDF A;  2N1T D;  1OFC X;  1YIT P;  2ZXX A;  1AA0 A;  2HMO A;  5B66 E;  4C7N B;  1DEB A;  4PD4 H;  3R2P A;  4R4L A;  1Z56 A;  1CI6 B;  5E79 H;  1E5W A;  3VMY A;  2XV5 A;  2YKQ A;  3A3Y B;  3QH9 A;  2E75 D;  1RF0 C;  4HM0 A;  3L74 D;  1FE6 A;  2K37 A;  4UB6 H;  1PPJ D;  4H13 D;  5B5E H;  1BGY D;  2BAS A;  4QUQ A;  3KPE A;  1PGP A;  1FZC C;  1VPC A;  3B5N B;  1T6A A;  1GW4 A;  2RKL A;  3AZC A;  4Y28 J;  3T97 B;  1FZA A;  2KOG A;  4OGQ B;  2ZT9 B;  2NPS B;  1HUC A;  3A0H H;  3K5B A;  2J59 M;  3H1J E;  4H0L B;  3L75 D;  1VQ9 P;  3LID A;  2IX7 C;  1YJ9 P;  4U3F D;  3OAK A;  3MTU E;  2IBZ I;  2O01 J;  3ZDM A;  1GL2 C;  1VF5 C;  2RN0 A;  1HBW A;  2I1K A;  2QG4 A;  1A02 F;  1SQB D;  1NKZ B;  3H1H E;  1JUN A;  2ZYG A;  5KAI E;  2V7Q J;  3GZX A;  2H88 C;  3RK2 D;  1H89 A;  3V4Q A;  1GL2 D;  3M9Q A;  3FXE A;  3PRJ A;  4TT3 H;  2Y9Z A;  3B5N A;  4HM1 A;  5AVZ B;  5AW4 B;  1LTT C;  1KD1 Q;  3L71 G;  4HM3 A;  2KNC A;  1RF1 C;  1YBK A;  1SQP E;  3RL0 D;  2HML A;  3NXS A;  2FYN C;  1VDF A;  4L74 A;  1IC2 A;  1NAY A;  2O1K A;  1J1D C;  5GTI E;  2PAJ A;  1N8R Q;  4D6T G;  4WY4 A;  1N7L A;  1EDI A;  2BCC D;  3CXH D;  4WB4 A;  1UUW A;  2E4Q A;  1FQT A;  1LTA C;  1RF1 B;  1L0L G;  3CC4 P;  4H13 C;  2ZVN B;  3HUS C;  1K05 A;  3M0D A;  3MD0 A;  2FFD A;  4PJ0 H;  2XZR A;  3U59 A;  1PFI A;  2YVJ B;  1U7M A;  5AEU A;  1G8K B;  1KYO I;  2M3E A;  2WSC J;  4JYB A;  2HG5 D;  2JDI H;  1NTM D;  3AEC C;  3G4S P;  1IO4 A;  3L4F A;  1FOS E;  2E74 D;  1H0T B;  2WSE J;  1KB9 H;  1S9K E;  3IFM A;  3NFQ A;  5AW6 B;  1TU3 F;  3H1L E;  3BCC D;  1U7J A;  3AE2 C;  3DQY A;  1KFM A;  3U1A A;  2V4H A;  1VM9 A;  1N73 C;  5AW3 B;  1FJP A;  3CWB J;  3P8C D;  3CXH E;  4AIV A;  1A02 J;  3VP8 A;  3B4S A;  3SFD C;  2FXM A;  1ZXG A;  3PP5 A;  4IOI H;  2L5G B;  2ZYL A;  1DX7 A;  4RO0 A;  1LP1 B;  2H7H A;  5DJU B;  2IBZ D;  2K9J A;  5KAI H;  2N9B A;  1SQX K;  1AV1 A;  1DH3 A;  2SPZ A;  1GK6 A;  1NYH A;  2JKV A;  3WUU A;  3B5N C;  1M1J C;  1HJ0 A;  4JBZ A;  2NVE A;  3H1J J;  2WTY A;  3CX5 H;  3H6P A;  2NVG A;  2QIW A;  1RQU A;  1Q81 Q;  4YXD C;  3G6E P;  1GZL A;  1M56 D;  5CXM A;  2QM7 A;  3PTZ A;  3CCM P;  1OW7 A;  4EMJ B;  1YJW P;  1J2J B;  2IFN A;  4JF7 A;  1NVO A;  1LWU C;  4IL6 X;  3P7K A;  4EIJ A;  3CXH I;  2D2C D;  5BU8 B;  3KDP B;  4MN4 C;  3D70 A;  3HTK A;  3AE9 C;  1LGH B;  5KLV D;  3L71 D;  4YPC A;  3CWB D;  1Q90 C;  1VQL P;  1S4X A;  2DE7 D;  2QJP C;  3GKE A;  2ZVO B;  2B88 A;  3KYQ A;  2Z5H A;  1KIL C;  1YYC A;  4PV1 B;  1R5S A;  1CZQ A;  1W2B O;  2OGU A;  5KLI B;  4EI2 A;  1R5L A;  4H44 B;  3SWY A;  1L0L D;  1LT9 A;  2B24 A;  2YNY A;  1T3J A;  1P84 H;  3A0B E;  3MHV A;  1KOR A;  2BMQ A;  1E79 H;  5TIS H;  2R32 A;  1USE A;  1RHZ B;  1O7P A;  1SQB G;  5AW1 B;  3Q2Y A;  1NOH A;  3G71 P;  3M91 A;  5AVQ B;  3S9O A;  1QVF O;  5KLV E;  4Z1M H;  1N7S B;  3V2R A;  1NU1 G;  3AE1 C;  3D6Y A;  2ZT9 D;  5DJT B;  4HKZ H;  2OYI B;  1KZU B;  2KIK A;  5GTH E;  1LTG C;  3BRV B;  5KLV J;  4W80 A;  3BRT B;  3C9I A;  1BSH A;  5CCG D;  5AW0 B;  5KLV G;  3BCC G;  1JY2 P;  2YXR B;  2WQY C;  3JCU E;  2YXQ B;  3M06 A;  4ZMD A;  1KQL A;  1HWT C;  4IFD K;  4NBF D;  4QCK A;  1IFM A;  1NTZ G;  2JWA A;  2OYI C;  3E7K A;  3QWO C;  1FU1 A;  1YIJ P;  3GHG A;  2VRS A;  1S3J A;  3GB4 A;  1SQP K;  4NBB D;  1K9M Q;  4NBD D;  2XSO A;  3H1H J;  4HYT B;  2LR2 A;  2R3C A;  4ASV A;  2NUM A;  3HD7 D;  4U3F E;  3CCV P;  3TGU E;  3V6I A;  5B66 H;  1OIP A;  1Y9B A;  4GIF A;  1L0N G;  1BCC J;  1S72 P;  5AW8 B;  1J1E C;  2C0X A;  1JB0 J;  4HM7 A;  2ZAE B;  4NBH D;  1SFC B;  2AEF A;  3ITK A;  3AED C;  1ZR2 A;  4DT0 A;  4UB8 H;  5H2F H;  1AQ5 A;  1NTK G;  2OTJ P;  4GT1 A;  3CCR P;  1JTH B;  1CW5 A;  1L4A B;  2JEE A;  2HMM A;  1GW3 A;  1NDO A;  1PP9 E;  4XA4 A;  1ZME C;  3TYY A;  4GOF A;  3VMZ A;  2JR8 A;  3V5B A;  1YI2 P;  3O6Q A;  1P84 I;  2OAR A;  3L72 D;  1KB9 I;  4N3Y B;  5K5G B;  2KZJ A;  1JY3 O;  3C8V A;  3FX0 A;  3BVH A;  1Q86 Q;  3H1K D;  1O7H A;  1BE3 G;  1SQQ K;  2Q9I A;  2FYU G;  1BE3 J;  3CC7 P;  2HMJ A;  2C0W A;  3SWF A;  1QL2 A;  2C9L Y;  2YMY A;  2NVF A;  3Q5P A;  3L70 J;  4H44 D;  3EWK A;  1JTH A;  1OVR A;  1L4A A;  5B5E E;  1KYO E;  1MFT A;  5AVX B;  3RK2 C;  5CCH C;  3A0H E;  4U7J A;  4Y99 B;  3E1R A;  1RE4 A;  2NRG A;  4DOJ A;  1JY2 N;  1H88 A;  3VP9 A;  2E74 C;  5AVW B;  3AEB C;  4OWF A;  2G3A A;  3SWK A;  3TNU B;  5AVV B;  1NU1 E;  3CX5 I;  1JNM A;  1SQX D;  2B89 A;  1HH0 A;  1GDT A;  1NO4 A;  2BMO A;  3CMA P;  4GDO A;  4BRY B;  2AXT H;  1SJG A;  4OGQ C;  1ZN5 A;  1SS1 A;  1MKM A;  4DZO A;  2WSS H;  3BAS A;  2FXO A;  1L0L J;  1VQ4 P;  3CCQ P;  1ULJ A;  3VOP A;  4WY4 D;  1KV4 A;  2Y0C A;  5AVY B;  3Q1M A;  2HMK A;  1FAV A;  1W5C E;  1VF5 B;  2FKW B;  4ZNC A;  2XND H;  1NTZ D;  2BCC G;  3RBZ A;  3IF4 A;  1AQT A;  3CXH H;  1DD3 A;  1EDL A;  1BCC E;  4KT0 J;  3M0A A;  1SQX E;  2N1T C;  3FGA D;  5CCG A;  2CKF A;  1PIX A;  1T8Z A;  2KB7 P;  4ZKU A;  3Q5S A;  1FZF A;  4YTP C;  1SQX J;  3IR9 A;  1JM0 A;  1LJ2 A;  1ZOY C;  2W90 A;  2NWF A;  3A7O A;  2IYP A;  1URQ C;  1CI6 A;  1KYO H;  1SQX G;  5APX A;  1FDI A;  3OW2 O;  3MUD A;  2LKM A;  1VQ8 P;  1Q82 Q;  1EQ7 A;  4QUP A;  4NBC D;  2OQQ A;  1JEK A;  1URQ A;  1NWQ A;  2GUV A;  5AVU B;  3VYI A;  2AXC A;  3EFG A;  2YFI A;  1IJD B;  1KIL B;  4PV1 C;  3GLM A;  3VMH D;  2IZ0 A;  3H1H D;  3B71 A;  2R3S A;  5APQ A;  2YFJ A;  2FYU E;  2A06 D;  1KIL A;  1RF0 A;  4KJM A;  1AJY A;  2NPS D;  2Q1K A;  4WVZ A;  2W6A A;  1PV3 A;  1LTS C;  3V4W A;  1UII A;  2WIT A;  3HTK B;  3LW5 H;  2KS1 B;  4XFJ A;  3NMD A;  2HOD B;  3HD7 C;  1R8E A;  2MJZ A;  3L73 J;  3CWB G;  1QVG O;  4HM6 A;  2OYI A;  3GTE A;  4HM8 A;  3WU2 E;  1L0N K;  3I55 P;  1NTM G;  3A5T A;  4I7Z B;  3CCE P;  4N6J A;  5AW5 B;  1USD A;  3MUD C;  2E75 C;  3TK1 A;  5AW9 B;  2R5B A;  3CCS P;  1G8J B;  3A0B H;  1ZRT D;  2OTL P;  1MZ9 A;  3H1L D;  3AEE C;  4GOD A;  3VMX A;  1FZC B;  1K73 Q;  1S5L X;  2A06 E;  3M9H A;  1NJI Q;  1ZW0 A;  2A45 H;  3W68 A;  3VTP C;  2QSI A;  1NGM B;  1EZV G;  2I1J A;  2ZT9 C;  3CME P;  3EQ2 A;  3EFF K;  1EXI A;  3P32 A;  3L36 A;  4IFF A;  3PHL A;  1CSB A;  4XE5 B;  1YTZ T;  1VF5 D;  1FC2 C;  3L74 J;  2IDB A;  5CCH A;  1M1J B;  3IN6 A;  1RIE A;  2M8R A;  4C46 A;  4WY4 B;  3HE5 A;  3L72 G;  1BGY E;  1H0T A;  1HJB A;  5CHX A;  4IL6 H;  3CI9 A;  1KQS O;  3Q5R A;  4W7Z A;  2AEJ A;  4NPF X;  1QX8 A;  2BEZ F;  5TIS E;  2QJK C;  1RE3 A;  1SFC C;  1EZV I;  2PRR A;  2KLU A;  2UWJ E;  1HTL C;  3S4R A;  5BU5 A;  2G8Y A;  1N2D C;  1ZLL A;  3H32 A;  4QDF B;  3V2P A;  1NAF A;  3F5H A;  2KSJ A;  1SQV G;  2WPQ A;  1EC5 A;  1DIP A;  3OA7 A;  1SLQ A;  5GTH H;  1N86 A;  1NTZ J;  1BSN A;  1LT1 A;  1VCK A;  1NHL A;  3KQG A;  2Q3I A;  1SQV K;  1T2K D;  2OYH B;  1GU4 A;  1SQB J;  3H1H G;  1L0L K;  1NTZ K;  3GW6 A;  4I6M C;  2P67 A;  4Y99 C;  1MUU A;  2O1J A;  1QLE D;  2YMK A;  1NU1 J;  3L37 A;  2R5D A;  4P1C H;  4M3L A;  2QRX A;  4LGD E;  1JCD A;  3CPW O;  3H1I J;  2NUK A;  1GMJ A;  2W6B A;  1O7W A;  3SSU A;  5KJ7 C;  5KLV K;  2QJY C;  5KTB A;  2NPS A;  1L0L E;  5AW2 B;  1KB9 E;  4U3F J;  1NTM E;  3F89 A;  1Y8A A;  4TLF A;  2JP3 A;  1JY2 O;  4UB8 E;  1N73 A;  3L70 E;  2E76 D;  4D6T J;  2YKO A;  3NTN A;  4ZKP A;  2KK7 A;  1PPJ G;  3D89 A;  2WZ7 A;  2FYU J;  2P1J A;  1WMK A;  1SQQ J;  2H89 C;  3GG2 A;  1X0T A;  3LIE A;  5AVR B;  4RJT A;  1K8A Q;  1NKN A;  1XTG B;  4D6T E;  2CPS A;  2FBW C;  2N9Y B;  2CK3 H;  1L0N J;  1IFJ A;  2GUS A;  2W6J H;  3T97 A;  2WPS A;  1FDO A;  3L73 E;  1NTM K;  4OGQ D;  3FOU A;  1Q7Y Q;  3MGN A;  2XR8 A;  4LC1 A;  2AXT E;  2HLO A;  3I5C A;  1AVY A;  4RES B;  3L72 E;  4H13 B;  1RY3 A;  4WY4 C;  3CX5 E;  4NBG D;  3AE8 C;  3G9R A;  3H1L G;  4P1B H;  2MKV A;  4JYC A;  1VQN P;  2GM4 A;  4NPD A;  4B86 A;  4AUW A;  2K88 A;  1LT9 B;  2YFL A;  2B1X A;  2HR3 A;  4K3A A;  2HPC A;  3RL0 g;  5KKZ B;  3H1K G;  3L35 A;  2ITA A;  3FXD A;  1J1D B;  2HPC B;  1SQP J;  3L73 D;  2HOD A;  3L71 E;  1H8A A;  3VMA A;  1SP4 A;  4EOT A;  1SQP G;  4LLH A;  3HD7 B;  1ZV8 A;  5APY A;  3GL2 A;  2RMZ A;  2BCC J;  1N7S A;  3AE6 C;  3H1J G;  4AAY B;  1IK7 A;  3OJA B;  2FFD B;  3L71 J;  1QGK B;  3GF3 A;  5AW7 B;  1WRG A;  2QE7 H;  1GTW A;  1X79 B;  2ZJS E;  3CC2 P;  2I7F A; 
#chains in the Genus database with same CATH homology
 4NBA D;  1SQX E;  1VCK A;  1VM9 A;  3GB4 A;  2E4P A;  4NBB D;  4NBD D;  2XSO A;  1P84 E;  1G8J B;  2CKF A;  3N0Q A;  3L73 E;  4HKV A;  2NUM A;  3H1H E;  3FOU A;  4OGQ D;  3CXH E;  2DE5 D;  4AIV A;  4QDF A;  4U3F E;  2A06 E;  1ULI A;  4QDC A;  3GZX A;  2XR8 A;  3TGU E;  5AEW A;  3EN1 A;  4HM1 A;  4NBE D;  2NWF A;  4PD4 E;  4HM3 A;  4HJL A;  4QDD A;  3L72 E;  3CWB E;  1L0N E;  1SQQ E;  2ZYL A;  3L74 E;  3GOB A;  1SQP E;  2HML A;  3H1I E;  2B24 A;  2FYN C;  3CX5 E;  4HM7 A;  4NBG D;  1NU1 E;  4NBC D;  4P1C H;  4QUP A;  4NBH D;  3GZY A;  3H1K E;  2GBX A;  2BMQ A;  2YFI A;  3GCE A;  1SQV E;  1O7G A;  2BMO A;  2JO6 A;  3C0D A;  1ZRT E;  5BOK A;  4P1B H;  3VMH D;  1O7P A;  1VF5 D;  1SQB E;  2HMO A;  3VMI D;  2NUK A;  2Q3W A;  2XSH A;  2HMM A;  1NDO A;  1SJG A;  1PP9 E;  2FYU E;  2YFJ A;  2YIU C;  1O7W A;  3GTS A;  4HM4 A;  1RIE A;  1UUW A;  1UUV A;  3VMG D;  2E4Q A;  2JZA A;  2QPZ A;  1FQT A;  1BGY E;  2YFL A;  4PV1 D;  4NB8 D;  2B1X A;  5KLV E;  2QJY C;  4HM2 A;  2IBZ E;  2NVE A;  1L0L E;  1NYK A;  2E75 D;  1KB9 E;  3GL0 A;  1NTM E;  3EQQ A;  2NVG A;  4HM0 A;  2ZT9 D;  1JM1 A;  2GBW A;  2HMN A;  1O7M A;  2YVJ B;  4H13 D;  1ULJ A;  2QJK C;  5AEU A;  1G8K B;  2BMR A;  5CXM A;  2HMK A;  1O7H A;  4QUQ A;  3L70 E;  1BE3 E;  2E76 D;  1EZV E;  4EMJ B;  4NB9 D;  3L71 E;  1O7N A;  1EG9 A;  2DE6 D;  3L75 E;  1WQL A;  3AZC A;  4HM6 A;  2HMJ A;  1RFS A;  3BCC E;  3GTE A;  2BCC E;  4HM8 A;  3D89 A;  1PPJ E;  3GL2 A;  2E74 D;  2NVF A;  4QDF B;  2D2C D;  4HM5 A;  3VCA A;  4QUR A;  5KLI C;  5HL4 A;  4AAY B;  3H1J E;  4H44 D;  4NBF D;  1NTK E;  4D6T E;  4QCK A;  2XRX A;  3VCP A;  5KKZ C;  1BCC E;  3H1L E;  1Q90 C;  1NTZ E;  2DE7 D;  4H0L D;  1KYO E;  2QJP C;  3GKE A;  2I7F A;  3DQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...