2IBZE

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
total genus 45
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2ibzE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2ibzE02
3GCEA 4NBFD 4NBBD 1BCCE 1O7MA 1NTKE 1P84E 1RFSA 1EG9A 1O7PA 4NBAD 2Q3WA 2NUMA 4NB9D 2YIUC 1EZVE 5KKZC 3CXHE 4NBDD 4NBCD 2NVFA 4QDDA 1UUWA 2NVEA 3VCAA 4PD4E 2XSOA 3AZCA 2B1XA 2BMQA 4HM0A 3GL2A 1FQTA 2XSHA 1PP9E 2BMRA 5KLIC 4HM7A 2CKFA 2YVJB 4QUQA 3CWBE 1O7NA 1Q90C 1BE3E 4P1CH 5CXMA 2E75D 4HM4A 1VM9A 3D89A 3GKEA 2I7FA 2QJYC 4HM2A 1O7WA 1O7HA 1UUVA 1ZRTE 2HMKA 4HJLA 1SJGA 3VMGD 1NYKA 3CX5E 4OGQD 1VCKA 2NWFA 1NU1E 1L0NE 1G8JB 2GBWA 3N0QA 2JZAA 4NBHD 4P1BH 4QDCA 2E4PA 1SQVE 2YFIA 2QJKC 3GOBA 5KLVE 1SQBE 2DE6D 4HM8A 2HMMA 4QUPA 4AIVA 4AAYB 2BMOA 2FYNC 2YFJA 2E4QA 5HL4A 2HMNA 4QCKA 3TGUE 5AEWA 3L72E 1SQPE 1NTZE 2YFLA 3GZYA 3VCPA 1L0LE 2FYUE 2D2CD 2HMJA 2HMLA 4HM3A 3C0DA 1BGYE 1VF5D 4HM1A 1NTME 3H1LE 1JM1A 3H1JE 4NBGD 2XRXA 3L75E 4H44D 2DE7D 3VMID 1SQXE 2B24A 1ULIA 2IBZE 4EMJB 1NDOA 4QURA 2XR8A 3GTEA 4HKVA 2A06E 2BCCE 2NUKA 4NB8D 3GB4A 2GBXA 3H1KE 2QPZA 3DQYA 3H1HE 3L70E 4H0LD 2E76D 3EN1A 2QJPC 3GZXA 1KYOE 3EQQA 2NVGA 4QDFA 2ZT9D 3H1IE 1G8KB 3L71E 4HM6A 1RIEA 2JO6A 3L74E 1KB9E 3FOUA 3GL0A 4U3FE 1PPJE 2HMOA 4H13D 2DE5D 5BOKA 1O7GA 4PV1D 4NBED 1SQQE 1WQLA 1ULJA 4HM5A 3L73E 3VMHD 3GTSA 4D6TE 4QDFB 2ZYLA 5AEUA 2E74D 3BCCE
chains in the Genus database with same CATH superfamily
2CPSA 2FYUK 4PD4H 1SFCA 3BVHA 1KC8Q 1EG9A 2WSCH 5KKZC 2AXTE 2H7HA 1M1KQ 2E76C 4I7ZB 2Y0CA 1S72P 4DJGA 1KB9D 4U3FJ 2Z4EA 3JCUE 1FQTA 2IYPA 4QUQA 3Q3DA 3U59A 2KLUA 1YQ3C 2I1KA 4R4MA 5KKZB 3KHUA 1WT6A 3H1JD 2FXOA 4P1BH 1DEEG 3CX5I 4K35A 3CCVP 2ZFCA 3L70D 1RQVA 3RK2C 3L72E 1SQVG 1PPJG 1JB0J 3C0DA 1AA0A 1JM1A 3L71G 4XA4A 3RK3D 5APSA 2LKMA 1NU1K 3H1KJ 3CX5D 1EQ7A 2XR8A 1NU1D 4GIFA 2E5TA 2GBXA 3JSVC 2POHA 1KB9H 3EQQA 3VYIA 1S3JA 2IZ1A 4GOFA 2FYUD 3V2RA 3GL0A 1JTHA 1T6AA 2A45I 5BOKA 3L72J 2E75B 2A45H 2IPPA 2Y9YA 3CMAP 3CCRP 2Q7CA 2QE7H 2KP8A 2YMYA 2XU6A 1KILD 1HGVA 2C0WA 1LP1B 1NWQA 1FOSF 4NBDD 3SSUA 1FJPA 5AW6B 4JYBA 1R5SA 2NPSC 3A0HE 1LT9C 2ZXEB 1L2PA 1OXZA 2WPRA 1AQ5A 3L75G 2Q3EA 1Q90C 2IZ0A 4OGQC 3VP9A 4WY4A 1RE3C 2Y0DA 5BU5A 2K1AA 1SQPJ 2DW3A 1W2EA 1O7HA 1SQQJ 4BXLA 2L5GB 3P8CE 4Y99C 5KAFH 4NBHD 2OGUA 2RMZA 4WY4D 2HMLA 4YPCA 5AW9B 3O6QA 1OW6A 1JY3O 2ITAA 3VMID 1FU1A 3AE5C 1SQBK 3C8VA 1URQB 4HB1A 2IBZG 1N2DC 3VOPA 2KNCB 3Q5SA 1ZOYC 1PP9G 2KSEA 1PPJE 1L0LG 1VQMP 4C7RA 3IF4A 1IFNA 2O01H 2WPVB 1HUCA 1HJ0A 2RN0A 3AE4C 2JO1A 4GOEA 2ZT9C 2O3JA 1BCCE 4IFMA 2W83C 1W2BO 1Q7YQ 2NUMA 2YIUC 2YO2A 1VQ5P 4UB6E 1YHQP 5AVYB 1BSNA 5APUA 2KOGA 1KORA 4RKUJ 2G8YA 2PRRA 5CJ4A 3EQ2A 3HTKB 4P1CH 5CXMA 2KS1B 2Y9ZA 4HH2A 4IL6X 3L73G 2RH0A 1NTKJ 5KLVE 1JNMA 2QG4A 5AW8B 1OVRA 5APXA 2H43A 5APQA 4L76A 3L73J 1CI6A 3EFFK 2P10A 4GODA 1KQFB 1NTME 1RF1A 3BASA 3S9OA 2XNDH 3SWKA 4HKVA 3GHGA 1ZR2A 1SQQD 1K05A 1NTZD 3SFDC 1LGHB 1GL2A 2E76D 5AVUB 1YJ9P 1NTKG 2W6BA 1SQXD 4U3FE 5APTA 5CCGA 1ULJA 1X0TA 2ZYDA 1GL2B 3L73E 1OFCX 2KK7A 1SQPK 1P84E 3FXEA 1RFSA 3L74J 1HH0A 1M90Q 1BDCA 3HUSA 1IJDB 4GT1A 2N1TD 4YXWH 2NVFA 1Q81Q 5AVSB 2OQQA 3MHVA 1NVOA 2XSOA 1Q90D 1VQLP 1VQ9P 1E79H 3GL2A 4I2LC 1MFZA 3A5TA 3KXDA 3HE5A 1H0TB 1N86A 3E7KA 1OVUA 5AVWB 2E43A 4DT0A 1DD3A 4LLHA 2R32A 2Q1KA 5AVRB 1JY3N 3ABVC 1SJGA 2R5DA 2WSEH 5L8RJ 1AVOA 2BCCD 2MKVA 1RE3A 3IAOA 4AIVA 1NU1G 1N7SB 2AEJA 2JJLA 3GF7A 2GM4A 2AXTH 1SQPE 1AVYA 2A45G 4LC1A 3OJAB 3NMDA 4EMJB 2A06E 3KDPB 1CZQA 1J1DB 3BRVB 2N1TC 3FXDA 3H1LD 2QIWA 3G9RA 1GK4A 5APWA 2XNXA 2GUSA 1VL2A 1IFMA 3BCCJ 1FZCA 1O7GA 1LP1A 4NBED 4W80A 2OYHA 5KJ7A 3CCMP 2M0BA 3V4QA 3I56P 2K9YA 1URQC 3FX0A 1WMKA 3H1HG 3IN6A 1VQ8P 5CCGC 1KTMA 3H32A 1L4AA 1N8RQ 2E42A 3A0BH 1Y8AA 2B1XA 2LR2A 3AE7C 3L73D 1MFTA 1BCCJ 1SQXJ 1P84D 1HWTC 1AQTA 1NTMD 1Q2NA 3QWOC 2YKQA 4C46A 4PD4D 1VQOP 1YI2P 1ZV8A 2YKOA 1GTWA 1OMIA 2QJKC 2R44A 4L73A 4BRYB 3M0DA 1VQNP 3WU2H 1AJYA 3Q1MA 2YFJA 5CMZA 4M3LA 5AVTB 1SQQG 4GDOA 2J58A 2QVAA 3II6A 3USSA 3AE9C 1VQ7P 2FBWC 3B71A 2DE7D 5B66H 1KQSO 5H2FE 3C9IA 5AVZB 2QA4P 2LXBA 4AUWA 1KILB 4H0LD 1KYOE 1G8KB 2ZYGA 2OYOA 1VDFA 3A2AA 3HE5B 1YJWP 3B5NA 1EDJA 3SWYA 2E75C 1GK6A 3TNUB 5B5EE 1T8ZA 1KILC 1K8AQ 4HKZH 2C9NY 4EYYQ 3U1CA 3RL0C 2OTJP 3H1LJ 3G3ZA 4TLFA 5H2FH 3L72D 1SQXK 3GHGC 5CHXA 4Y99B 1QGKB 2HMKA 3N0QA 2JZAA 3GOBA 3BCCG 1Y47A 3Q5PA 3QH9A 1L4AB 1JEKA 4CPGA 3GHGB 2ZAEB 2FYUE 4PD4I 2HMJA 2Q3IA 1K04A 4UB8E 3EFGA 2IYOA 4QMAA 4D6TD 1KILE 2FYUJ 3V2QA 1GU4A 1K9MQ 1DEBA 1KB9I 1LT1A 3AE1C 5AVXB 2NZ2A 3V2NA 2BCCJ 4PJ0H 2YKPA 3LW5H 4IL6H 1LNQA 2MJZA 1LWUB 4O9BA 2JKVA 4XFJA 3G4SP 4H0LC 3MUDC 2QJPB 1SQQE 3CL3D 2YIUB 1TU3F 1QLED 2E76B 3RK3C 4JBZA 5BVZA 3B5NC 2Q3WA 2FY8A 4RJTA 2K88A 2WSEJ 1SQVK 1KILA 3VMZA 1LTSC 4WB4A 2C0XA 2FYNB 1IFPA 2J5UA 1M56D 2BMRA 2KYVA 3H1KG 1PZQA 2I8DA 1O7NA 1NKNA 2HR3A 1VQPP 2B88A 3TGUG 1DIPA 1Q82Q 3VMYA 3V5BA 1R5LA 2BEQD 2A06D 2FYNC 4QCKA 3N4XA 3CCUP 4JPZB 3CCEP 2YFLA 3HRNA 2B87A 4ASWA 1X9VA 4HM1A 1HBWA 3H1JE 2XRXA 1URQD 3WU2E 3H1HJ 1L0ND 4HYTB 3ZDMA 3AE6C 3Q2YA 4NPFX 4U7JA 3M9QA 1RF1C 3OW2O 3PJSK 1SQPD 1LTJA 1FZCB 3AEFC 1LT9A 2GA1A 1EXIA 3T97A 3DQYA 3H1HE 2YNYA 3RL0g 2OYHB 4QDFA 3FGAD 4DCKA 2JP3A 1USDA 1G1IA 2DE5D 4DZOA 4OVNF 2OTLP 4KHXA 2K9JB 1DD4A 3M9HA 4D6TE 1NTZK 4ZNCA 1L4AD 1KFNA 3GCEA 1L0LK 1QVGO 2OYIA 1VQ4P 4NBAD 3M91A 2K9JA 2V7QJ 1U57A 1EZVE 1BDDA 4H13B 5AVVB 3CC7P 3D70A 1NTMG 2QSIA 3HD7A 2BMQA 1JUNA 1VF5B 2JWAA 5CCHD 3BATA 4D6TJ 4BRYA 1PGPA 3WUVA 5E79E 1GZLA 1VQ6P 2H89C 2BCCG 4LGDE 1BGYG 3NXSA 5APYA 1ZN5A 3L75J 3KYQA 4EIJA 1NO4A 1GDTA 1GL2D 2KXPB 2M3EA 2KB7P 3EWKA 3CX5H 5CCGD 1EDLA 2D2CD 4PV1B 5C39A 1NH4A 1PP9J 4KJMA 1BE3G 2WMMA 2FFDA 1LTTC 3P32A 2CK3H 1KD1Q 1KN7A 3MGNA 2W90A 1L4AC 3EN1A 5AW4B 3G71P 2W6JH 3HE4A 1SQBJ 1KB9E 3V6IA 4AQRD 1T3UA 5KLIB 2WSFJ 2ZYLA 4NBFD 1L0NK 1NTKE 2KZJA 3H1KD 3CCQP 3SFEC 5K5GB 4L74A 1AV1A 2XDJA 3D71A 2B87B 3BRTB 3M06A 1PGJA 1RE4C 1SQBG 4HM7A 3PRJA 1RF0C 2W6AA 1BE3E 2HODA 4HM4A 1JM0A 2K37A 1JMBA 1PFIA 3M9BA 3CX5E 5CBNA 3T97B 1BCCG 1BSHA 4QDCA 1J2JB 3LW5J 4BWNA 2HODB 1JMMA 3CPWO 2KNCA 3TK1A 3Q5RA 2W27A 1SS1A 5AEWA 1L0LE 4OH8B 1BGYE 3MIWA 3U1AA 3L74D 2OYIB 1ULIA 1NTMJ 1RH5B 3AEGC 2IBZE 1SQXG 1L0LJ 3CMEP 3HD7D 1LWUA 3H25A 4IFDK 4NB8D 2HPCA 1SFCC 2WPSA 4U3FG 1IZNB 3CC2P 5AW1B 1NGMB 3H1JJ 1RIEA 3CLQA 2CPBA 3W67A 5KTBA 2OYIC 3GMAA 4YXDC 2QRXA 4NPDA 5KLVJ 2O1JA 4GKGA 1RF1B 3TYYA 2WITA 1HGZA 1O7PA 1JY2N 5TISH 3MZWB 1OWAA 3RL0D 3L37A 1YJNP 4MN4C 1LTIC 2HG5D 1NYHA 2XZRA 1N7SC 4RESB 1S9KD 3RL0B 2Y0EA 2R3SA 4WVZA 3GKEA 1HF9A 3L35A 3KQGA 1LJ2A 1SQVJ 4L75A 1KQGB 2QJYB 2E4PA 2YFIA 4Y28J 1JO5A 1SQBE 4EOTA 2NPSB 2GUVA 1EDKA 2NPSD 1ZXGA 3AEBC 1A02J 2E4QA 5HL4A 1VPCA 1USEA 3CXHH 1HTLC 3SWFA 2WSFH 3GZYA 1SFCD 2N1TA 2HYNA 4OGQB 2BASA 2KZIA 1OW7A 2KUBA 1H0TA 1KV4A 4N78D 3W68A 3L75E 3H1LG 4KT0J 2V7QH 2XKMA 4QURA 2KLVA 2N1TB 2I1JA 3HUSB 4ZKUA 3TGUD 2FXMA 1YTZI 3H1KE 3UIAA 1WRGA 5E79H 3GF3A 3GZXA 2J59M 2IBZI 1QL2A 1EXJA 3L71E 3L75D 1N7SA 1YIJP 1L0LD 2B9BA 5TISE 1NKZB 1HVVA 4IFFA 4HM5A 3M0AA 2O01N 3RBZA 2RKLA 2L91A 5AW3B 3L4FA 3JC22 3OAKA 2E74D 1JOCA 4NBBD 1O7MA 1G2CA 1NAYA 3FWNA 4NB9D 3CXHE 5AW0B 3D6ZA 4QDDA 5KLVD 1NTZG 3WUUA 3VCAA 3IFMA 1IFDA 1BGYJ 4H44C 1ZP0C 1FDOA 5KLIC 2PP6A 3AE2C 2YVJB 1YBKA 2IX7C 1VM9A 2I7FA 1ZRTE 2IBZD 2E74B 1PGOA 4I7ZC 2WZ7A 2GBWA 2H88C 3HTKA 3AEAC 4XE5B 3B8EB 3O8ZA 1BE3J 4B86A 1H88A 1DH3A 2PAJA 4U3FD 5AW7B 1OW8A 4IOIH 2ZVOB 2O01J 4H44D 3A7OA 4WY4C 3WUTA 1GW4A 1L0NG 3HE4B 2YXQB 1JY2P 2P1JA 1CI6B 2O1KA 1SQVD 2K3RA 4DOJA 3IR9A 1QX8A 1JY2O 1RE4A 2D2CB 2M3BA 5M1BA 2ZT9D 1NTKD 2JO6A 3K5BA 3MUDA 1S1CX 1ZMEC 1CW5A 3S1KA 3TGUJ 2AXCA 2P67A 4WY4B 1FS0E 1S9KE 3A0BE 1FOSE 2JR8A 4TT3H 3NFQA 4N3YB 5CBOA 3GG2A 3L72G 2HFED 1S2EA 1BE3D 4NBCD 3ITKA 1DX7A 3RK2D 1Z56A 2H8PD 2NVEA 2P2UA 1IFIA 3CWBG 3AZCA 4R4LA 4Z1MH 3CD6P 2P7JA 5KAFE 2WTYA 1MZ9A 1X8YA 2OARA 3BCCD 3CCLP 4IL6E 3MD0A 1E5WA 3E1RA 1EZVG 2FKWB 1QVFO 1BGYD 1L0NE 3D6YA 4A7PA 2HMMA 4QUPA 2PGDA 3H1HD 4D6TG 2R3CA 2WPQA 4JF7A 1U7JA 4EI2A 1EZVI 4NBGD 2PFXA 1QL1A 3PHLA 2B24A 1GD2E 1K73Q 2JEEA 2KS1A 1KZUB 1HJBA 1A02F 3PH0A 1JTHB 3RK3B 3GB4A 1KQLA 2QJPC 2FXPA 1PV3A 1PL5A 2NVGA 3HUSC 1BCCD 1ZLLA 1FAVA 1P84I 1X22A 3R2PA 4I6MC 1SLQA 1FZAA 1WQLA 1MV8A 2N9BA 1RQUA 5AEUA 1EC5A 3B4SA 2M5AA 1SP4A 2ZXXA 3V2PA 1PP9D 3MP7B 1VQKP 5TJHA 1J1DC 3L71J 3R4YA 5CJ0A 1S5LE 1FDIA 3F5HA 3L70J 5B5EH 1L0NJ 1UUWA 4W7YA 1N73A 4HM0A 2XSHA 1PP9E 3LIDA 2CKFA 3FWLA 2ZT9B 1N73B 2A06G 1MUUA 4H44B 1NOHA 2NPSA 3LIEA 3D89A 5KAIE 2YMKA 1UUVA 1VCKA 1FE6A 3F89A 1LTAC 1ZR4A 4N78E 3RK2B 2DE6D 3TDKA 2AEMA 3O6QB 3VTPC 3P8MC 3TGUE 5DJUB 1N7LA 4YTPC 1N73C 3CXHI 4C7NB 3VMXA 3L71D 2Q9IA 3N7NA 5GTHH 1SQXE 1GMJA 2E74C 1FZCC 3KZIE 2QJKB 5APVA 1YQ4C 1FZEA 4H13C 2NRGA 5KLVK 5CCHC 3E1IA 3AE8C 2FYUG 2D2CC 3TNUA 4PV1D 1NHLA 1S5LH 3MTUE 3P7KA 3S4RA 1JCCA 1NAFA 3H6PA 3BCCE 3CC4P 3GW6A 3H1JG 2HLOA 1GL2C 3H1ID 3VP8A 1KYOD 5GTIE 1ZRTD 1PPJD 3CCSP 3B5ND 1PIXA 2WQYC 4HJGH 1FJKA 2YXRB 4K3AA 2E75D 1RY3A 2LXCB 4EDFA 1T2KC 1NTZJ 2M5AB 3KPEA 1O7WA 3VMAA 1UIIA 4OGQD 1G8JB 1Y9BA 3RK3E 1OVVA 2N9YB 1J1EC 4HM8A 3OA7A 4AAYB 2WVRA 5KJ7D 4ZKPA 1Q86Q 5KLVG 2E5YA 3VCPA 1LWUC 5EFWB 1VF5D 1YITP 3H1LE 3PTZA 1MKMA 2QM7A 2QM8A 4JQ0D 1S5LX 2QPZA 2G3AA 3H32B 2JDIH 3HD7B 1FZFA 3M0DC 3PLNA 1RF0A 1KYOI 1KFMA 1M1JB 3TF5A 4N6JA 2Q6QA 5KAIH 4H13D 1QEXA 1GU5A 1ZW0A 4WBAA 2UWJE 3VMHD 2Q5UA 3CWBD 3C1LA 3V4WA 1G1JA 4AYCA 3AE3C 1IO4A 2ZYAA 4UB6H 3TSIA 2FFDB 1M1JC 2Z5IA 1SQPG 4H0LB 4PD4E 1M7LA 5B66E 1D7MA 2JWDA 2R5BA 4C7NA 3H1IG 1IFJA 2Z5HA 4W7ZA 3I55P 3B5NB 2KIKA 1IK7A 3VMGD 4NPEA 2FFDC 2NWFA 3AECC 2ZJSE 2QEXP 3L74G 4RO0A 1T2KD 2HMNA 3GLMA 1NTMK 2WT7A 5GTIH 4HM3A 1LTJC 5BU8B 2V4HA 3G6EP 1SFCB 1S4XA 3H1IJ 5AW5B 2BCCE 2NUKA 2WT7B 1RHZB 2VRSA 3A0HH 4ASVA 3JCUH 1EZVD 3CXHD 2SPZA 1NTKK 3L70E 1OZHA 3RBXA 1CSBA 3L74E 2WSSH 2BEZF 1URQA 4I1LA 1KMIZ 1LTJB 1LT9B 1FBMA 1P84H 2W8ZA 1JCDA 1H89A 1W5CE 1FZGA 4QDFB 5CCHA 2WSCJ 1N7SD 1R8EA 1NU1J 3AEDC 1FDMA 2KSJA 5GTHE 2OYHC 2HPCB 3NTNA 3RGUA 2C9LY 3CCJP 1G2CB 5AW2B 4OWFA 1GW3A 2P58A 3A3YB 1M1JA 2IFMA 3CWBE 1SVFA 1FC2C 3L70G 1OX3A 4PV1C 2OTKE 2QJYC 4HM2A 2WWWA 2YO3A 1KYOH 4HJLA 1NYKA 1LTBC 1AFOA 1NU1E 1SQVE 1IC2A 2BMOA 4JYCA 1YTZT 4ZMDA 2IDBA 1OIPA 1VF5C 3L36A 2FYZA 3I5CA 3WMM0 1NTZE 5AVQB 2M8RA 2KI7B 4PJ0E 1M8OB 3CWBJ 1XTGB 1X79B 1H8AA 2AEFA 1SQBD 1SQQK 1NDOA 3GTEA 2IFNA 1U7MA 5KJ7C 3P8CD 1JY3P 1XTCC 2ZVNB 1J1EB 4WWIA 2XV5A 3PP5A 3KZIH 3AEEC 1PGQA 1NJIQ 3CI9A 4UB8H 1EDIA 3H1IE 4HM6A 1FZBA 3FOUA 1IK9A 1T3JA 2B89A 2HMOA 3HD7C 1YYCA 3VN0A 1UIXA 5DJTB 1LTGC 3GTSA 1M57D
chains in the Genus database with same CATH topology
3GCEA 4NBFD 4NBBD 1BCCE 1O7MA 1NTKE 1P84E 1RFSA 1EG9A 1O7PA 4NBAD 2Q3WA 2NUMA 4NB9D 2YIUC 1EZVE 5KKZC 3CXHE 4NBDD 4NBCD 2NVFA 4QDDA 1UUWA 2NVEA 3VCAA 4PD4E 2XSOA 3AZCA 2B1XA 2BMQA 4HM0A 3GL2A 1FQTA 2XSHA 1PP9E 2BMRA 5KLIC 4HM7A 2CKFA 2YVJB 4QUQA 3CWBE 1O7NA 1Q90C 1BE3E 4P1CH 5CXMA 2E75D 4HM4A 1VM9A 3D89A 3GKEA 2I7FA 2QJYC 4HM2A 1O7WA 1O7HA 1UUVA 1ZRTE 2HMKA 4HJLA 1SJGA 3VMGD 1NYKA 3CX5E 4OGQD 1VCKA 2NWFA 1NU1E 1L0NE 1G8JB 2GBWA 3N0QA 2JZAA 4NBHD 4P1BH 4QDCA 2E4PA 1SQVE 2YFIA 2QJKC 3GOBA 5KLVE 1SQBE 2DE6D 4HM8A 2HMMA 4QUPA 4AIVA 4AAYB 2BMOA 2FYNC 2YFJA 2E4QA 5HL4A 2HMNA 4QCKA 3TGUE 5AEWA 3L72E 1SQPE 1NTZE 2YFLA 3GZYA 3VCPA 1L0LE 2FYUE 2D2CD 2HMJA 2HMLA 4HM3A 3C0DA 1BGYE 1VF5D 4HM1A 1NTME 3H1LE 1JM1A 3H1JE 4NBGD 2XRXA 3L75E 4H44D 2DE7D 3VMID 1SQXE 2B24A 1ULIA 2IBZE 4EMJB 1NDOA 4QURA 2XR8A 3GTEA 4HKVA 2A06E 2BCCE 2NUKA 4NB8D 3GB4A 2GBXA 3H1KE 2QPZA 3DQYA 3H1HE 3L70E 4H0LD 2E76D 3EN1A 2QJPC 3GZXA 1KYOE 3EQQA 2NVGA 4QDFA 2ZT9D 3H1IE 1G8KB 3L71E 4HM6A 1RIEA 2JO6A 3L74E 1KB9E 3FOUA 3GL0A 4U3FE 1PPJE 2HMOA 4H13D 2DE5D 5BOKA 1O7GA 4PV1D 4NBED 1SQQE 1WQLA 1ULJA 4HM5A 3L73E 3VMHD 3GTSA 4D6TE 4QDFB 2ZYLA 5AEUA 2E74D 3BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCE A;  4NBF D;  4NBB D;  1BCC E;  1O7M A;  1NTK E;  1P84 E;  1RFS A;  1EG9 A;  1O7P A;  4NBA D;  2Q3W A;  2NUM A;  4NB9 D;  2YIU C;  1EZV E;  5KKZ C;  3CXH E;  4NBD D;  4NBC D;  2NVF A;  4QDD A;  1UUW A;  2NVE A;  3VCA A;  4PD4 E;  2XSO A;  3AZC A;  2B1X A;  2BMQ A;  4HM0 A;  3GL2 A;  1FQT A;  2XSH A;  1PP9 E;  2BMR A;  5KLI C;  4HM7 A;  2CKF A;  2YVJ B;  4QUQ A;  3CWB E;  1O7N A;  1Q90 C;  1BE3 E;  4P1C H;  5CXM A;  2E75 D;  4HM4 A;  1VM9 A;  3D89 A;  3GKE A;  2I7F A;  2QJY C;  4HM2 A;  1O7W A;  1O7H A;  1UUV A;  1ZRT E;  2HMK A;  4HJL A;  1SJG A;  3VMG D;  1NYK A;  3CX5 E;  4OGQ D;  1VCK A;  2NWF A;  1NU1 E;  1L0N E;  1G8J B;  2GBW A;  3N0Q A;  2JZA A;  4NBH D;  4P1B H;  4QDC A;  2E4P A;  1SQV E;  2YFI A;  2QJK C;  3GOB A;  5KLV E;  1SQB E;  2DE6 D;  4HM8 A;  2HMM A;  4QUP A;  4AIV A;  4AAY B;  2BMO A;  2FYN C;  2YFJ A;  2E4Q A;  5HL4 A;  2HMN A;  4QCK A;  3TGU E;  5AEW A;  3L72 E;  1SQP E;  1NTZ E;  2YFL A;  3GZY A;  3VCP A;  1L0L E;  2FYU E;  2D2C D;  2HMJ A;  2HML A;  4HM3 A;  3C0D A;  1BGY E;  1VF5 D;  4HM1 A;  1NTM E;  3H1L E;  1JM1 A;  3H1J E;  4NBG D;  2XRX A;  3L75 E;  4H44 D;  2DE7 D;  3VMI D;  1SQX E;  2B24 A;  1ULI A;  2IBZ E;  4EMJ B;  1NDO A;  4QUR A;  2XR8 A;  3GTE A;  4HKV A;  2A06 E;  2BCC E;  2NUK A;  4NB8 D;  3GB4 A;  2GBX A;  3H1K E;  2QPZ A;  3DQY A;  3H1H E;  3L70 E;  4H0L D;  2E76 D;  3EN1 A;  2QJP C;  3GZX A;  1KYO E;  3EQQ A;  2NVG A;  4QDF A;  2ZT9 D;  3H1I E;  1G8K B;  3L71 E;  4HM6 A;  1RIE A;  2JO6 A;  3L74 E;  1KB9 E;  3FOU A;  3GL0 A;  4U3F E;  1PPJ E;  2HMO A;  4H13 D;  2DE5 D;  5BOK A;  1O7G A;  4PV1 D;  4NBE D;  1SQQ E;  1WQL A;  1ULJ A;  4HM5 A;  3L73 E;  3VMH D;  3GTS A;  4D6T E;  4QDF B;  2ZYL A;  5AEU A;  2E74 D;  3BCC E; 
#chains in the Genus database with same CATH topology
 2CPS A;  2FYU K;  4PD4 H;  1SFC A;  3BVH A;  1KC8 Q;  1EG9 A;  2WSC H;  5KKZ C;  2AXT E;  2H7H A;  1M1K Q;  2E76 C;  4I7Z B;  2Y0C A;  1S72 P;  4DJG A;  1KB9 D;  4U3F J;  2Z4E A;  3JCU E;  1FQT A;  2IYP A;  4QUQ A;  3Q3D A;  3U59 A;  2KLU A;  1YQ3 C;  2I1K A;  4R4M A;  5KKZ B;  3KHU A;  1WT6 A;  3H1J D;  2FXO A;  4P1B H;  1DEE G;  3CX5 I;  4K35 A;  3CCV P;  2ZFC A;  3L70 D;  1RQV A;  3RK2 C;  3L72 E;  1SQV G;  1PPJ G;  1JB0 J;  3C0D A;  1AA0 A;  1JM1 A;  3L71 G;  4XA4 A;  3RK3 D;  5APS A;  2LKM A;  1NU1 K;  3H1K J;  3CX5 D;  1EQ7 A;  2XR8 A;  1NU1 D;  4GIF A;  2E5T A;  2GBX A;  3JSV C;  2POH A;  1KB9 H;  3EQQ A;  3VYI A;  1S3J A;  2IZ1 A;  4GOF A;  2FYU D;  3V2R A;  3GL0 A;  1JTH A;  1T6A A;  2A45 I;  5BOK A;  3L72 J;  2E75 B;  2A45 H;  2IPP A;  2Y9Y A;  3CMA P;  3CCR P;  2Q7C A;  2QE7 H;  2KP8 A;  2YMY A;  2XU6 A;  1KIL D;  1HGV A;  2C0W A;  1LP1 B;  1NWQ A;  1FOS F;  4NBD D;  3SSU A;  1FJP A;  5AW6 B;  4JYB A;  1R5S A;  2NPS C;  3A0H E;  1LT9 C;  2ZXE B;  1L2P A;  1OXZ A;  2WPR A;  1AQ5 A;  3L75 G;  2Q3E A;  1Q90 C;  2IZ0 A;  4OGQ C;  3VP9 A;  4WY4 A;  1RE3 C;  2Y0D A;  5BU5 A;  2K1A A;  1SQP J;  2DW3 A;  1W2E A;  1O7H A;  1SQQ J;  4BXL A;  2L5G B;  3P8C E;  4Y99 C;  5KAF H;  4NBH D;  2OGU A;  2RMZ A;  4WY4 D;  2HML A;  4YPC A;  5AW9 B;  3O6Q A;  1OW6 A;  1JY3 O;  2ITA A;  3VMI D;  1FU1 A;  3AE5 C;  1SQB K;  3C8V A;  1URQ B;  4HB1 A;  2IBZ G;  1N2D C;  3VOP A;  2KNC B;  3Q5S A;  1ZOY C;  1PP9 G;  2KSE A;  1PPJ E;  1L0L G;  1VQM P;  4C7R A;  3IF4 A;  1IFN A;  2O01 H;  2WPV B;  1HUC A;  1HJ0 A;  2RN0 A;  3AE4 C;  2JO1 A;  4GOE A;  2ZT9 C;  2O3J A;  1BCC E;  4IFM A;  2W83 C;  1W2B O;  1Q7Y Q;  2NUM A;  2YIU C;  2YO2 A;  1VQ5 P;  4UB6 E;  1YHQ P;  5AVY B;  1BSN A;  5APU A;  2KOG A;  1KOR A;  4RKU J;  2G8Y A;  2PRR A;  5CJ4 A;  3EQ2 A;  3HTK B;  4P1C H;  5CXM A;  2KS1 B;  2Y9Z A;  4HH2 A;  4IL6 X;  3L73 G;  2RH0 A;  1NTK J;  5KLV E;  1JNM A;  2QG4 A;  5AW8 B;  1OVR A;  5APX A;  2H43 A;  5APQ A;  4L76 A;  3L73 J;  1CI6 A;  3EFF K;  2P10 A;  4GOD A;  1KQF B;  1NTM E;  1RF1 A;  3BAS A;  3S9O A;  2XND H;  3SWK A;  4HKV A;  3GHG A;  1ZR2 A;  1SQQ D;  1K05 A;  1NTZ D;  3SFD C;  1LGH B;  1GL2 A;  2E76 D;  5AVU B;  1YJ9 P;  1NTK G;  2W6B A;  1SQX D;  4U3F E;  5APT A;  5CCG A;  1ULJ A;  1X0T A;  2ZYD A;  1GL2 B;  3L73 E;  1OFC X;  2KK7 A;  1SQP K;  1P84 E;  3FXE A;  1RFS A;  3L74 J;  1HH0 A;  1M90 Q;  1BDC A;  3HUS A;  1IJD B;  4GT1 A;  2N1T D;  4YXW H;  2NVF A;  1Q81 Q;  5AVS B;  2OQQ A;  3MHV A;  1NVO A;  2XSO A;  1Q90 D;  1VQL P;  1VQ9 P;  1E79 H;  3GL2 A;  4I2L C;  1MFZ A;  3A5T A;  3KXD A;  3HE5 A;  1H0T B;  1N86 A;  3E7K A;  1OVU A;  5AVW B;  2E43 A;  4DT0 A;  1DD3 A;  4LLH A;  2R32 A;  2Q1K A;  5AVR B;  1JY3 N;  3ABV C;  1SJG A;  2R5D A;  2WSE H;  5L8R J;  1AVO A;  2BCC D;  2MKV A;  1RE3 A;  3IAO A;  4AIV A;  1NU1 G;  1N7S B;  2AEJ A;  2JJL A;  3GF7 A;  2GM4 A;  2AXT H;  1SQP E;  1AVY A;  2A45 G;  4LC1 A;  3OJA B;  3NMD A;  4EMJ B;  2A06 E;  3KDP B;  1CZQ A;  1J1D B;  3BRV B;  2N1T C;  3FXD A;  3H1L D;  2QIW A;  3G9R A;  1GK4 A;  5APW A;  2XNX A;  2GUS A;  1VL2 A;  1IFM A;  3BCC J;  1FZC A;  1O7G A;  1LP1 A;  4NBE D;  4W80 A;  2OYH A;  5KJ7 A;  3CCM P;  2M0B A;  3V4Q A;  3I56 P;  2K9Y A;  1URQ C;  3FX0 A;  1WMK A;  3H1H G;  3IN6 A;  1VQ8 P;  5CCG C;  1KTM A;  3H32 A;  1L4A A;  1N8R Q;  2E42 A;  3A0B H;  1Y8A A;  2B1X A;  2LR2 A;  3AE7 C;  3L73 D;  1MFT A;  1BCC J;  1SQX J;  1P84 D;  1HWT C;  1AQT A;  1NTM D;  1Q2N A;  3QWO C;  2YKQ A;  4C46 A;  4PD4 D;  1VQO P;  1YI2 P;  1ZV8 A;  2YKO A;  1GTW A;  1OMI A;  2QJK C;  2R44 A;  4L73 A;  4BRY B;  3M0D A;  1VQN P;  3WU2 H;  1AJY A;  3Q1M A;  2YFJ A;  5CMZ A;  4M3L A;  5AVT B;  1SQQ G;  4GDO A;  2J58 A;  2QVA A;  3II6 A;  3USS A;  3AE9 C;  1VQ7 P;  2FBW C;  3B71 A;  2DE7 D;  5B66 H;  1KQS O;  5H2F E;  3C9I A;  5AVZ B;  2QA4 P;  2LXB A;  4AUW A;  1KIL B;  4H0L D;  1KYO E;  1G8K B;  2ZYG A;  2OYO A;  1VDF A;  3A2A A;  3HE5 B;  1YJW P;  3B5N A;  1EDJ A;  3SWY A;  2E75 C;  1GK6 A;  3TNU B;  5B5E E;  1T8Z A;  1KIL C;  1K8A Q;  4HKZ H;  2C9N Y;  4EYY Q;  3U1C A;  3RL0 C;  2OTJ P;  3H1L J;  3G3Z A;  4TLF A;  5H2F H;  3L72 D;  1SQX K;  3GHG C;  5CHX A;  4Y99 B;  1QGK B;  2HMK A;  3N0Q A;  2JZA A;  3GOB A;  3BCC G;  1Y47 A;  3Q5P A;  3QH9 A;  1L4A B;  1JEK A;  4CPG A;  3GHG B;  2ZAE B;  2FYU E;  4PD4 I;  2HMJ A;  2Q3I A;  1K04 A;  4UB8 E;  3EFG A;  2IYO A;  4QMA A;  4D6T D;  1KIL E;  2FYU J;  3V2Q A;  1GU4 A;  1K9M Q;  1DEB A;  1KB9 I;  1LT1 A;  3AE1 C;  5AVX B;  2NZ2 A;  3V2N A;  2BCC J;  4PJ0 H;  2YKP A;  3LW5 H;  4IL6 H;  1LNQ A;  2MJZ A;  1LWU B;  4O9B A;  2JKV A;  4XFJ A;  3G4S P;  4H0L C;  3MUD C;  2QJP B;  1SQQ E;  3CL3 D;  2YIU B;  1TU3 F;  1QLE D;  2E76 B;  3RK3 C;  4JBZ A;  5BVZ A;  3B5N C;  2Q3W A;  2FY8 A;  4RJT A;  2K88 A;  2WSE J;  1SQV K;  1KIL A;  3VMZ A;  1LTS C;  4WB4 A;  2C0X A;  2FYN B;  1IFP A;  2J5U A;  1M56 D;  2BMR A;  2KYV A;  3H1K G;  1PZQ A;  2I8D A;  1O7N A;  1NKN A;  2HR3 A;  1VQP P;  2B88 A;  3TGU G;  1DIP A;  1Q82 Q;  3VMY A;  3V5B A;  1R5L A;  2BEQ D;  2A06 D;  2FYN C;  4QCK A;  3N4X A;  3CCU P;  4JPZ B;  3CCE P;  2YFL A;  3HRN A;  2B87 A;  4ASW A;  1X9V A;  4HM1 A;  1HBW A;  3H1J E;  2XRX A;  1URQ D;  3WU2 E;  3H1H J;  1L0N D;  4HYT B;  3ZDM A;  3AE6 C;  3Q2Y A;  4NPF X;  4U7J A;  3M9Q A;  1RF1 C;  3OW2 O;  3PJS K;  1SQP D;  1LTJ A;  1FZC B;  3AEF C;  1LT9 A;  2GA1 A;  1EXI A;  3T97 A;  3DQY A;  3H1H E;  2YNY A;  3RL0 g;  2OYH B;  4QDF A;  3FGA D;  4DCK A;  2JP3 A;  1USD A;  1G1I A;  2DE5 D;  4DZO A;  4OVN F;  2OTL P;  4KHX A;  2K9J B;  1DD4 A;  3M9H A;  4D6T E;  1NTZ K;  4ZNC A;  1L4A D;  1KFN A;  3GCE A;  1L0L K;  1QVG O;  2OYI A;  1VQ4 P;  4NBA D;  3M91 A;  2K9J A;  2V7Q J;  1U57 A;  1EZV E;  1BDD A;  4H13 B;  5AVV B;  3CC7 P;  3D70 A;  1NTM G;  2QSI A;  3HD7 A;  2BMQ A;  1JUN A;  1VF5 B;  2JWA A;  5CCH D;  3BAT A;  4D6T J;  4BRY A;  1PGP A;  3WUV A;  5E79 E;  1GZL A;  1VQ6 P;  2H89 C;  2BCC G;  4LGD E;  1BGY G;  3NXS A;  5APY A;  1ZN5 A;  3L75 J;  3KYQ A;  4EIJ A;  1NO4 A;  1GDT A;  1GL2 D;  2KXP B;  2M3E A;  2KB7 P;  3EWK A;  3CX5 H;  5CCG D;  1EDL A;  2D2C D;  4PV1 B;  5C39 A;  1NH4 A;  1PP9 J;  4KJM A;  1BE3 G;  2WMM A;  2FFD A;  1LTT C;  3P32 A;  2CK3 H;  1KD1 Q;  1KN7 A;  3MGN A;  2W90 A;  1L4A C;  3EN1 A;  5AW4 B;  3G71 P;  2W6J H;  3HE4 A;  1SQB J;  1KB9 E;  3V6I A;  4AQR D;  1T3U A;  5KLI B;  2WSF J;  2ZYL A;  4NBF D;  1L0N K;  1NTK E;  2KZJ A;  3H1K D;  3CCQ P;  3SFE C;  5K5G B;  4L74 A;  1AV1 A;  2XDJ A;  3D71 A;  2B87 B;  3BRT B;  3M06 A;  1PGJ A;  1RE4 C;  1SQB G;  4HM7 A;  3PRJ A;  1RF0 C;  2W6A A;  1BE3 E;  2HOD A;  4HM4 A;  1JM0 A;  2K37 A;  1JMB A;  1PFI A;  3M9B A;  3CX5 E;  5CBN A;  3T97 B;  1BCC G;  1BSH A;  4QDC A;  1J2J B;  3LW5 J;  4BWN A;  2HOD B;  1JMM A;  3CPW O;  2KNC A;  3TK1 A;  3Q5R A;  2W27 A;  1SS1 A;  5AEW A;  1L0L E;  4OH8 B;  1BGY E;  3MIW A;  3U1A A;  3L74 D;  2OYI B;  1ULI A;  1NTM J;  1RH5 B;  3AEG C;  2IBZ E;  1SQX G;  1L0L J;  3CME P;  3HD7 D;  1LWU A;  3H25 A;  4IFD K;  4NB8 D;  2HPC A;  1SFC C;  2WPS A;  4U3F G;  1IZN B;  3CC2 P;  5AW1 B;  1NGM B;  3H1J J;  1RIE A;  3CLQ A;  2CPB A;  3W67 A;  5KTB A;  2OYI C;  3GMA A;  4YXD C;  2QRX A;  4NPD A;  5KLV J;  2O1J A;  4GKG A;  1RF1 B;  3TYY A;  2WIT A;  1HGZ A;  1O7P A;  1JY2 N;  5TIS H;  3MZW B;  1OWA A;  3RL0 D;  3L37 A;  1YJN P;  4MN4 C;  1LTI C;  2HG5 D;  1NYH A;  2XZR A;  1N7S C;  4RES B;  1S9K D;  3RL0 B;  2Y0E A;  2R3S A;  4WVZ A;  3GKE A;  1HF9 A;  3L35 A;  3KQG A;  1LJ2 A;  1SQV J;  4L75 A;  1KQG B;  2QJY B;  2E4P A;  2YFI A;  4Y28 J;  1JO5 A;  1SQB E;  4EOT A;  2NPS B;  2GUV A;  1EDK A;  2NPS D;  1ZXG A;  3AEB C;  1A02 J;  2E4Q A;  5HL4 A;  1VPC A;  1USE A;  3CXH H;  1HTL C;  3SWF A;  2WSF H;  3GZY A;  1SFC D;  2N1T A;  2HYN A;  4OGQ B;  2BAS A;  2KZI A;  1OW7 A;  2KUB A;  1H0T A;  1KV4 A;  4N78 D;  3W68 A;  3L75 E;  3H1L G;  4KT0 J;  2V7Q H;  2XKM A;  4QUR A;  2KLV A;  2N1T B;  2I1J A;  3HUS B;  4ZKU A;  3TGU D;  2FXM A;  1YTZ I;  3H1K E;  3UIA A;  1WRG A;  5E79 H;  3GF3 A;  3GZX A;  2J59 M;  2IBZ I;  1QL2 A;  1EXJ A;  3L71 E;  3L75 D;  1N7S A;  1YIJ P;  1L0L D;  2B9B A;  5TIS E;  1NKZ B;  1HVV A;  4IFF A;  4HM5 A;  3M0A A;  2O01 N;  3RBZ A;  2RKL A;  2L91 A;  5AW3 B;  3L4F A;  3JC2 2;  3OAK A;  2E74 D;  1JOC A;  4NBB D;  1O7M A;  1G2C A;  1NAY A;  3FWN A;  4NB9 D;  3CXH E;  5AW0 B;  3D6Z A;  4QDD A;  5KLV D;  1NTZ G;  3WUU A;  3VCA A;  3IFM A;  1IFD A;  1BGY J;  4H44 C;  1ZP0 C;  1FDO A;  5KLI C;  2PP6 A;  3AE2 C;  2YVJ B;  1YBK A;  2IX7 C;  1VM9 A;  2I7F A;  1ZRT E;  2IBZ D;  2E74 B;  1PGO A;  4I7Z C;  2WZ7 A;  2GBW A;  2H88 C;  3HTK A;  3AEA C;  4XE5 B;  3B8E B;  3O8Z A;  1BE3 J;  4B86 A;  1H88 A;  1DH3 A;  2PAJ A;  4U3F D;  5AW7 B;  1OW8 A;  4IOI H;  2ZVO B;  2O01 J;  4H44 D;  3A7O A;  4WY4 C;  3WUT A;  1GW4 A;  1L0N G;  3HE4 B;  2YXQ B;  1JY2 P;  2P1J A;  1CI6 B;  2O1K A;  1SQV D;  2K3R A;  4DOJ A;  3IR9 A;  1QX8 A;  1JY2 O;  1RE4 A;  2D2C B;  2M3B A;  5M1B A;  2ZT9 D;  1NTK D;  2JO6 A;  3K5B A;  3MUD A;  1S1C X;  1ZME C;  1CW5 A;  3S1K A;  3TGU J;  2AXC A;  2P67 A;  4WY4 B;  1FS0 E;  1S9K E;  3A0B E;  1FOS E;  2JR8 A;  4TT3 H;  3NFQ A;  4N3Y B;  5CBO A;  3GG2 A;  3L72 G;  2HFE D;  1S2E A;  1BE3 D;  4NBC D;  3ITK A;  1DX7 A;  3RK2 D;  1Z56 A;  2H8P D;  2NVE A;  2P2U A;  1IFI A;  3CWB G;  3AZC A;  4R4L A;  4Z1M H;  3CD6 P;  2P7J A;  5KAF E;  2WTY A;  1MZ9 A;  1X8Y A;  2OAR A;  3BCC D;  3CCL P;  4IL6 E;  3MD0 A;  1E5W A;  3E1R A;  1EZV G;  2FKW B;  1QVF O;  1BGY D;  1L0N E;  3D6Y A;  4A7P A;  2HMM A;  4QUP A;  2PGD A;  3H1H D;  4D6T G;  2R3C A;  2WPQ A;  4JF7 A;  1U7J A;  4EI2 A;  1EZV I;  4NBG D;  2PFX A;  1QL1 A;  3PHL A;  2B24 A;  1GD2 E;  1K73 Q;  2JEE A;  2KS1 A;  1KZU B;  1HJB A;  1A02 F;  3PH0 A;  1JTH B;  3RK3 B;  3GB4 A;  1KQL A;  2QJP C;  2FXP A;  1PV3 A;  1PL5 A;  2NVG A;  3HUS C;  1BCC D;  1ZLL A;  1FAV A;  1P84 I;  1X22 A;  3R2P A;  4I6M C;  1SLQ A;  1FZA A;  1WQL A;  1MV8 A;  2N9B A;  1RQU A;  5AEU A;  1EC5 A;  3B4S A;  2M5A A;  1SP4 A;  2ZXX A;  3V2P A;  1PP9 D;  3MP7 B;  1VQK P;  5TJH A;  1J1D C;  3L71 J;  3R4Y A;  5CJ0 A;  1S5L E;  1FDI A;  3F5H A;  3L70 J;  5B5E H;  1L0N J;  1UUW A;  4W7Y A;  1N73 A;  4HM0 A;  2XSH A;  1PP9 E;  3LID A;  2CKF A;  3FWL A;  2ZT9 B;  1N73 B;  2A06 G;  1MUU A;  4H44 B;  1NOH A;  2NPS A;  3LIE A;  3D89 A;  5KAI E;  2YMK A;  1UUV A;  1VCK A;  1FE6 A;  3F89 A;  1LTA C;  1ZR4 A;  4N78 E;  3RK2 B;  2DE6 D;  3TDK A;  2AEM A;  3O6Q B;  3VTP C;  3P8M C;  3TGU E;  5DJU B;  1N7L A;  4YTP C;  1N73 C;  3CXH I;  4C7N B;  3VMX A;  3L71 D;  2Q9I A;  3N7N A;  5GTH H;  1SQX E;  1GMJ A;  2E74 C;  1FZC C;  3KZI E;  2QJK B;  5APV A;  1YQ4 C;  1FZE A;  4H13 C;  2NRG A;  5KLV K;  5CCH C;  3E1I A;  3AE8 C;  2FYU G;  2D2C C;  3TNU A;  4PV1 D;  1NHL A;  1S5L H;  3MTU E;  3P7K A;  3S4R A;  1JCC A;  1NAF A;  3H6P A;  3BCC E;  3CC4 P;  3GW6 A;  3H1J G;  2HLO A;  1GL2 C;  3H1I D;  3VP8 A;  1KYO D;  5GTI E;  1ZRT D;  1PPJ D;  3CCS P;  3B5N D;  1PIX A;  2WQY C;  4HJG H;  1FJK A;  2YXR B;  4K3A A;  2E75 D;  1RY3 A;  2LXC B;  4EDF A;  1T2K C;  1NTZ J;  2M5A B;  3KPE A;  1O7W A;  3VMA A;  1UII A;  4OGQ D;  1G8J B;  1Y9B A;  3RK3 E;  1OVV A;  2N9Y B;  1J1E C;  4HM8 A;  3OA7 A;  4AAY B;  2WVR A;  5KJ7 D;  4ZKP A;  1Q86 Q;  5KLV G;  2E5Y A;  3VCP A;  1LWU C;  5EFW B;  1VF5 D;  1YIT P;  3H1L E;  3PTZ A;  1MKM A;  2QM7 A;  2QM8 A;  4JQ0 D;  1S5L X;  2QPZ A;  2G3A A;  3H32 B;  2JDI H;  3HD7 B;  1FZF A;  3M0D C;  3PLN A;  1RF0 A;  1KYO I;  1KFM A;  1M1J B;  3TF5 A;  4N6J A;  2Q6Q A;  5KAI H;  4H13 D;  1QEX A;  1GU5 A;  1ZW0 A;  4WBA A;  2UWJ E;  3VMH D;  2Q5U A;  3CWB D;  3C1L A;  3V4W A;  1G1J A;  4AYC A;  3AE3 C;  1IO4 A;  2ZYA A;  4UB6 H;  3TSI A;  2FFD B;  1M1J C;  2Z5I A;  1SQP G;  4H0L B;  4PD4 E;  1M7L A;  5B66 E;  1D7M A;  2JWD A;  2R5B A;  4C7N A;  3H1I G;  1IFJ A;  2Z5H A;  4W7Z A;  3I55 P;  3B5N B;  2KIK A;  1IK7 A;  3VMG D;  4NPE A;  2FFD C;  2NWF A;  3AEC C;  2ZJS E;  2QEX P;  3L74 G;  4RO0 A;  1T2K D;  2HMN A;  3GLM A;  1NTM K;  2WT7 A;  5GTI H;  4HM3 A;  1LTJ C;  5BU8 B;  2V4H A;  3G6E P;  1SFC B;  1S4X A;  3H1I J;  5AW5 B;  2BCC E;  2NUK A;  2WT7 B;  1RHZ B;  2VRS A;  3A0H H;  4ASV A;  3JCU H;  1EZV D;  3CXH D;  2SPZ A;  1NTK K;  3L70 E;  1OZH A;  3RBX A;  1CSB A;  3L74 E;  2WSS H;  2BEZ F;  1URQ A;  4I1L A;  1KMI Z;  1LTJ B;  1LT9 B;  1FBM A;  1P84 H;  2W8Z A;  1JCD A;  1H89 A;  1W5C E;  1FZG A;  4QDF B;  5CCH A;  2WSC J;  1N7S D;  1R8E A;  1NU1 J;  3AED C;  1FDM A;  2KSJ A;  5GTH E;  2OYH C;  2HPC B;  3NTN A;  3RGU A;  2C9L Y;  3CCJ P;  1G2C B;  5AW2 B;  4OWF A;  1GW3 A;  2P58 A;  3A3Y B;  1M1J A;  2IFM A;  3CWB E;  1SVF A;  1FC2 C;  3L70 G;  1OX3 A;  4PV1 C;  2OTK E;  2QJY C;  4HM2 A;  2WWW A;  2YO3 A;  1KYO H;  4HJL A;  1NYK A;  1LTB C;  1AFO A;  1NU1 E;  1SQV E;  1IC2 A;  2BMO A;  4JYC A;  1YTZ T;  4ZMD A;  2IDB A;  1OIP A;  1VF5 C;  3L36 A;  2FYZ A;  3I5C A;  3WMM 0;  1NTZ E;  5AVQ B;  2M8R A;  2KI7 B;  4PJ0 E;  1M8O B;  3CWB J;  1XTG B;  1X79 B;  1H8A A;  2AEF A;  1SQB D;  1SQQ K;  1NDO A;  3GTE A;  2IFN A;  1U7M A;  5KJ7 C;  3P8C D;  1JY3 P;  1XTC C;  2ZVN B;  1J1E B;  4WWI A;  2XV5 A;  3PP5 A;  3KZI H;  3AEE C;  1PGQ A;  1NJI Q;  3CI9 A;  4UB8 H;  1EDI A;  3H1I E;  4HM6 A;  1FZB A;  3FOU A;  1IK9 A;  1T3J A;  2B89 A;  2HMO A;  3HD7 C;  1YYC A;  3VN0 A;  1UIX A;  5DJT B;  1LTG C;  3GTS A;  1M57 D; 
#chains in the Genus database with same CATH homology
 3GCE A;  4NBF D;  4NBB D;  1BCC E;  1O7M A;  1NTK E;  1P84 E;  1RFS A;  1EG9 A;  1O7P A;  4NBA D;  2Q3W A;  2NUM A;  4NB9 D;  2YIU C;  1EZV E;  5KKZ C;  3CXH E;  4NBD D;  4NBC D;  2NVF A;  4QDD A;  1UUW A;  2NVE A;  3VCA A;  4PD4 E;  2XSO A;  3AZC A;  2B1X A;  2BMQ A;  4HM0 A;  3GL2 A;  1FQT A;  2XSH A;  1PP9 E;  2BMR A;  5KLI C;  4HM7 A;  2CKF A;  2YVJ B;  4QUQ A;  3CWB E;  1O7N A;  1Q90 C;  1BE3 E;  4P1C H;  5CXM A;  2E75 D;  4HM4 A;  1VM9 A;  3D89 A;  3GKE A;  2I7F A;  2QJY C;  4HM2 A;  1O7W A;  1O7H A;  1UUV A;  1ZRT E;  2HMK A;  4HJL A;  1SJG A;  3VMG D;  1NYK A;  3CX5 E;  4OGQ D;  1VCK A;  2NWF A;  1NU1 E;  1L0N E;  1G8J B;  2GBW A;  3N0Q A;  2JZA A;  4NBH D;  4P1B H;  4QDC A;  2E4P A;  1SQV E;  2YFI A;  2QJK C;  3GOB A;  5KLV E;  1SQB E;  2DE6 D;  4HM8 A;  2HMM A;  4QUP A;  4AIV A;  4AAY B;  2BMO A;  2FYN C;  2YFJ A;  2E4Q A;  5HL4 A;  2HMN A;  4QCK A;  3TGU E;  5AEW A;  3L72 E;  1SQP E;  1NTZ E;  2YFL A;  3GZY A;  3VCP A;  1L0L E;  2FYU E;  2D2C D;  2HMJ A;  2HML A;  4HM3 A;  3C0D A;  1BGY E;  1VF5 D;  4HM1 A;  1NTM E;  3H1L E;  1JM1 A;  3H1J E;  4NBG D;  2XRX A;  3L75 E;  4H44 D;  2DE7 D;  3VMI D;  1SQX E;  2B24 A;  1ULI A;  2IBZ E;  4EMJ B;  1NDO A;  4QUR A;  2XR8 A;  3GTE A;  4HKV A;  2A06 E;  2BCC E;  2NUK A;  4NB8 D;  3GB4 A;  2GBX A;  3H1K E;  2QPZ A;  3DQY A;  3H1H E;  3L70 E;  4H0L D;  2E76 D;  3EN1 A;  2QJP C;  3GZX A;  1KYO E;  3EQQ A;  2NVG A;  4QDF A;  2ZT9 D;  3H1I E;  1G8K B;  3L71 E;  4HM6 A;  1RIE A;  2JO6 A;  3L74 E;  1KB9 E;  3FOU A;  3GL0 A;  4U3F E;  1PPJ E;  2HMO A;  4H13 D;  2DE5 D;  5BOK A;  1O7G A;  4PV1 D;  4NBE D;  1SQQ E;  1WQL A;  1ULJ A;  4HM5 A;  3L73 E;  3VMH D;  3GTS A;  4D6T E;  4QDF B;  2ZYL A;  5AEU A;  2E74 D;  3BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...