2IBZE

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
185
structure length
185
Chain Sequence
b'KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
molecule tags Oxidoreductase
source organism Mus musculus
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
total genus 45
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2ibzE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2ibzE02
1WQLA 5HL4A 4HKVA 1EZVE 3FOUA 4NB8D 2HMLA 5KKZC 3GTEA 3VMHD 2XR8A 3VCPA 3CWBE 4HM4A 2GBWA 3L75E 1L0LE 2E75D 1G8JB 3TGUE 4QCKA 4HM1A 3L74E 1RIEA 2XSHA 1PPJE 2FYNC 2NUMA 1SQPE 4NBDD 2A06E 1G8KB 2BMRA 4NBBD 2Q3WA 4U3FE 2QJPC 3CXHE 1VM9A 1KYOE 3H1JE 4HM6A 1FQTA 4NBCD 4D6TE 2I7FA 2QJYC 4AAYB 4HM2A 4QDFB 2NUKA 1RFSA 2YFLA 3GCEA 1SQQE 2NVEA 3GZYA 4HM8A 3VCAA 3AZCA 1KB9E 4OGQD 3L70E 1O7MA 2ZYLA 5AEUA 1ZRTE 1O7HA 3H1KE 4QDCA 2E4PA 2ZT9D 1PP9E 2DE5D 2IBZE 3CX5E 1NDOA 2YFIA 4HJLA 5BOKA 1NTME 4EMJB 1O7NA 2CKFA 2HMKA 1P84E 1SJGA 2YIUC 2BCCE 3GTSA 2HMMA 4P1BH 3D89A 5KLVE 1UUVA 1EG9A 2NVFA 3GB4A 1VCKA 4NBFD 5AEWA 5CXMA 1NTKE 2E76D 4HM7A 3L72E 2E74D 3BCCE 1ULJA 2QPZA 2YVJB 3C0DA 3GOBA 1JM1A 3EN1A 4PV1D 4QUQA 2HMOA 2E4QA 1SQXE 3H1HE 2FYUE 3EQQA 3GKEA 1BGYE 4NBED 1ULIA 3N0QA 3L71E 1SQVE 2GBXA 4QDDA 4H44D 3VMGD 1NU1E 3L73E 4QUPA 2HMJA 2NWFA 1BE3E 1L0NE 4NBGD 3GZXA 4NBAD 3DQYA 4QDFA 4NB9D 1O7GA 1Q90C 2B1XA 2BMOA 2JO6A 3GL2A 3H1IE 4QURA 3VMID 1VF5D 1O7PA 2B24A 4H0LD 1UUWA 4NBHD 3H1LE 4HM5A 1SQBE 4HM3A 4HM0A 4AIVA 2JZAA 2NVGA 3GL0A 1O7WA 2YFJA 4H13D 1NTZE 4P1CH 1BCCE 5KLIC 2QJKC 2BMQA 2DE7D 2D2CD 2XSOA 1NYKA 2XRXA 2HMNA 2DE6D 4PD4E
chains in the Genus database with same CATH superfamily
4KHXA 3A0HE 1LWUA 1G2CA 1EZVE 2H7HA 4WY4A 1KMIZ 4IFFA 2E43A 4IFDK 1P84H 1ZLLA 1G8KB 2O01N 3CXHD 2B88A 2NPSA 1SFCB 2IDBA 2NUKA 4PV1B 1N8RQ 2OTLP 2OQQA 3F89A 3H1KE 1JTHB 2OYHA 3R4YA 4EI2A 1L4AC 3H1KJ 4N6JA 3QWOC 1KTMA 3L71D 1UUVA 1EG9A 3CCEP 1MFZA 1SQQD 3FWNA 2DW3A 3KQGA 3B4SA 2KOGA 2M5AB 4QUQA 2B89A 1SQXE 2K9YA 3H1LD 3AE5C 1NTZJ 2KLVA 5AVRB 3L73J 1AVOA 1IC2A 3U59A 1BE3E 1L0NE 1N7SA 3CCMP 4WBAA 3M0DC 3EFFK 4PD4I 1NTKG 2Q6QA 3HRNA 4ASWA 1OX3A 2QG4A 2IBZG 3Q1MA 2QJPB 1SFCA 1PGQA 5CJ0A 3MP7B 1R8EA 3ABVC 2FYUK 1T2KD 3O8ZA 3H1KD 1FZFA 1GU5A 1UIIA 1L0NK 2ZVOB 4HM1A 5AW3B 4H13C 1JCDA 2YKQA 1RE4A 1KILB 3HUSB 1ZR4A 1L0LJ 1Q7YQ 1O7MA 5AEUA 1H8AA 4H0LB 3CX5E 4PV1C 2QM8A 2O1JA 1VQOP 5AW6B 2XDJA 3B5NC 2Y0DA 1RE3C 1IFNA 4ZKUA 5AEWA 1QL2A 1JOCA 3BCCE 5AVSB 1PGPA 5CCHD 1W5CE 3RL0B 5APVA 3AE7C 1DD3A 2FFDB 1ZOYC 4N78D 1NO4A 2HPCB 1S2EA 1M1KQ 1FZCB 1HJ0A 1T6AA 1JCCA 3GMAA 1HUCA 1L0LG 1OFCX 1O7GA 3FX0A 4EOTA 1H0TB 3CMEP 3A0BH 4NBHD 1SQBE 3GL0A 3H1HG 5K5GB 2OYIC 1O7WA 1OXZA 4U3FJ 5KLIC 4UB6E 2WPQA 3SWYA 4NPFX 3CXHH 1SQQG 2FFDC 3H32B 4HYTB 2R5BA 2GUVA 3VCPA 3PP5A 4AQRD 1NOHA 3TGUD 3L75D 3KYQA 2D2CB 1KQSO 1RIEA 3VMZA 5CJ4A 2H43A 1GK4A 3H32A 2BCCJ 1S4XA 1TU3F 3RL0D 2PGDA 2L91A 3B5ND 3Q5SA 3B5NB 1KB9D 4YXWH 1SQPD 3M9HA 1H0TA 5BU8B 3FXEA 5APQA 1O7HA 1SQPJ 1M1JA 2YFIA 3L74J 2WPSA 1VQ8P 4HH2A 3LW5H 1OWAA 1PGJA 3S4RA 2BCCE 1L4AA 3L73D 3GB4A 3TYYA 1KB9I 2W90A 4OWFA 3OJAB 1NTZK 1NTKK 1MKMA 1CI6A 4PV1D 1G2CB 3CXHI 2WSSH 1LT9B 1PPJD 3GKEA 2W6JH 1E79H 3AEEC 4C7NB 1ULIA 4UB6H 1LTSC 2IFNA 3CCRP 3V4QA 3TF5A 3CI9A 1PGOA 2IPPA 2J5UA 1RF1B 1EDIA 1AVYA 3VOPA 3H1IE 3M0DA 3FGAD 2KUBA 1SQXD 3H1JJ 3N7NA 1LTJC 2M8RA 2XRXA 3FOUA 1BCCJ 1WQLA 5KAIE 5APXA 3L72J 3I55P 3AECC 1JEKA 3CD6P 2NPSC 5AW2B 1PPJE 3C9IA 2Q1KA 1J1EC 3RK2C 4NBCD 3CCUP 1SQVK 1OW7A 3IAOA 1PV3A 1FC2C 3V5BA 4I7ZC 1S5LH 1PP9G 5AW5B 2ZT9C 2DE5D 1KILE 4EMJB 3CCQP 1DD4A 3HD7B 1X9VA 1YJ9P 4IL6X 1SJGA 1RF1C 1NKZB 1OMIA 1EZVI 3CWBD 2KXPB 1IJDB 2R3CA 1PFIA 2YVJB 1LT9C 2JJLA 3VMYA 4UB8E 4BXLA 4L74A 4NPEA 1VF5C 1XTCC 3GHGA 2LXCB 3N0QA 2Z4EA 3GW6A 4N78E 3LW5J 4GOFA 4GDOA 3HE5A 1FOSE 5GTIH 3W68A 3AEGC 4HJGH 1HF9A 1HBWA 1LTBC 1BE3D 3MUDA 3VMAA 2KZIA 3H1KG 3C8VA 2RN0A 2WT7A 5TJHA 4U3FG 2A45I 1WRGA 1NTZE 2Y0CA 2DE6D 2KIKA 2Y9ZA 4RJTA 4BRYB 1M57D 3OA7A 2HMLA 4KT0J 4QMAA 3GTEA 4HM4A 2KNCA 1FZBA 2B9BA 1YTZT 3WU2E 1PPJG 2KP8A 1VDFA 3B71A 1KYOE 1VQ5P 5KJ7D 1NTKD 4HM2A 1SLQA 2QE7H 1Y9BA 1NHLA 2OYIB 1ZRTE 4EYYQ 1U7JA 4XA4A 3U1AA 1L4AD 4LLHA 5TISH 1NTMD 2HFED 1BDDA 1MUUA 2SPZA 1LWUC 1J1DC 3CX5I 4WY4C 3HUSA 2AEFA 5KLVE 1LP1B 2ZT9B 3KPEA 3EQ2A 4DOJA 1SQPK 4I1LA 3Q2YA 2WQYC 1YJNP 5E79H 3L75J 3AE2C 4PD4H 1N73C 1NH4A 3A0BE 1QEXA 4YTPC 1BE3G 3GF7A 1LGHB 3V4WA 1AV1A 2K1AA 3LIEA 2N1TB 2Y9YA 2IYPA 1FAVA 1GTWA 4NB9D 3V2RA 1IFDA 4C7NA 1FZAA 1M1JB 4HM5A 5KLVD 1GL2A 2BMQA 2D2CD 4PD4E 1T2KC 5KLVJ 3RK3D 5CCGC 4NB8D 3B5NA 2CPSA 3L74G 2AEJA 2NUMA 2A06E 2FYUG 1JY3P 2FYUD 1VQPP 1N73A 4NBBD 3CXHE 1SVFA 1VM9A 4MN4C 1NU1G 4AAYB 1S72P 4QDFB 4D6TG 2YFLA 3AEFC 4JBZA 2BEZF 2YMKA 2KSEA 1KB9E 2QA4P 4GT1A 2Z5HA 2LXBA 3V6IA 3RL0g 1T3UA 1NTME 2P10A 2B87B 4RO0A 1PZQA 1NWQA 2WWWA 3D89A 3U1CA 3IN6A 1FDOA 1RQUA 3AEBC 1HGVA 3L70J 3MHVA 4LGDE 4EDFA 4I7ZB 1GD2E 1JM1A 3H1HE 2XKMA 3H1ID 1J1EB 1GL2B 4H44D 2D2CC 1USEA 1JY2O 1EDLA 1KILD 2JWAA 1URQB 1JMBA 2E75B 3VP8A 3GLMA 3F5HA 1T3JA 2K9JB 2QSIA 4W7YA 1YJWP 1HJBA 2JZAA 2NVGA 4RKUJ 2DE7D 5GTHE 3L71G 1Z56A 1ZR2A 2Q3IA 2RMZA 1NYHA 5AVUB 5H2FE 3TGUE 2QIWA 1RQVA 2WTYA 4NBDD 2R5DA 4JQ0D 3AE6C 4HM6A 5KLVG 2I7FA 2BEQD 2QJYC 4JF7A 2MKVA 2JKVA 3RK3C 2XU6A 3AZCA 4C46A 1X8YA 2WPVB 4ZMDA 4IFMA 1URQA 1AFOA 1O7NA 3HD7D 1RE4C 5B5EH 4DT0A 1H88A 5GTIE 1KFNA 1FZEA 2IBZI 2R32A 1MFTA 2G3AA 2NVFA 4ASVA 1VCKA 3CWBJ 1R5LA 1JY3O 1VQ9P 3B8EB 2GM4A 3CCJP 4O9BA 1OW6A 1URQC 2M3EA 3H1JG 5GTHH 2V4HA 1ZMEC 1NU1E 3CCVP 2N9BA 2ZYGA 2FYZA 2HG5D 3PTZA 1Q81Q 3H1LJ 1RF0C 1SQBD 5AW7B 4H0LD 2N1TD 3HTKA 3PH0A 1S1CX 3HE5B 3RBXA 2ZXXA 2H8PD 4Z1MH 3RBZA 2NPSD 3VMHD 3NTNA 2GBWA 1IZNB 5KTBA 2E75D 2KSJA 3L74E 1SQPE 1WT6A 3A5TA 2YNYA 1KQGB 1FQTA 1YIJP 1JTHA 4D6TE 2OGUA 3IR9A 1RFSA 1M8OB 1Q2NA 1OW8A 2NVEA 3GZYA 1CSBA 3JSVC 3AE1C 2OYHC 2YKPA 1CW5A 2K3RA 3L75G 2PP6A 3VYIA 1IFMA 3G9RA 2JEEA 3CLQA 1KYOH 3RK3E 1XTGB 5CXMA 1M1JC 1S3JA 2AEMA 2E76D 2O01H 1YQ4C 2JO1A 1SFCC 2P2UA 3S9OA 2OTKE 2FYUE 2FKWB 1JMMA 1LP1A 4W7ZA 4H13B 1P84D 2HMJA 2NWFA 1N7SC 2ZAEB 4DCKA 1YYCA 1IK7A 1SQQK 1OIPA 3GG2A 2M3BA 1FS0E 4JYCA 1ZRTD 4B86A 2IYOA 1FZGA 3SWFA 3L71J 5CBOA 4OH8B 1GL2D 3RK2D 5C39A 1KYOD 2HMNA 1SQVE 3L72D 5HL4A 4HKVA 2QRXA 2XR8A 3CWBE 5AW0B 2E74B 2AXTH 3CC7P 1PL5A 2GA1A 3I5CA 3K5BA 5KJ7C 3P8CE 3T97B 2YIUB 4JYBA 3CX5H 2QM7A 1FJKA 4OGQD 5KAFH 1EXJA 3HTKB 2E4PA 4HJLA 1KORA 2K88A 2HMKA 3OW2O 1BCCD 2Q9IA 3A2AA 3D71A 2WMMA 2WITA 1EZVG 1UIXA 1NTKE 2IBZD 1VL2A 1FBMA 4YXDC 5AW1B 1NVOA 1VQ4P 5B66H 2A06G 1NTMJ 2WSFJ 1EC5A 2E4QA 1RF0A 1URQD 1GZLA 1HGZA 2WSCH 2YXQB 4QDDA 2YMYA 1U7MA 2GUSA 1K04A 4QDFA 1PP9D 3M06A 1DEEG 4GOEA 2BMOA 1M56D 4QURA 5CHXA 1VF5D 5AVTB 3H25A 1GMJA 4HM3A 3T97A 4HB1A 1IFJA 1BCCE 5B66E 2ITAA 2E5YA 1L0NJ 1LJ2A 2N9YB 3L74D 1AA0A 1L0LE 5AVZB 1X79B 4EIJA 1NJIQ 2BMRA 3TNUB 1MV8A 2A45H 2W6AA 3H1JE 1RE3A 4XFJA 1G1JA 1NU1D 1NTZD 4WY4D 1SQVJ 3VP9A 2JP3A 1YHQP 4HM8A 3CWBG 2KS1A 1GW3A 2KS1B 1S5LE 3H6PA 2FYUJ 5DJUB 4U3FD 1HVVA 3WU2H 1YITP 5CCHA 1JB0J 1LT9A 5AVQB 1N2DC 2E74C 2E76C 1ULJA 2WSEJ 1GU4A 2XZRA 2FXPA 4UB8H 1DH3A 4I2LC 2W8ZA 2K9JA 2ZYDA 4WWIA 4WVZA 4NBGD 5DJTB 4OVNF 3Q3DA 1K73Q 2YKOA 3GL2A 5AVXB 1NTMG 4AIVA 2YFJA 1QVGO 1X22A 1NU1K 4Y99B 1NYKA 4R4LA 1BE3J 1KN7A 2POHA 1KZUB 3L70G 2M5AA 1G8JB 3JCUH 3N4XA 3P8MC 3WMM0 1PP9J 2XV5A 1KQFB 2I1JA 2B87A 4U3FE 1KD1Q 3BRTB 2WT7B 4XE5B 2LR2A 3AE8C 3RK2B 3MD0A 3PHLA 1GK6A 1KV4A 2CPBA 2NZ2A 2HR3A 2NPSB 2Q5UA 1SQXK 3AE4C 1ZW0A 2FFDA 1VQKP 5KLIB 2P1JA 4W80A 3Q5RA 3IF4A 4ZNCA 4L75A 1LNQA 3HE4A 2A45G 4K3AA 1P84I 3H1IG 4WY4B 5BU5A 5AW4B 4I6MC 1J1DB 1SP4A 1LT1A 3EQQA 1FZCC 3CC4P 4ZKPA 2I8DA 5AVYB 2BCCD 1IFIA 2O01J 3PLNA 5L8RJ 3QH9A 3GZXA 4NBAD 1NKNA 2KYVA 1L0ND 2Y0EA 1T8ZA 2B1XA 2JO6A 1JUNA 3WUVA 2B24A 1JM0A 1BDCA 3AEAC 3BASA 4PD4D 2QJKC 1S9KE 3KHUA 3PRJA 2Q3EA 2W6BA 2CK3H 1BSHA 5AVWB 1N7LA 4U7JA 2IZ1A 4K35A 2PAJA 3IFMA 3L75E 4QCKA 2L5GB 2ZVNB 3H1IJ 3H1HD 1FU1A 1FE6A 2HODA 3KZIH 1BSNA 3LIDA 1EXIA 1BCCG 2ZFCA 5TISE 2QJKB 3MUDC 2ZYAA 2VRSA 1KB9H 3M9BA 2IBZE 2FBWC 1NGMB 3GHGC 2KZJA 2QJYB 4IL6E 2Q7CA 1W2BO 2YIUC 3KXDA 3GTSA 3ZDMA 3HE4B 4M3LA 1YBKA 4NBFD 2OTJP 4OGQB 3M91A 1EDJA 5CCHC 1LTAC 1L0LK 3GOBA 1SQXJ 3H1JD 3SWKA 2C9LY 1J2JB 1HTLC 3HD7C 1LTGC 3MZWB 1SS1A 3L73G 2J58A 5AW8B 3V2QA 3P8CD 3VMGD 1L0NG 3WUUA 4QUPA 3VMXA 4TLFA 3SFEC 1CZQA 3D70A 4LC1A 2JWDA 2E75C 1LTTC 3BRVB 3VMID 2MJZA 4DJGA 1MZ9A 2RH0A 3W67A 1SQBK 1GL2C 3AE3C 2P7JA 1GW4A 1SQVG 2XNXA 1N86A 4BWNA 1FZCA 3TDKA 1A02F 2A06D 5KKZC 3BATA 3MTUE 1K05A 4AUWA 3VTPC 1BGYD 1LTJB 2W83C 1ZP0C 3RGUA 4H0LC 1SQXG 1YTZI 2OYOA 1K9MQ 2UWJE 2YO3A 1FOSF 1EQ7A 3HUSC 1Q82Q 3E1RA 2I1KA 3NMDA 4D6TJ 1AJYA 3CCLP 3M9QA 4OGQC 1L0LD 2KI7B 3GF3A 4IOIH 1NDOA 2K37A 5BOKA 2C0XA 5APUA 3G71P 2W27A 2R44A 2HMMA 1RF1A 4WB4A 1OVRA 1DIPA 1EDKA 3OAKA 1EZVD 3C1LA 5EFWB 1IFPA 3L72E 2IZ0A 3C0DA 3SSUA 2QVAA 4NPDA 2G8YA 2R3SA 3L71E 1BGYG 4YPCA 4Y28J 2QEXP 4H44B 5B5EE 1KFMA 3FXDA 1Y8AA 1ZV8A 3TGUG 2RKLA 1KQLA 3A3YB 1Q90D 2BASA 4N3YB 5KKZB 4L73A 3TSIA 1YI2P 3AEDC 1ZN5A 3TNUA 3S1KA 2V7QH 2LKMA 1CI6B 2J59M 5AVVB 3P7KA 5BVZA 5APYA 1NU1J 1RH5B 2XSOA 1D7MA 3AE9C 3A7OA 5CBNA 5APWA 5CCGD 4KJMA 3UIAA 5KAIH 1DX7A 2KNCB 3SFDC 1OVVA 2FXOA 2O1KA 3R2PA 2FY8A 1R5SA 1USDA 1Q86Q 3CCSP 4CPGA 1NTZG 2PRRA 1SQQE 1AQ5A 1A02J 1JY2N 4QDCA 1X0TA 1OVUA 5KLVK 1VQLP 3V2NA 1P84E 3RL0C 3RK3B 2P58A 4P1BH 1G1IA 1QX8A 3L70D 3I56P 5APTA 3GHGB 1SQQJ 1GDTA 3CL3D 2HYNA 3KDPB 2ZJSE 4D6TD 1IK9A 5H2FH 3L35A 2WSCJ 4HKZH 3L37A 1SQBG 1RHZB 3II6A 1BGYE 4C7RA 3EWKA 3H1HJ 2WZ7A 2GBXA 3L73E 3G6EP 1N7SD 3JC22 4R4MA 1KILC 2HPCA 3L72G 2PFXA 1K8AQ 3H1LG 1O7PA 3L4FA 1BGYJ 2E5TA 2N1TA 1ZXGA 1HWTC 2JR8A 4GIFA 3JCUE 2HODB 1QLED 1VF5B 1QGKB 1U57A 1JY3N 5CCGA 2AXTE 1FDIA 2M0BA 4GKGA 2FYNC 3CPWO 1FDMA 4IL6H 2O3JA 2AXCA 5E79E 2XNDH 1VQMP 2HLOA 2QJPC 2IX7C 1WMKA 3E1IA 2V7QJ 2WPRA 2WSFH 3BCCJ 3G3ZA 1VQNP 3TK1A 1DEBA 2KLUA 2OYIA 2WSEH 1JNMA 4GODA 1S9KD 5KJ7A 3KZIE 1N7SB 1KC8Q 2JDIH 3EFGA 3O6QA 1LTJA 3CX5D 1RY3A 1M90Q 2QPZA 3BVHA 1QVFO 3EN1A 1FJPA 1NTMK 5APSA 4BRYA 4NBED 1H89A 2FXMA 1L4AB 2BCCG 2KK7A 1VQ6P 1NTKJ 3VN0A 4RESB 2Z5IA 3DQYA 1YQ3C 3P32A 5KAFE 1Q90C 1SQPG 1AQTA 1UUWA 3H1LE 2N1TC 4Y99C 2OYHB 4P1CH 1JY2P 1SQBJ 3NFQA 1NAFA 3Q5PA 1N73B 2WVRA 3WUTA 2XSHA 2P67A 3ITKA 3G4SP 1KYOI 3MGNA 1L2PA 2Q3WA 3D6ZA 2YO2A 3O6QB 4TT3H 3HD7A 1LTIC 1LWUB 3GCEA 3L36A 1Y47A 1PIXA 3VCAA 3L70E 1JO5A 3FWLA 2E76B 2ZYLA 2ZT9D 1PP9E 1W2EA 2FYNB 2KB7P 2CKFA 3V2PA 5CMZA 2IFMA 4A7PA 3E7KA 3TGUJ 4HM7A 2E74D 3USSA 4AYCA 2NRGA 3BCCG 3BCCD 1SFCD 2HMOA 1VPCA 3CMAP 3CC2P 1NAYA 2H89C 3A0HH 4H44C 1OZHA 3NXSA 4PJ0E 2E42A 4DZOA 3M0AA 2C9NY 5AW9B 1S5LX 1E5WA 3PJSK 1VQ7P 1M7LA 2C0WA 4JPZB 2H88C 4L76A 1KILA 1HH0A 5M1BA 4HM0A 3D6YA 2OARA 4H13D 2YXRB 3MIWA 1QL1A 1SQVD 4PJ0H 1IO4A 2ZXEB
chains in the Genus database with same CATH topology
1WQLA 5HL4A 4HKVA 1EZVE 3FOUA 4NB8D 2HMLA 5KKZC 3GTEA 3VMHD 2XR8A 3VCPA 3CWBE 4HM4A 2GBWA 3L75E 1L0LE 2E75D 1G8JB 3TGUE 4QCKA 4HM1A 3L74E 1RIEA 2XSHA 1PPJE 2FYNC 2NUMA 1SQPE 4NBDD 2A06E 1G8KB 2BMRA 4NBBD 2Q3WA 4U3FE 2QJPC 3CXHE 1VM9A 1KYOE 3H1JE 4HM6A 1FQTA 4NBCD 4D6TE 2I7FA 2QJYC 4AAYB 4HM2A 4QDFB 2NUKA 1RFSA 2YFLA 3GCEA 1SQQE 2NVEA 3GZYA 4HM8A 3VCAA 3AZCA 1KB9E 4OGQD 3L70E 1O7MA 2ZYLA 5AEUA 1ZRTE 1O7HA 3H1KE 4QDCA 2E4PA 2ZT9D 1PP9E 2DE5D 2IBZE 3CX5E 1NDOA 2YFIA 4HJLA 5BOKA 1NTME 4EMJB 1O7NA 2CKFA 2HMKA 1P84E 1SJGA 2YIUC 2BCCE 3GTSA 2HMMA 4P1BH 3D89A 5KLVE 1UUVA 1EG9A 2NVFA 3GB4A 1VCKA 4NBFD 5AEWA 5CXMA 1NTKE 2E76D 4HM7A 3L72E 2E74D 3BCCE 1ULJA 2QPZA 2YVJB 3C0DA 3GOBA 1JM1A 3EN1A 4PV1D 4QUQA 2HMOA 2E4QA 1SQXE 3H1HE 2FYUE 3EQQA 3GKEA 1BGYE 4NBED 1ULIA 3N0QA 3L71E 1SQVE 2GBXA 4QDDA 4H44D 3VMGD 1NU1E 3L73E 4QUPA 2HMJA 2NWFA 1BE3E 1L0NE 4NBGD 3GZXA 4NBAD 3DQYA 4QDFA 4NB9D 1O7GA 1Q90C 2B1XA 2BMOA 2JO6A 3GL2A 3H1IE 4QURA 3VMID 1VF5D 1O7PA 2B24A 4H0LD 1UUWA 4NBHD 3H1LE 4HM5A 1SQBE 4HM3A 4HM0A 4AIVA 2JZAA 2NVGA 3GL0A 1O7WA 2YFJA 4H13D 1NTZE 4P1CH 1BCCE 5KLIC 2QJKC 2BMQA 2DE7D 2D2CD 2XSOA 1NYKA 2XRXA 2HMNA 2DE6D 4PD4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQL A;  5HL4 A;  4HKV A;  1EZV E;  3FOU A;  4NB8 D;  2HML A;  5KKZ C;  3GTE A;  3VMH D;  2XR8 A;  3VCP A;  3CWB E;  4HM4 A;  2GBW A;  3L75 E;  1L0L E;  2E75 D;  1G8J B;  3TGU E;  4QCK A;  4HM1 A;  3L74 E;  1RIE A;  2XSH A;  1PPJ E;  2FYN C;  2NUM A;  1SQP E;  4NBD D;  2A06 E;  1G8K B;  2BMR A;  4NBB D;  2Q3W A;  4U3F E;  2QJP C;  3CXH E;  1VM9 A;  1KYO E;  3H1J E;  4HM6 A;  1FQT A;  4NBC D;  4D6T E;  2I7F A;  2QJY C;  4AAY B;  4HM2 A;  4QDF B;  2NUK A;  1RFS A;  2YFL A;  3GCE A;  1SQQ E;  2NVE A;  3GZY A;  4HM8 A;  3VCA A;  3AZC A;  1KB9 E;  4OGQ D;  3L70 E;  1O7M A;  2ZYL A;  5AEU A;  1ZRT E;  1O7H A;  3H1K E;  4QDC A;  2E4P A;  2ZT9 D;  1PP9 E;  2DE5 D;  2IBZ E;  3CX5 E;  1NDO A;  2YFI A;  4HJL A;  5BOK A;  1NTM E;  4EMJ B;  1O7N A;  2CKF A;  2HMK A;  1P84 E;  1SJG A;  2YIU C;  2BCC E;  3GTS A;  2HMM A;  4P1B H;  3D89 A;  5KLV E;  1UUV A;  1EG9 A;  2NVF A;  3GB4 A;  1VCK A;  4NBF D;  5AEW A;  5CXM A;  1NTK E;  2E76 D;  4HM7 A;  3L72 E;  2E74 D;  3BCC E;  1ULJ A;  2QPZ A;  2YVJ B;  3C0D A;  3GOB A;  1JM1 A;  3EN1 A;  4PV1 D;  4QUQ A;  2HMO A;  2E4Q A;  1SQX E;  3H1H E;  2FYU E;  3EQQ A;  3GKE A;  1BGY E;  4NBE D;  1ULI A;  3N0Q A;  3L71 E;  1SQV E;  2GBX A;  4QDD A;  4H44 D;  3VMG D;  1NU1 E;  3L73 E;  4QUP A;  2HMJ A;  2NWF A;  1BE3 E;  1L0N E;  4NBG D;  3GZX A;  4NBA D;  3DQY A;  4QDF A;  4NB9 D;  1O7G A;  1Q90 C;  2B1X A;  2BMO A;  2JO6 A;  3GL2 A;  3H1I E;  4QUR A;  3VMI D;  1VF5 D;  1O7P A;  2B24 A;  4H0L D;  1UUW A;  4NBH D;  3H1L E;  4HM5 A;  1SQB E;  4HM3 A;  4HM0 A;  4AIV A;  2JZA A;  2NVG A;  3GL0 A;  1O7W A;  2YFJ A;  4H13 D;  1NTZ E;  4P1C H;  1BCC E;  5KLI C;  2QJK C;  2BMQ A;  2DE7 D;  2D2C D;  2XSO A;  1NYK A;  2XRX A;  2HMN A;  2DE6 D;  4PD4 E; 
#chains in the Genus database with same CATH topology
 4KHX A;  3A0H E;  1LWU A;  1G2C A;  1EZV E;  2H7H A;  4WY4 A;  1KMI Z;  4IFF A;  2E43 A;  4IFD K;  1P84 H;  1ZLL A;  1G8K B;  2O01 N;  3CXH D;  2B88 A;  2NPS A;  1SFC B;  2IDB A;  2NUK A;  4PV1 B;  1N8R Q;  2OTL P;  2OQQ A;  3F89 A;  3H1K E;  1JTH B;  2OYH A;  3R4Y A;  4EI2 A;  1L4A C;  3H1K J;  4N6J A;  3QWO C;  1KTM A;  3L71 D;  1UUV A;  1EG9 A;  3CCE P;  1MFZ A;  1SQQ D;  3FWN A;  2DW3 A;  3KQG A;  3B4S A;  2KOG A;  2M5A B;  4QUQ A;  2B89 A;  1SQX E;  2K9Y A;  3H1L D;  3AE5 C;  1NTZ J;  2KLV A;  5AVR B;  3L73 J;  1AVO A;  1IC2 A;  3U59 A;  1BE3 E;  1L0N E;  1N7S A;  3CCM P;  4WBA A;  3M0D C;  3EFF K;  4PD4 I;  1NTK G;  2Q6Q A;  3HRN A;  4ASW A;  1OX3 A;  2QG4 A;  2IBZ G;  3Q1M A;  2QJP B;  1SFC A;  1PGQ A;  5CJ0 A;  3MP7 B;  1R8E A;  3ABV C;  2FYU K;  1T2K D;  3O8Z A;  3H1K D;  1FZF A;  1GU5 A;  1UII A;  1L0N K;  2ZVO B;  4HM1 A;  5AW3 B;  4H13 C;  1JCD A;  2YKQ A;  1RE4 A;  1KIL B;  3HUS B;  1ZR4 A;  1L0L J;  1Q7Y Q;  1O7M A;  5AEU A;  1H8A A;  4H0L B;  3CX5 E;  4PV1 C;  2QM8 A;  2O1J A;  1VQO P;  5AW6 B;  2XDJ A;  3B5N C;  2Y0D A;  1RE3 C;  1IFN A;  4ZKU A;  5AEW A;  1QL2 A;  1JOC A;  3BCC E;  5AVS B;  1PGP A;  5CCH D;  1W5C E;  3RL0 B;  5APV A;  3AE7 C;  1DD3 A;  2FFD B;  1ZOY C;  4N78 D;  1NO4 A;  2HPC B;  1S2E A;  1M1K Q;  1FZC B;  1HJ0 A;  1T6A A;  1JCC A;  3GMA A;  1HUC A;  1L0L G;  1OFC X;  1O7G A;  3FX0 A;  4EOT A;  1H0T B;  3CME P;  3A0B H;  4NBH D;  1SQB E;  3GL0 A;  3H1H G;  5K5G B;  2OYI C;  1O7W A;  1OXZ A;  4U3F J;  5KLI C;  4UB6 E;  2WPQ A;  3SWY A;  4NPF X;  3CXH H;  1SQQ G;  2FFD C;  3H32 B;  4HYT B;  2R5B A;  2GUV A;  3VCP A;  3PP5 A;  4AQR D;  1NOH A;  3TGU D;  3L75 D;  3KYQ A;  2D2C B;  1KQS O;  1RIE A;  3VMZ A;  5CJ4 A;  2H43 A;  1GK4 A;  3H32 A;  2BCC J;  1S4X A;  1TU3 F;  3RL0 D;  2PGD A;  2L91 A;  3B5N D;  3Q5S A;  3B5N B;  1KB9 D;  4YXW H;  1SQP D;  3M9H A;  1H0T A;  5BU8 B;  3FXE A;  5APQ A;  1O7H A;  1SQP J;  1M1J A;  2YFI A;  3L74 J;  2WPS A;  1VQ8 P;  4HH2 A;  3LW5 H;  1OWA A;  1PGJ A;  3S4R A;  2BCC E;  1L4A A;  3L73 D;  3GB4 A;  3TYY A;  1KB9 I;  2W90 A;  4OWF A;  3OJA B;  1NTZ K;  1NTK K;  1MKM A;  1CI6 A;  4PV1 D;  1G2C B;  3CXH I;  2WSS H;  1LT9 B;  1PPJ D;  3GKE A;  2W6J H;  1E79 H;  3AEE C;  4C7N B;  1ULI A;  4UB6 H;  1LTS C;  2IFN A;  3CCR P;  3V4Q A;  3TF5 A;  3CI9 A;  1PGO A;  2IPP A;  2J5U A;  1RF1 B;  1EDI A;  1AVY A;  3VOP A;  3H1I E;  3M0D A;  3FGA D;  2KUB A;  1SQX D;  3H1J J;  3N7N A;  1LTJ C;  2M8R A;  2XRX A;  3FOU A;  1BCC J;  1WQL A;  5KAI E;  5APX A;  3L72 J;  3I55 P;  3AEC C;  1JEK A;  3CD6 P;  2NPS C;  5AW2 B;  1PPJ E;  3C9I A;  2Q1K A;  1J1E C;  3RK2 C;  4NBC D;  3CCU P;  1SQV K;  1OW7 A;  3IAO A;  1PV3 A;  1FC2 C;  3V5B A;  4I7Z C;  1S5L H;  1PP9 G;  5AW5 B;  2ZT9 C;  2DE5 D;  1KIL E;  4EMJ B;  3CCQ P;  1DD4 A;  3HD7 B;  1X9V A;  1YJ9 P;  4IL6 X;  1SJG A;  1RF1 C;  1NKZ B;  1OMI A;  1EZV I;  3CWB D;  2KXP B;  1IJD B;  2R3C A;  1PFI A;  2YVJ B;  1LT9 C;  2JJL A;  3VMY A;  4UB8 E;  4BXL A;  4L74 A;  4NPE A;  1VF5 C;  1XTC C;  3GHG A;  2LXC B;  3N0Q A;  2Z4E A;  3GW6 A;  4N78 E;  3LW5 J;  4GOF A;  4GDO A;  3HE5 A;  1FOS E;  5GTI H;  3W68 A;  3AEG C;  4HJG H;  1HF9 A;  1HBW A;  1LTB C;  1BE3 D;  3MUD A;  3VMA A;  2KZI A;  3H1K G;  3C8V A;  2RN0 A;  2WT7 A;  5TJH A;  4U3F G;  2A45 I;  1WRG A;  1NTZ E;  2Y0C A;  2DE6 D;  2KIK A;  2Y9Z A;  4RJT A;  4BRY B;  1M57 D;  3OA7 A;  2HML A;  4KT0 J;  4QMA A;  3GTE A;  4HM4 A;  2KNC A;  1FZB A;  2B9B A;  1YTZ T;  3WU2 E;  1PPJ G;  2KP8 A;  1VDF A;  3B71 A;  1KYO E;  1VQ5 P;  5KJ7 D;  1NTK D;  4HM2 A;  1SLQ A;  2QE7 H;  1Y9B A;  1NHL A;  2OYI B;  1ZRT E;  4EYY Q;  1U7J A;  4XA4 A;  3U1A A;  1L4A D;  4LLH A;  5TIS H;  1NTM D;  2HFE D;  1BDD A;  1MUU A;  2SPZ A;  1LWU C;  1J1D C;  3CX5 I;  4WY4 C;  3HUS A;  2AEF A;  5KLV E;  1LP1 B;  2ZT9 B;  3KPE A;  3EQ2 A;  4DOJ A;  1SQP K;  4I1L A;  3Q2Y A;  2WQY C;  1YJN P;  5E79 H;  3L75 J;  3AE2 C;  4PD4 H;  1N73 C;  1NH4 A;  3A0B E;  1QEX A;  4YTP C;  1BE3 G;  3GF7 A;  1LGH B;  3V4W A;  1AV1 A;  2K1A A;  3LIE A;  2N1T B;  2Y9Y A;  2IYP A;  1FAV A;  1GTW A;  4NB9 D;  3V2R A;  1IFD A;  4C7N A;  1FZA A;  1M1J B;  4HM5 A;  5KLV D;  1GL2 A;  2BMQ A;  2D2C D;  4PD4 E;  1T2K C;  5KLV J;  3RK3 D;  5CCG C;  4NB8 D;  3B5N A;  2CPS A;  3L74 G;  2AEJ A;  2NUM A;  2A06 E;  2FYU G;  1JY3 P;  2FYU D;  1VQP P;  1N73 A;  4NBB D;  3CXH E;  1SVF A;  1VM9 A;  4MN4 C;  1NU1 G;  4AAY B;  1S72 P;  4QDF B;  4D6T G;  2YFL A;  3AEF C;  4JBZ A;  2BEZ F;  2YMK A;  2KSE A;  1KB9 E;  2QA4 P;  4GT1 A;  2Z5H A;  2LXB A;  3V6I A;  3RL0 g;  1T3U A;  1NTM E;  2P10 A;  2B87 B;  4RO0 A;  1PZQ A;  1NWQ A;  2WWW A;  3D89 A;  3U1C A;  3IN6 A;  1FDO A;  1RQU A;  3AEB C;  1HGV A;  3L70 J;  3MHV A;  4LGD E;  4EDF A;  4I7Z B;  1GD2 E;  1JM1 A;  3H1H E;  2XKM A;  3H1I D;  1J1E B;  1GL2 B;  4H44 D;  2D2C C;  1USE A;  1JY2 O;  1EDL A;  1KIL D;  2JWA A;  1URQ B;  1JMB A;  2E75 B;  3VP8 A;  3GLM A;  3F5H A;  1T3J A;  2K9J B;  2QSI A;  4W7Y A;  1YJW P;  1HJB A;  2JZA A;  2NVG A;  4RKU J;  2DE7 D;  5GTH E;  3L71 G;  1Z56 A;  1ZR2 A;  2Q3I A;  2RMZ A;  1NYH A;  5AVU B;  5H2F E;  3TGU E;  2QIW A;  1RQV A;  2WTY A;  4NBD D;  2R5D A;  4JQ0 D;  3AE6 C;  4HM6 A;  5KLV G;  2I7F A;  2BEQ D;  2QJY C;  4JF7 A;  2MKV A;  2JKV A;  3RK3 C;  2XU6 A;  3AZC A;  4C46 A;  1X8Y A;  2WPV B;  4ZMD A;  4IFM A;  1URQ A;  1AFO A;  1O7N A;  3HD7 D;  1RE4 C;  5B5E H;  4DT0 A;  1H88 A;  5GTI E;  1KFN A;  1FZE A;  2IBZ I;  2R32 A;  1MFT A;  2G3A A;  2NVF A;  4ASV A;  1VCK A;  3CWB J;  1R5L A;  1JY3 O;  1VQ9 P;  3B8E B;  2GM4 A;  3CCJ P;  4O9B A;  1OW6 A;  1URQ C;  2M3E A;  3H1J G;  5GTH H;  2V4H A;  1ZME C;  1NU1 E;  3CCV P;  2N9B A;  2ZYG A;  2FYZ A;  2HG5 D;  3PTZ A;  1Q81 Q;  3H1L J;  1RF0 C;  1SQB D;  5AW7 B;  4H0L D;  2N1T D;  3HTK A;  3PH0 A;  1S1C X;  3HE5 B;  3RBX A;  2ZXX A;  2H8P D;  4Z1M H;  3RBZ A;  2NPS D;  3VMH D;  3NTN A;  2GBW A;  1IZN B;  5KTB A;  2E75 D;  2KSJ A;  3L74 E;  1SQP E;  1WT6 A;  3A5T A;  2YNY A;  1KQG B;  1FQT A;  1YIJ P;  1JTH A;  4D6T E;  2OGU A;  3IR9 A;  1RFS A;  1M8O B;  1Q2N A;  1OW8 A;  2NVE A;  3GZY A;  1CSB A;  3JSV C;  3AE1 C;  2OYH C;  2YKP A;  1CW5 A;  2K3R A;  3L75 G;  2PP6 A;  3VYI A;  1IFM A;  3G9R A;  2JEE A;  3CLQ A;  1KYO H;  3RK3 E;  1XTG B;  5CXM A;  1M1J C;  1S3J A;  2AEM A;  2E76 D;  2O01 H;  1YQ4 C;  2JO1 A;  1SFC C;  2P2U A;  3S9O A;  2OTK E;  2FYU E;  2FKW B;  1JMM A;  1LP1 A;  4W7Z A;  4H13 B;  1P84 D;  2HMJ A;  2NWF A;  1N7S C;  2ZAE B;  4DCK A;  1YYC A;  1IK7 A;  1SQQ K;  1OIP A;  3GG2 A;  2M3B A;  1FS0 E;  4JYC A;  1ZRT D;  4B86 A;  2IYO A;  1FZG A;  3SWF A;  3L71 J;  5CBO A;  4OH8 B;  1GL2 D;  3RK2 D;  5C39 A;  1KYO D;  2HMN A;  1SQV E;  3L72 D;  5HL4 A;  4HKV A;  2QRX A;  2XR8 A;  3CWB E;  5AW0 B;  2E74 B;  2AXT H;  3CC7 P;  1PL5 A;  2GA1 A;  3I5C A;  3K5B A;  5KJ7 C;  3P8C E;  3T97 B;  2YIU B;  4JYB A;  3CX5 H;  2QM7 A;  1FJK A;  4OGQ D;  5KAF H;  1EXJ A;  3HTK B;  2E4P A;  4HJL A;  1KOR A;  2K88 A;  2HMK A;  3OW2 O;  1BCC D;  2Q9I A;  3A2A A;  3D71 A;  2WMM A;  2WIT A;  1EZV G;  1UIX A;  1NTK E;  2IBZ D;  1VL2 A;  1FBM A;  4YXD C;  5AW1 B;  1NVO A;  1VQ4 P;  5B66 H;  2A06 G;  1NTM J;  2WSF J;  1EC5 A;  2E4Q A;  1RF0 A;  1URQ D;  1GZL A;  1HGZ A;  2WSC H;  2YXQ B;  4QDD A;  2YMY A;  1U7M A;  2GUS A;  1K04 A;  4QDF A;  1PP9 D;  3M06 A;  1DEE G;  4GOE A;  2BMO A;  1M56 D;  4QUR A;  5CHX A;  1VF5 D;  5AVT B;  3H25 A;  1GMJ A;  4HM3 A;  3T97 A;  4HB1 A;  1IFJ A;  1BCC E;  5B66 E;  2ITA A;  2E5Y A;  1L0N J;  1LJ2 A;  2N9Y B;  3L74 D;  1AA0 A;  1L0L E;  5AVZ B;  1X79 B;  4EIJ A;  1NJI Q;  2BMR A;  3TNU B;  1MV8 A;  2A45 H;  2W6A A;  3H1J E;  1RE3 A;  4XFJ A;  1G1J A;  1NU1 D;  1NTZ D;  4WY4 D;  1SQV J;  3VP9 A;  2JP3 A;  1YHQ P;  4HM8 A;  3CWB G;  2KS1 A;  1GW3 A;  2KS1 B;  1S5L E;  3H6P A;  2FYU J;  5DJU B;  4U3F D;  1HVV A;  3WU2 H;  1YIT P;  5CCH A;  1JB0 J;  1LT9 A;  5AVQ B;  1N2D C;  2E74 C;  2E76 C;  1ULJ A;  2WSE J;  1GU4 A;  2XZR A;  2FXP A;  4UB8 H;  1DH3 A;  4I2L C;  2W8Z A;  2K9J A;  2ZYD A;  4WWI A;  4WVZ A;  4NBG D;  5DJT B;  4OVN F;  3Q3D A;  1K73 Q;  2YKO A;  3GL2 A;  5AVX B;  1NTM G;  4AIV A;  2YFJ A;  1QVG O;  1X22 A;  1NU1 K;  4Y99 B;  1NYK A;  4R4L A;  1BE3 J;  1KN7 A;  2POH A;  1KZU B;  3L70 G;  2M5A A;  1G8J B;  3JCU H;  3N4X A;  3P8M C;  3WMM 0;  1PP9 J;  2XV5 A;  1KQF B;  2I1J A;  2B87 A;  4U3F E;  1KD1 Q;  3BRT B;  2WT7 B;  4XE5 B;  2LR2 A;  3AE8 C;  3RK2 B;  3MD0 A;  3PHL A;  1GK6 A;  1KV4 A;  2CPB A;  2NZ2 A;  2HR3 A;  2NPS B;  2Q5U A;  1SQX K;  3AE4 C;  1ZW0 A;  2FFD A;  1VQK P;  5KLI B;  2P1J A;  4W80 A;  3Q5R A;  3IF4 A;  4ZNC A;  4L75 A;  1LNQ A;  3HE4 A;  2A45 G;  4K3A A;  1P84 I;  3H1I G;  4WY4 B;  5BU5 A;  5AW4 B;  4I6M C;  1J1D B;  1SP4 A;  1LT1 A;  3EQQ A;  1FZC C;  3CC4 P;  4ZKP A;  2I8D A;  5AVY B;  2BCC D;  1IFI A;  2O01 J;  3PLN A;  5L8R J;  3QH9 A;  3GZX A;  4NBA D;  1NKN A;  2KYV A;  1L0N D;  2Y0E A;  1T8Z A;  2B1X A;  2JO6 A;  1JUN A;  3WUV A;  2B24 A;  1JM0 A;  1BDC A;  3AEA C;  3BAS A;  4PD4 D;  2QJK C;  1S9K E;  3KHU A;  3PRJ A;  2Q3E A;  2W6B A;  2CK3 H;  1BSH A;  5AVW B;  1N7L A;  4U7J A;  2IZ1 A;  4K35 A;  2PAJ A;  3IFM A;  3L75 E;  4QCK A;  2L5G B;  2ZVN B;  3H1I J;  3H1H D;  1FU1 A;  1FE6 A;  2HOD A;  3KZI H;  1BSN A;  3LID A;  1EXI A;  1BCC G;  2ZFC A;  5TIS E;  2QJK B;  3MUD C;  2ZYA A;  2VRS A;  1KB9 H;  3M9B A;  2IBZ E;  2FBW C;  1NGM B;  3GHG C;  2KZJ A;  2QJY B;  4IL6 E;  2Q7C A;  1W2B O;  2YIU C;  3KXD A;  3GTS A;  3ZDM A;  3HE4 B;  4M3L A;  1YBK A;  4NBF D;  2OTJ P;  4OGQ B;  3M91 A;  1EDJ A;  5CCH C;  1LTA C;  1L0L K;  3GOB A;  1SQX J;  3H1J D;  3SWK A;  2C9L Y;  1J2J B;  1HTL C;  3HD7 C;  1LTG C;  3MZW B;  1SS1 A;  3L73 G;  2J58 A;  5AW8 B;  3V2Q A;  3P8C D;  3VMG D;  1L0N G;  3WUU A;  4QUP A;  3VMX A;  4TLF A;  3SFE C;  1CZQ A;  3D70 A;  4LC1 A;  2JWD A;  2E75 C;  1LTT C;  3BRV B;  3VMI D;  2MJZ A;  4DJG A;  1MZ9 A;  2RH0 A;  3W67 A;  1SQB K;  1GL2 C;  3AE3 C;  2P7J A;  1GW4 A;  1SQV G;  2XNX A;  1N86 A;  4BWN A;  1FZC A;  3TDK A;  1A02 F;  2A06 D;  5KKZ C;  3BAT A;  3MTU E;  1K05 A;  4AUW A;  3VTP C;  1BGY D;  1LTJ B;  2W83 C;  1ZP0 C;  3RGU A;  4H0L C;  1SQX G;  1YTZ I;  2OYO A;  1K9M Q;  2UWJ E;  2YO3 A;  1FOS F;  1EQ7 A;  3HUS C;  1Q82 Q;  3E1R A;  2I1K A;  3NMD A;  4D6T J;  1AJY A;  3CCL P;  3M9Q A;  4OGQ C;  1L0L D;  2KI7 B;  3GF3 A;  4IOI H;  1NDO A;  2K37 A;  5BOK A;  2C0X A;  5APU A;  3G71 P;  2W27 A;  2R44 A;  2HMM A;  1RF1 A;  4WB4 A;  1OVR A;  1DIP A;  1EDK A;  3OAK A;  1EZV D;  3C1L A;  5EFW B;  1IFP A;  3L72 E;  2IZ0 A;  3C0D A;  3SSU A;  2QVA A;  4NPD A;  2G8Y A;  2R3S A;  3L71 E;  1BGY G;  4YPC A;  4Y28 J;  2QEX P;  4H44 B;  5B5E E;  1KFM A;  3FXD A;  1Y8A A;  1ZV8 A;  3TGU G;  2RKL A;  1KQL A;  3A3Y B;  1Q90 D;  2BAS A;  4N3Y B;  5KKZ B;  4L73 A;  3TSI A;  1YI2 P;  3AED C;  1ZN5 A;  3TNU A;  3S1K A;  2V7Q H;  2LKM A;  1CI6 B;  2J59 M;  5AVV B;  3P7K A;  5BVZ A;  5APY A;  1NU1 J;  1RH5 B;  2XSO A;  1D7M A;  3AE9 C;  3A7O A;  5CBN A;  5APW A;  5CCG D;  4KJM A;  3UIA A;  5KAI H;  1DX7 A;  2KNC B;  3SFD C;  1OVV A;  2FXO A;  2O1K A;  3R2P A;  2FY8 A;  1R5S A;  1USD A;  1Q86 Q;  3CCS P;  4CPG A;  1NTZ G;  2PRR A;  1SQQ E;  1AQ5 A;  1A02 J;  1JY2 N;  4QDC A;  1X0T A;  1OVU A;  5KLV K;  1VQL P;  3V2N A;  1P84 E;  3RL0 C;  3RK3 B;  2P58 A;  4P1B H;  1G1I A;  1QX8 A;  3L70 D;  3I56 P;  5APT A;  3GHG B;  1SQQ J;  1GDT A;  3CL3 D;  2HYN A;  3KDP B;  2ZJS E;  4D6T D;  1IK9 A;  5H2F H;  3L35 A;  2WSC J;  4HKZ H;  3L37 A;  1SQB G;  1RHZ B;  3II6 A;  1BGY E;  4C7R A;  3EWK A;  3H1H J;  2WZ7 A;  2GBX A;  3L73 E;  3G6E P;  1N7S D;  3JC2 2;  4R4M A;  1KIL C;  2HPC A;  3L72 G;  2PFX A;  1K8A Q;  3H1L G;  1O7P A;  3L4F A;  1BGY J;  2E5T A;  2N1T A;  1ZXG A;  1HWT C;  2JR8 A;  4GIF A;  3JCU E;  2HOD B;  1QLE D;  1VF5 B;  1QGK B;  1U57 A;  1JY3 N;  5CCG A;  2AXT E;  1FDI A;  2M0B A;  4GKG A;  2FYN C;  3CPW O;  1FDM A;  4IL6 H;  2O3J A;  2AXC A;  5E79 E;  2XND H;  1VQM P;  2HLO A;  2QJP C;  2IX7 C;  1WMK A;  3E1I A;  2V7Q J;  2WPR A;  2WSF H;  3BCC J;  3G3Z A;  1VQN P;  3TK1 A;  1DEB A;  2KLU A;  2OYI A;  2WSE H;  1JNM A;  4GOD A;  1S9K D;  5KJ7 A;  3KZI E;  1N7S B;  1KC8 Q;  2JDI H;  3EFG A;  3O6Q A;  1LTJ A;  3CX5 D;  1RY3 A;  1M90 Q;  2QPZ A;  3BVH A;  1QVF O;  3EN1 A;  1FJP A;  1NTM K;  5APS A;  4BRY A;  4NBE D;  1H89 A;  2FXM A;  1L4A B;  2BCC G;  2KK7 A;  1VQ6 P;  1NTK J;  3VN0 A;  4RES B;  2Z5I A;  3DQY A;  1YQ3 C;  3P32 A;  5KAF E;  1Q90 C;  1SQP G;  1AQT A;  1UUW A;  3H1L E;  2N1T C;  4Y99 C;  2OYH B;  4P1C H;  1JY2 P;  1SQB J;  3NFQ A;  1NAF A;  3Q5P A;  1N73 B;  2WVR A;  3WUT A;  2XSH A;  2P67 A;  3ITK A;  3G4S P;  1KYO I;  3MGN A;  1L2P A;  2Q3W A;  3D6Z A;  2YO2 A;  3O6Q B;  4TT3 H;  3HD7 A;  1LTI C;  1LWU B;  3GCE A;  3L36 A;  1Y47 A;  1PIX A;  3VCA A;  3L70 E;  1JO5 A;  3FWL A;  2E76 B;  2ZYL A;  2ZT9 D;  1PP9 E;  1W2E A;  2FYN B;  2KB7 P;  2CKF A;  3V2P A;  5CMZ A;  2IFM A;  4A7P A;  3E7K A;  3TGU J;  4HM7 A;  2E74 D;  3USS A;  4AYC A;  2NRG A;  3BCC G;  3BCC D;  1SFC D;  2HMO A;  1VPC A;  3CMA P;  3CC2 P;  1NAY A;  2H89 C;  3A0H H;  4H44 C;  1OZH A;  3NXS A;  4PJ0 E;  2E42 A;  4DZO A;  3M0A A;  2C9N Y;  5AW9 B;  1S5L X;  1E5W A;  3PJS K;  1VQ7 P;  1M7L A;  2C0W A;  4JPZ B;  2H88 C;  4L76 A;  1KIL A;  1HH0 A;  5M1B A;  4HM0 A;  3D6Y A;  2OAR A;  4H13 D;  2YXR B;  3MIW A;  1QL1 A;  1SQV D;  4PJ0 H;  1IO4 A;  2ZXE B; 
#chains in the Genus database with same CATH homology
 1WQL A;  5HL4 A;  4HKV A;  1EZV E;  3FOU A;  4NB8 D;  2HML A;  5KKZ C;  3GTE A;  3VMH D;  2XR8 A;  3VCP A;  3CWB E;  4HM4 A;  2GBW A;  3L75 E;  1L0L E;  2E75 D;  1G8J B;  3TGU E;  4QCK A;  4HM1 A;  3L74 E;  1RIE A;  2XSH A;  1PPJ E;  2FYN C;  2NUM A;  1SQP E;  4NBD D;  2A06 E;  1G8K B;  2BMR A;  4NBB D;  2Q3W A;  4U3F E;  2QJP C;  3CXH E;  1VM9 A;  1KYO E;  3H1J E;  4HM6 A;  1FQT A;  4NBC D;  4D6T E;  2I7F A;  2QJY C;  4AAY B;  4HM2 A;  4QDF B;  2NUK A;  1RFS A;  2YFL A;  3GCE A;  1SQQ E;  2NVE A;  3GZY A;  4HM8 A;  3VCA A;  3AZC A;  1KB9 E;  4OGQ D;  3L70 E;  1O7M A;  2ZYL A;  5AEU A;  1ZRT E;  1O7H A;  3H1K E;  4QDC A;  2E4P A;  2ZT9 D;  1PP9 E;  2DE5 D;  2IBZ E;  3CX5 E;  1NDO A;  2YFI A;  4HJL A;  5BOK A;  1NTM E;  4EMJ B;  1O7N A;  2CKF A;  2HMK A;  1P84 E;  1SJG A;  2YIU C;  2BCC E;  3GTS A;  2HMM A;  4P1B H;  3D89 A;  5KLV E;  1UUV A;  1EG9 A;  2NVF A;  3GB4 A;  1VCK A;  4NBF D;  5AEW A;  5CXM A;  1NTK E;  2E76 D;  4HM7 A;  3L72 E;  2E74 D;  3BCC E;  1ULJ A;  2QPZ A;  2YVJ B;  3C0D A;  3GOB A;  1JM1 A;  3EN1 A;  4PV1 D;  4QUQ A;  2HMO A;  2E4Q A;  1SQX E;  3H1H E;  2FYU E;  3EQQ A;  3GKE A;  1BGY E;  4NBE D;  1ULI A;  3N0Q A;  3L71 E;  1SQV E;  2GBX A;  4QDD A;  4H44 D;  3VMG D;  1NU1 E;  3L73 E;  4QUP A;  2HMJ A;  2NWF A;  1BE3 E;  1L0N E;  4NBG D;  3GZX A;  4NBA D;  3DQY A;  4QDF A;  4NB9 D;  1O7G A;  1Q90 C;  2B1X A;  2BMO A;  2JO6 A;  3GL2 A;  3H1I E;  4QUR A;  3VMI D;  1VF5 D;  1O7P A;  2B24 A;  4H0L D;  1UUW A;  4NBH D;  3H1L E;  4HM5 A;  1SQB E;  4HM3 A;  4HM0 A;  4AIV A;  2JZA A;  2NVG A;  3GL0 A;  1O7W A;  2YFJ A;  4H13 D;  1NTZ E;  4P1C H;  1BCC E;  5KLI C;  2QJK C;  2BMQ A;  2DE7 D;  2D2C D;  2XSO A;  1NYK A;  2XRX A;  2HMN A;  2DE6 D;  4PD4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...