2IBZE

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
185
structure length
185
Chain Sequence
b'KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 45
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2ibzE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2ibzE02
2BMQA 1BGYE 4H0LD 2B24A 2HMNA 2ZT9D 4HM7A 2HMMA 1PP9E 1ULJA 3GTEA 2IBZE 2GBWA 1O7MA 1BE3E 2JZAA 2NVFA 2QPZA 2ZYLA 2E75D 4QUQA 1ZRTE 3H1KE 2I7FA 3L72E 1SQBE 2CKFA 4NB8D 1O7HA 4QDFB 2E76D 1KB9E 3CX5E 5AEWA 4HM5A 4NBED 2FYUE 1L0NE 4EMJB 1VCKA 3CXHE 2Q3WA 2DE5D 2YFLA 4NBAD 3DQYA 3GTSA 1VF5D 1L0LE 4QDFA 4HM4A 2HMKA 2A06E 2BMOA 4P1BH 1NTKE 4HJLA 3VMGD 2YIUC 3VMID 2B1XA 5HL4A 3EQQA 1BCCE 3GZYA 1O7WA 1SQQE 4QDDA 4HKVA 4AIVA 2FYNC 3AZCA 1NTME 1SQVE 1ULIA 4HM3A 2BCCE 3TGUE 1NYKA 2NUMA 4QURA 2XSHA 4NBDD 1JM1A 4H44D 3GOBA 3L71E 2YFJA 1EG9A 5KLIC 3N0QA 1VM9A 3H1JE 4QUPA 3GL2A 3VCAA 5KKZC 2DE7D 3EN1A 3L75E 1SQPE 1RIEA 4AAYB 4NBFD 4NBBD 1G8KB 1UUVA 4OGQD 3CWBE 2E74D 4NBHD 2HMLA 2HMOA 1NDOA 4NBGD 5AEUA 3L74E 1NTZE 1O7PA 4HM8A 3GKEA 1O7NA 4PD4E 1RFSA 3H1IE 2NUKA 4HM2A 1PPJE 3BCCE 4HM0A 1Q90C 3L70E 4U3FE 2XR8A 2XRXA 1UUWA 3VCPA 2QJKC 1FQTA 4D6TE 4QCKA 3D89A 1SJGA 1O7GA 4PV1D 3FOUA 3GL0A 1NU1E 3VMHD 5KLVE 2NVEA 4H13D 4HM6A 1G8JB 3C0DA 1EZVE 3H1HE 3GCEA 1P84E 2NWFA 3GZXA 4HM1A 3GB4A 2D2CD 4QDCA 2QJPC 4NB9D 2E4QA 2GBXA 5CXMA 2HMJA 3L73E 2JO6A 2NVGA 4NBCD 5BOKA 2YVJB 2XSOA 4P1CH 2BMRA 2YFIA 2E4PA 1KYOE 3H1LE 2QJYC 1WQLA 2DE6D 1SQXE
chains in the Genus database with same CATH superfamily
1IFJA 1LTJA 1PP9E 3VYIA 3CPWO 1J1DC 2QPZA 5BU8B 3CCUP 3H1LD 1Q7YQ 1QEXA 1QVGO 3GG2A 1RF1C 4Y99B 5AEWA 1PP9J 3O6QA 2ZVOB 3KYQA 2K9YA 2YFLA 3HE5A 4NPFX 1YIJP 1L0LE 1SQBD 1K05A 3M9QA 2OYIA 2K37A 2B1XA 5HL4A 1EDJA 3VMAA 4WBAA 1LWUC 5AW7B 1L0LJ 3B5ND 5AVZB 5EFWB 1QX8A 3GOBA 4EOTA 3I56P 3L75E 1URQB 4N6JA 2FYUG 1X79B 4JBZA 1JMBA 3P8CD 2YNYA 4DOJA 1NH4A 1M7LA 3RGUA 3SWYA 4OWFA 3L75J 4HM0A 2XDJA 3CX5I 2PRRA 1FJKA 1SJGA 1O7GA 3NMDA 1RHZB 3EQ2A 1S5LX 4GODA 1IK7A 3VMZA 4HM1A 3HD7B 3GB4A 3FXDA 2ZXXA 1S4XA 2BMQA 1ZN5A 1U57A 2C9LY 3CCSP 1NTKK 1PPJG 3G9RA 1SQQK 2WSFJ 3CX5E 2IBZD 3H32B 2WZ7A 4DT0A 4PJ0H 1EDKA 2CPBA 4R4LA 1NVOA 2N1TB 1BCCE 2A45G 5B66E 1H8AA 4H13B 2QIWA 4RESB 3K5BA 4GOFA 1X8YA 1BCCJ 4WY4C 2QVAA 4PD4I 2H7HA 3L72G 1L4AD 1ZR4A 3RK2B 2I1JA 1IFPA 1JY3O 1S72P 1KTMA 4RKUJ 3WUUA 2HPCB 3MUDA 2YMYA 3AEBC 5KKZB 4HM2A 2Y0EA 2NPSC 3FWLA 2A45I 5AW6B 2W6JH 1SQXK 2WPQA 5KTBA 1FZCC 1MZ9A 2W90A 3AEDC 1GU4A 1VQ4P 1USDA 4WWIA 3RK3B 2IYOA 3H25A 1EZVD 2QJYC 1VQ5P 3GW6A 3BASA 4L73A 2Q9IA 4HM7A 5CBNA 3B71A 2FXOA 1LT9A 1OWAA 1M1JA 3FXEA 3AE1C 3IFMA 3MHVA 3WUTA 3L4FA 4XFJA 3VP9A 1HVVA 1FZBA 3B4SA 1DH3A 4ZKPA 1J1EB 2YO2A 2Q1KA 1T8ZA 2XKMA 3PH0A 1MKMA 1SQPK 1VQPP 1CI6B 2W27A 2FYNC 1YJNP 2OYHB 3AZCA 1H0TA 3IR9A 5KAFE 4QURA 3LIEA 2E5TA 1PV3A 2MJZA 1E5WA 4AAYB 3P8MC 1KILC 1NKZB 1QGKB 2QM7A 1K73Q 3VMYA 1U7JA 2E74C 4ZNCA 1HJBA 3R2PA 1GD2E 4N78D 3Q5RA 4KT0J 2ZVNB 3GL0A 4AQRD 5KLVE 5APXA 4AYCA 3P32A 5CJ0A 4EIJA 3Q3DA 1S2EA 5B5EH 4ASWA 4PD4H 1BSNA 5KLVJ 1SQPD 2AXTE 3RL0C 5AVTB 2P67A 4HKZH 2Y0DA 1L0NK 3USSA 3L74G 2ZAEB 1ULJA 3M0AA 4GDOA 2IZ1A 2GBWA 1NAFA 2DW3A 3M06A 2ZYLA 4WY4D 4D6TG 3CCQP 2N1TC 2A45H 1M57D 2JR8A 3CL3D 4NPEA 1NTMK 4R4MA 3H1HD 1VCKA 3Q2YA 3QH9A 4QDFA 2FY8A 1GU5A 1BSHA 2YIUC 3VMID 2FYUD 3GZYA 3CXHD 4NPDA 4QDDA 5KAFH 1OMIA 2A06D 3RK2C 2P58A 1HJ0A 1OX3A 1NTZK 4HH2A 5KLIB 1BDCA 2K9JB 5KKZC 2UWJE 1G8KB 1BDDA 3CWBE 1RF1B 1DX7A 2POHA 1AQ5A 4OVNF 1IFMA 4U7JA 5AW8B 3T97A 3M0DA 2JKVA 2E76B 3U59A 2KS1B 3CWBJ 4WVZA 3RK3C 3VCPA 2AEMA 2WVRA 1LWUB 1KYOI 4HM6A 4PD4D 3V2QA 3AE3C 2N9BA 2O1JA 3A7OA 4I1LA 4QDCA 4NBCD 5BOKA 2B89A 1N8RQ 3HUSA 2OTLP 1URQD 3M9HA 5TISH 3L73D 1S5LE 1JMMA 3GLMA 4GIFA 3OAKA 1YTZI 4IL6X 1LTAC 1ZW0A 2IZ0A 1N73C 1AA0A 1IFIA 2OYHC 4EMJB 3P8CE 3H1KG 2ZYGA 3L72D 1AQTA 1FS0E 4JPZB 2CPSA 2R5BA 3HD7D 3M91A 3HTKB 5AVXB 5CBOA 1O7WA 3CC2P 5E79E 1KB9H 1NTKG 1PP9G 3NXSA 2M5AB 3GF7A 4JF7A 1H88A 3AE8C 1YQ4C 3VTPC 4EI2A 3L71E 1YI2P 2WITA 4QUPA 4M3LA 1NAYA 3S9OA 2H43A 2M0BA 4H0LB 3KDPB 3JC22 1IK9A 3L37A 3L71J 1JTHA 2HODA 1L0LG 4GKGA 2E43A 2YO3A 1KQFB 3IF4A 1EQ7A 5K5GB 3V4QA 2FYZA 2QRXA 2XR8A 2N1TD 2RKLA 1VL2A 2M3EA 1G2CA 2BCCD 4H13D 1VF5B 1M56D 2KIKA 1EXJA 1W2EA 3G4SP 2GA1A 3O6QB 2OQQA 1Y9BA 3SFDC 4EYYQ 2PFXA 2GUVA 2B87A 1YJWP 1ZXGA 3MGNA 1NO4A 3M9BA 4YPCA 2OYIB 3L75G 4IFDK 1SQBK 2XSOA 3A0BE 1IFDA 1X9VA 3GF3A 3RK2D 2C9NY 5CCGD 3VN0A 3A0HH 2NRGA 3GHGA 2Y9YA 2JZAA 4UB6E 1FJPA 4QUQA 3SWFA 1SQXG 3FWNA 2WSSH 3H1KE 4Z1MH 1HBWA 4GT1A 2CKFA 2NPSB 5KAIE 3CC7P 1KYOH 4HM5A 2JWAA 3S4RA 4HB1A 2QE7H 3CCLP 2CK3H 2HG5D 1FZCB 1FAVA 1NTKE 3H1KJ 1KB9D 1M1KQ 5E79H 4TLFA 2HLOA 1SQQE 1WRGA 1MUUA 3RK3D 4L75A 5AVSB 1ULIA 3TGUE 2QJYB 1NTKJ 4YXWH 1KFMA 1SQQJ 1VQ7P 1YQ3C 2E76C 2DE7D 3EN1A 4QMAA 3TGUJ 2AEFA 1UUVA 4JQ0D 1Q90D 3H1JG 5DJUB 5GTIH 3PP5A 1JY3N 5KJ7C 3H1IE 1BCCG 1UUWA 3L74D 4WY4A 3TNUA 2FYNB 2O01H 2KZIA 1JY2O 3H1IJ 3L70D 4D6TD 1FOSF 1XTCC 2JP3A 1RQVA 1Y47A 1SQXE 1M90Q 2HMNA 1PZQA 4YXDC 1KILB 3GTEA 1P84H 1HUCA 5AVQB 3TK1A 1KYOD 1SFCC 2E74B 1SQXJ 1VQ6P 3AECC 2O01N 3HE4A 2DE5D 3DQYA 2WT7A 1GW3A 1FDIA 2I1KA 3O8ZA 1PIXA 1FDMA 1OIPA 1Y8AA 1L0NG 3CC4P 2PGDA 3GMAA 1N7SA 1VQMP 2FFDC 3PTZA 3RL0B 4H0LC 2YXQB 5GTHE 4K3AA 1LTJC 3N0QA 3H1JE 1SQVD 1T2KC 5AW9B 1PL5A 2H88C 5CCHD 1SQPE 4NBBD 2H89C 2ZT9B 1USEA 1ZOYC 1VF5C 3ZDMA 1URQA 2KNCB 2P2UA 3H1JJ 1RQUA 4I6MC 2WPRA 3CCMP 2M8RA 1OXZA 3LW5J 5AVYB 1RFSA 1SQPJ 1OFCX 4L76A 2YIUB 1LT9B 2OYIC 1NTZG 2BEZF 1LTTC 4W80A 2NVEA 5AW5B 3H1HE 3GZXA 1LNQA 3CCJP 1N2DC 2SPZA 1NU1G 3HD7A 1P84D 1K8AQ 1MV8A 2V7QJ 3H1HJ 1WQLA 1BGYE 2IX7C 3F5HA 1HWTC 2KOGA 4L74A 3D6ZA 5L8RJ 3D70A 1K9MQ 1BE3E 4ASVA 2KLVA 2KSEA 2I7FA 1MFTA 1PP9D 2E76D 1BGYJ 2D2CB 5KLVG 1VQOP 2WSFH 4UB8E 4B86A 1L0NE 1BE3J 3CD6P 1K04A 2WSCJ 4YTPC 5KJ7D 2KP8A 3EWKA 5CMZA 2L5GB 3KZIE 3S1KA 1L0NJ 5GTHH 3CX5H 1FE6A 1NGMB 2OYOA 1NTME 4IL6E 1VQLP 1T6AA 3ITKA 2XSHA 1EC5A 2YFJA 2NZ2A 1EG9A 4BRYA 2XZRA 1Q86Q 3VCAA 1AVOA 1MFZA 4AUWA 4IOIH 5B66H 1NTMJ 2J5UA 3PHLA 2J59M 4ZMDA 2HMOA 1N73B 1N7LA 1NTZE 1N86A 5CCGA 3BCCE 3U1CA 1E79H 1PGJA 4C7RA 2XRXA 2HPCA 5CHXA 2V7QH 1NU1E 2IPPA 1NTZJ 2KXPB 3P7KA 2WPSA 2WQYC 4U3FG 3BCCJ 3SSUA 1CZQA 1Q2NA 1SLQA 5AW0B 5TJHA 1VDFA 1NU1J 3G6EP 3CWBG 2G8YA 2FYUK 2OTKE 1QVFO 4H44B 4H0LD 3BATA 1ZR2A 3A2AA 3KHUA 2JEEA 3I5CA 1T3JA 1T2KD 3MUDC 2RH0A 4NBAD 3V5BA 1GL2B 1VF5D 3F89A 1HGZA 1SQBG 3NTNA 3CX5D 2QEXP 3B5NA 1S9KE 4BWNA 4IL6H 1DEEG 2FBWC 3QWOC 3HRNA 2ZT9C 2BCCE 4XA4A 2JO1A 1BCCD 2B9BA 1VM9A 1LP1A 1T3UA 1ZRTD 2LR2A 2BCCJ 4OH8B 1LTGC 1LT9C 1JY3P 1NYHA 1NDOA 4RO0A 1M1JC 2NPSD 3HUSB 1LTSC 3V2PA 1RH5B 3I55P 1O7PA 1JCDA 2YMKA 1VQ8P 2Q7CA 2NUKA 3G3ZA 2LXCB 2KI7B 4U3FE 3D89A 3E7KA 2PAJA 1J2JB 1RE4A 3L71G 4A7PA 1X0TA 3BRTB 3A5TA 1X22A 4U3FJ 4DZOA 2ZXEB 3CCRP 2YVJB 3H1LE 1KQSO 2D2CC 2Q3WA 2FKWB 1GW4A 1RE3A 5CJ4A 1PPJD 1IZNB 2QG4A 4OGQB 3L36A 3H1LJ 2WSEJ 1SQBE 2AXTH 5CCHA 2YXRB 2KYVA 3SWKA 3AEEC 3IAOA 2HMKA 2HODB 4IFFA 1SQBJ 2JWDA 3BVHA 4HKVA 3WU2E 4C7NB 1AVYA 1D7MA 5BVZA 1FOSE 1KMIZ 5H2FE 4I7ZC 1G2CB 4NBDD 1L4AA 1CSBA 1KILD 5BU5A 3G71P 3GL2A 1RF0C 4RJTA 2YKPA 3IN6A 2W6AA 1SFCB 2E74D 2HMLA 4BXLA 4NBGD 5AEUA 1PGOA 1H89A 2E75B 1RF1A 2AXCA 1OVVA 3V6IA 1FDOA 1SQQG 3AEGC 2Q6QA 3TGUG 1NWQA 2FFDB 4H44C 3RL0D 3RBZA 3E1IA 1LWUA 2WMMA 5KLVD 1OVRA 1JY2N 1LTJB 1EZVG 3TYYA 2DE6D 2ZT9D 2R5DA 4LC1A 1LT1A 2IBZE 1GL2C 3H1IG 2GUSA 1R8EA 1NOHA 1AJYA 3HE5B 1FZFA 1JCCA 1PGQA 3AE7C 5AVRB 1NJIQ 1S5LH 3WU2H 4PV1B 3A3YB 2W6BA 5APVA 2XNDH 1LTBC 2QSIA 1EZVI 2QM8A 2JJLA 4HM3A 3W67A 2NUMA 3HUSC 1M8OB 4HJGH 3D71A 4K35A 4NBFD 1UIIA 2V4HA 1YYCA 2L91A 3KXDA 1VQNP 5AW2B 3FOUA 4EDFA 2FXPA 2C0WA 1G8JB 3SFEC 1EZVE 1KQGB 1XTGB 3HE4B 3C1LA 2E4QA 2WT7B 1Z56A 1QLED 2XU6A 1SQPG 1ZLLA 4I2LC 3AE4C 4OGQC 1OW7A 1HH0A 1N7SB 2Q5UA 1GDTA 4PJ0E 1QL2A 2NVFA 3WMM0 1PFIA 1R5SA 5AW3B 1ZV8A 1FC2C 3A0BH 3CMAP 4TT3H 1LJ2A 1SQVK 4NBED 3H1HG 2LKMA 1R5LA 3GTSA 2Z4EA 2NPSA 3TSIA 4P1BH 2Y0CA 4UB6H 4HJLA 1EXIA 2OARA 1FZCA 2R3SA 5KAIH 2A06G 1BGYG 1UIXA 4H44D 1BE3G 2ITAA 2WPVB 4GOEA 1JUNA 2E75C 3GHGC 2OTJP 1FU1A 3BRVB 4NBHD 3L71D 3CCEP 2C0XA 1AV1A 4N78E 1S3JA 3GKEA 1JNMA 4HYTB 1GL2D 3OW2O 3CLQA 1KD1Q 2WWWA 2Z5HA 1NTMG 3CXHI 3VMHD 2R44A 1SP4A 2PP6A 3C0DA 1GK6A 2VRSA 3OJAB 2YKQA 1FZEA 4IFMA 5DJTB 1CW5A 4NB9D 2QJKB 3V2NA 1OW8A 2BMRA 2YFIA 1LGHB 2LXBA 2P1JA 3WUVA 2B24A 3E1RA 1L0LK 3L73G 1M1JB 2QJPB 1FZAA 1KC8Q 3BCCG 1VQKP 1KILA 1ZRTE 4PV1C 4BRYB 4NB8D 2RMZA 2FYUE 3PRJA 3KPEA 3CXHE 1GMJA 3H1KD 2A06E 3C8VA 1H0TB 3EQQA 2E5YA 4ZKUA 2FYUJ 2P7JA 2AEJA 2O3JA 1NTKD 1G1IA 2IFMA 2W8ZA 1SQQD 1EDLA 3LIDA 1JO5A 5APTA 3TGUD 2QA4P 3H32A 4W7YA 1A02J 4OGQD 1L0LD 4Y28J 1Q81Q 3AE6C 2N1TA 5B5EE 1O7NA 4PD4E 1KV4A 1YTZT 1PPJE 1S1CX 4Y99C 1VPCA 4MN4C 2KNCA 3LW5H 1IO4A 1VQ9P 1FQTA 2BCCG 1N7SC 3H1ID 4JYBA 1JY2P 4DJGA 3GCEA 1QL1A 3Q5SA 4I7ZB 3V2RA 2XV5A 3H6PA 3FX0A 3TDKA 3L73E 1KN7A 4P1CH 3L75D 3B5NB 4W7ZA 2G3AA 2Y9ZA 1SFCD 1JOCA 3PJSK 2N9YB 3MD0A 3L73J 1KILE 2E75D 2KK7A 3II6A 1URQC 1SQXD 3AE5C 3L72E 1LP1B 4QDFB 1O7HA 3CXHH 5AVUB 1HTLC 1ZMEC 3U1AA 1W5CE 5APQA 2KUBA 3N7NA 3L72J 1L2PA 4C46A 1DD3A 2WSCH 3H1LG 3Q1MA 1YHQP 4UB8H 1NKNA 3AEFC 3HD7C 3L35A 1IC2A 4XE5B 1AFOA 2K3RA 1OVUA 3UIAA 1NHLA 1SS1A 5APSA 1GZLA 2Z5IA 3KZIH 2Q3EA 3T97B 5AW4B 3OA7A 3H1JD 4HM8A 1N73A 1CI6A 2IFNA 1KB9I 2OYHA 2QJKC 1FZGA 4PV1D 1KZUB 1FBMA 4LGDE 2BEQD 2ZYAA 1RF0A 5TISE 1RY3A 2NWFA 2BASA 3L70G 2QJPC 3R4YA 4H13C 2HYNA 3MTUE 3JCUE 5M1BA 1W2BO 2E4PA 1KQLA 5AVWB 2HMMA 4LLHA 2Q3IA 3MIWA 1L4AB 1A02F 2ZYDA 1YJ9P 1BGYD 5C39A 5CCGC 3CMEP 1KB9E 1BE3D 1SVFA 1TU3F 3RK3E 1J1DB 2R3CA 2BMOA 2ZJSE 3Q5PA 3KQGA 3VMGD 1NU1K 1KORA 1HGVA 1L0ND 1OZHA 1GL2A 5AW1B 3VMXA 3NFQA 1DEBA 1DIPA 4DCKA 2KLUA 1N7SD 3B8EB 1JM1A 2IBZG 2RN0A 1NTMD 1SQVG 2B88A 1JTHB 1EDIA 1RIEA 2O1KA 5KLVK 2IYPA 4WB4A 2H8PD 3L74E 3V4WA 4CPGA 2MKVA 3VOPA 2M3BA 3FGAD 2IDBA 3PLNA 3RL0g 3MP7B 2E42A 3C9IA 1Q90C 3L70E 4QCKA 4D6TE 2ZFCA 1NTZD 3B5NC 3L74J 1Q82Q 3VP8A 2B87B 4KJMA 1U7MA 3BCCD 1J1EC 3A0HE 2HFED 2K9JA 3JCUH 2IBZI 3L70J 1GTWA 2R32A 1NU1D 4D6TJ 5CXMA 3CI9A 5APUA 3D6YA 5APWA 2WTYA 1KYOE 3GHGB 3MZWB 3ABVC 4KHXA 2HR3A 3N4XA 3CCVP 1O7MA 2KS1A 2P10A 2XNXA 1JB0J 1IJDB 2WSEH 2KSJA 2FXMA 5KJ7A 4O9BA 1JM0A 1GK4A 4HM4A 4N3YB 3EFFK 2W83C 2YKOA 1RE4C 2OGUA 1DD4A 1WMKA 4AIVA 2GM4A 1SQVE 1P84I 3AEAC 2JDIH 3AE9C 1WT6A 3M0DC 1NYKA 1IFNA 2KB7P 1S9KD 4C7NA 5GTIE 3EFGA 1YBKA 3TF5A 2K1AA 1RE3C 1JEKA 1SQVJ 2KZJA 5H2FH 5AVVB 5CCHC 3RBXA 1SFCA 1KFNA 1OW6A 3HTKA 4WY4B 2J58A 1G1JA 3AE2C 3TNUB 3W68A 1PGPA 2O01J 2M5AA 4JYCA 2I8DA 1P84E 1LTIC 3JSVC 4U3FD 2D2CD 2K88A 2FFDA 1YITP 2GBXA 1ZP0C 2HMJA 2JO6A 2NVGA 1L4AC 1HF9A 5APYA 3CWBD 5KLIC
chains in the Genus database with same CATH topology
2BMQA 1BGYE 4H0LD 2B24A 2HMNA 2ZT9D 4HM7A 2HMMA 1PP9E 1ULJA 3GTEA 2IBZE 2GBWA 1O7MA 1BE3E 2JZAA 2NVFA 2QPZA 2ZYLA 2E75D 4QUQA 1ZRTE 3H1KE 2I7FA 3L72E 1SQBE 2CKFA 4NB8D 1O7HA 4QDFB 2E76D 1KB9E 3CX5E 5AEWA 4HM5A 4NBED 2FYUE 1L0NE 4EMJB 1VCKA 3CXHE 2Q3WA 2DE5D 2YFLA 4NBAD 3DQYA 3GTSA 1VF5D 1L0LE 4QDFA 4HM4A 2HMKA 2A06E 2BMOA 4P1BH 1NTKE 4HJLA 3VMGD 2YIUC 3VMID 2B1XA 5HL4A 3EQQA 1BCCE 3GZYA 1O7WA 1SQQE 4QDDA 4HKVA 4AIVA 2FYNC 3AZCA 1NTME 1SQVE 1ULIA 4HM3A 2BCCE 3TGUE 1NYKA 2NUMA 4QURA 2XSHA 4NBDD 1JM1A 4H44D 3GOBA 3L71E 2YFJA 1EG9A 5KLIC 3N0QA 1VM9A 3H1JE 4QUPA 3GL2A 3VCAA 5KKZC 2DE7D 3EN1A 3L75E 1SQPE 1RIEA 4AAYB 4NBFD 4NBBD 1G8KB 1UUVA 4OGQD 3CWBE 2E74D 4NBHD 2HMLA 2HMOA 1NDOA 4NBGD 5AEUA 3L74E 1NTZE 1O7PA 4HM8A 3GKEA 1O7NA 4PD4E 1RFSA 3H1IE 2NUKA 4HM2A 1PPJE 3BCCE 4HM0A 1Q90C 3L70E 4U3FE 2XR8A 2XRXA 1UUWA 3VCPA 2QJKC 1FQTA 4D6TE 4QCKA 3D89A 1SJGA 1O7GA 4PV1D 3FOUA 3GL0A 1NU1E 3VMHD 5KLVE 2NVEA 4H13D 4HM6A 1G8JB 3C0DA 1EZVE 3H1HE 3GCEA 1P84E 2NWFA 3GZXA 4HM1A 3GB4A 2D2CD 4QDCA 2QJPC 4NB9D 2E4QA 2GBXA 5CXMA 2HMJA 3L73E 2JO6A 2NVGA 4NBCD 5BOKA 2YVJB 2XSOA 4P1CH 2BMRA 2YFIA 2E4PA 1KYOE 3H1LE 2QJYC 1WQLA 2DE6D 1SQXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMQ A;  1BGY E;  4H0L D;  2B24 A;  2HMN A;  2ZT9 D;  4HM7 A;  2HMM A;  1PP9 E;  1ULJ A;  3GTE A;  2IBZ E;  2GBW A;  1O7M A;  1BE3 E;  2JZA A;  2NVF A;  2QPZ A;  2ZYL A;  2E75 D;  4QUQ A;  1ZRT E;  3H1K E;  2I7F A;  3L72 E;  1SQB E;  2CKF A;  4NB8 D;  1O7H A;  4QDF B;  2E76 D;  1KB9 E;  3CX5 E;  5AEW A;  4HM5 A;  4NBE D;  2FYU E;  1L0N E;  4EMJ B;  1VCK A;  3CXH E;  2Q3W A;  2DE5 D;  2YFL A;  4NBA D;  3DQY A;  3GTS A;  1VF5 D;  1L0L E;  4QDF A;  4HM4 A;  2HMK A;  2A06 E;  2BMO A;  4P1B H;  1NTK E;  4HJL A;  3VMG D;  2YIU C;  3VMI D;  2B1X A;  5HL4 A;  3EQQ A;  1BCC E;  3GZY A;  1O7W A;  1SQQ E;  4QDD A;  4HKV A;  4AIV A;  2FYN C;  3AZC A;  1NTM E;  1SQV E;  1ULI A;  4HM3 A;  2BCC E;  3TGU E;  1NYK A;  2NUM A;  4QUR A;  2XSH A;  4NBD D;  1JM1 A;  4H44 D;  3GOB A;  3L71 E;  2YFJ A;  1EG9 A;  5KLI C;  3N0Q A;  1VM9 A;  3H1J E;  4QUP A;  3GL2 A;  3VCA A;  5KKZ C;  2DE7 D;  3EN1 A;  3L75 E;  1SQP E;  1RIE A;  4AAY B;  4NBF D;  4NBB D;  1G8K B;  1UUV A;  4OGQ D;  3CWB E;  2E74 D;  4NBH D;  2HML A;  2HMO A;  1NDO A;  4NBG D;  5AEU A;  3L74 E;  1NTZ E;  1O7P A;  4HM8 A;  3GKE A;  1O7N A;  4PD4 E;  1RFS A;  3H1I E;  2NUK A;  4HM2 A;  1PPJ E;  3BCC E;  4HM0 A;  1Q90 C;  3L70 E;  4U3F E;  2XR8 A;  2XRX A;  1UUW A;  3VCP A;  2QJK C;  1FQT A;  4D6T E;  4QCK A;  3D89 A;  1SJG A;  1O7G A;  4PV1 D;  3FOU A;  3GL0 A;  1NU1 E;  3VMH D;  5KLV E;  2NVE A;  4H13 D;  4HM6 A;  1G8J B;  3C0D A;  1EZV E;  3H1H E;  3GCE A;  1P84 E;  2NWF A;  3GZX A;  4HM1 A;  3GB4 A;  2D2C D;  4QDC A;  2QJP C;  4NB9 D;  2E4Q A;  2GBX A;  5CXM A;  2HMJ A;  3L73 E;  2JO6 A;  2NVG A;  4NBC D;  5BOK A;  2YVJ B;  2XSO A;  4P1C H;  2BMR A;  2YFI A;  2E4P A;  1KYO E;  3H1L E;  2QJY C;  1WQL A;  2DE6 D;  1SQX E; 
#chains in the Genus database with same CATH topology
 1IFJ A;  1LTJ A;  1PP9 E;  3VYI A;  3CPW O;  1J1D C;  2QPZ A;  5BU8 B;  3CCU P;  3H1L D;  1Q7Y Q;  1QEX A;  1QVG O;  3GG2 A;  1RF1 C;  4Y99 B;  5AEW A;  1PP9 J;  3O6Q A;  2ZVO B;  3KYQ A;  2K9Y A;  2YFL A;  3HE5 A;  4NPF X;  1YIJ P;  1L0L E;  1SQB D;  1K05 A;  3M9Q A;  2OYI A;  2K37 A;  2B1X A;  5HL4 A;  1EDJ A;  3VMA A;  4WBA A;  1LWU C;  5AW7 B;  1L0L J;  3B5N D;  5AVZ B;  5EFW B;  1QX8 A;  3GOB A;  4EOT A;  3I56 P;  3L75 E;  1URQ B;  4N6J A;  2FYU G;  1X79 B;  4JBZ A;  1JMB A;  3P8C D;  2YNY A;  4DOJ A;  1NH4 A;  1M7L A;  3RGU A;  3SWY A;  4OWF A;  3L75 J;  4HM0 A;  2XDJ A;  3CX5 I;  2PRR A;  1FJK A;  1SJG A;  1O7G A;  3NMD A;  1RHZ B;  3EQ2 A;  1S5L X;  4GOD A;  1IK7 A;  3VMZ A;  4HM1 A;  3HD7 B;  3GB4 A;  3FXD A;  2ZXX A;  1S4X A;  2BMQ A;  1ZN5 A;  1U57 A;  2C9L Y;  3CCS P;  1NTK K;  1PPJ G;  3G9R A;  1SQQ K;  2WSF J;  3CX5 E;  2IBZ D;  3H32 B;  2WZ7 A;  4DT0 A;  4PJ0 H;  1EDK A;  2CPB A;  4R4L A;  1NVO A;  2N1T B;  1BCC E;  2A45 G;  5B66 E;  1H8A A;  4H13 B;  2QIW A;  4RES B;  3K5B A;  4GOF A;  1X8Y A;  1BCC J;  4WY4 C;  2QVA A;  4PD4 I;  2H7H A;  3L72 G;  1L4A D;  1ZR4 A;  3RK2 B;  2I1J A;  1IFP A;  1JY3 O;  1S72 P;  1KTM A;  4RKU J;  3WUU A;  2HPC B;  3MUD A;  2YMY A;  3AEB C;  5KKZ B;  4HM2 A;  2Y0E A;  2NPS C;  3FWL A;  2A45 I;  5AW6 B;  2W6J H;  1SQX K;  2WPQ A;  5KTB A;  1FZC C;  1MZ9 A;  2W90 A;  3AED C;  1GU4 A;  1VQ4 P;  1USD A;  4WWI A;  3RK3 B;  2IYO A;  3H25 A;  1EZV D;  2QJY C;  1VQ5 P;  3GW6 A;  3BAS A;  4L73 A;  2Q9I A;  4HM7 A;  5CBN A;  3B71 A;  2FXO A;  1LT9 A;  1OWA A;  1M1J A;  3FXE A;  3AE1 C;  3IFM A;  3MHV A;  3WUT A;  3L4F A;  4XFJ A;  3VP9 A;  1HVV A;  1FZB A;  3B4S A;  1DH3 A;  4ZKP A;  1J1E B;  2YO2 A;  2Q1K A;  1T8Z A;  2XKM A;  3PH0 A;  1MKM A;  1SQP K;  1VQP P;  1CI6 B;  2W27 A;  2FYN C;  1YJN P;  2OYH B;  3AZC A;  1H0T A;  3IR9 A;  5KAF E;  4QUR A;  3LIE A;  2E5T A;  1PV3 A;  2MJZ A;  1E5W A;  4AAY B;  3P8M C;  1KIL C;  1NKZ B;  1QGK B;  2QM7 A;  1K73 Q;  3VMY A;  1U7J A;  2E74 C;  4ZNC A;  1HJB A;  3R2P A;  1GD2 E;  4N78 D;  3Q5R A;  4KT0 J;  2ZVN B;  3GL0 A;  4AQR D;  5KLV E;  5APX A;  4AYC A;  3P32 A;  5CJ0 A;  4EIJ A;  3Q3D A;  1S2E A;  5B5E H;  4ASW A;  4PD4 H;  1BSN A;  5KLV J;  1SQP D;  2AXT E;  3RL0 C;  5AVT B;  2P67 A;  4HKZ H;  2Y0D A;  1L0N K;  3USS A;  3L74 G;  2ZAE B;  1ULJ A;  3M0A A;  4GDO A;  2IZ1 A;  2GBW A;  1NAF A;  2DW3 A;  3M06 A;  2ZYL A;  4WY4 D;  4D6T G;  3CCQ P;  2N1T C;  2A45 H;  1M57 D;  2JR8 A;  3CL3 D;  4NPE A;  1NTM K;  4R4M A;  3H1H D;  1VCK A;  3Q2Y A;  3QH9 A;  4QDF A;  2FY8 A;  1GU5 A;  1BSH A;  2YIU C;  3VMI D;  2FYU D;  3GZY A;  3CXH D;  4NPD A;  4QDD A;  5KAF H;  1OMI A;  2A06 D;  3RK2 C;  2P58 A;  1HJ0 A;  1OX3 A;  1NTZ K;  4HH2 A;  5KLI B;  1BDC A;  2K9J B;  5KKZ C;  2UWJ E;  1G8K B;  1BDD A;  3CWB E;  1RF1 B;  1DX7 A;  2POH A;  1AQ5 A;  4OVN F;  1IFM A;  4U7J A;  5AW8 B;  3T97 A;  3M0D A;  2JKV A;  2E76 B;  3U59 A;  2KS1 B;  3CWB J;  4WVZ A;  3RK3 C;  3VCP A;  2AEM A;  2WVR A;  1LWU B;  1KYO I;  4HM6 A;  4PD4 D;  3V2Q A;  3AE3 C;  2N9B A;  2O1J A;  3A7O A;  4I1L A;  4QDC A;  4NBC D;  5BOK A;  2B89 A;  1N8R Q;  3HUS A;  2OTL P;  1URQ D;  3M9H A;  5TIS H;  3L73 D;  1S5L E;  1JMM A;  3GLM A;  4GIF A;  3OAK A;  1YTZ I;  4IL6 X;  1LTA C;  1ZW0 A;  2IZ0 A;  1N73 C;  1AA0 A;  1IFI A;  2OYH C;  4EMJ B;  3P8C E;  3H1K G;  2ZYG A;  3L72 D;  1AQT A;  1FS0 E;  4JPZ B;  2CPS A;  2R5B A;  3HD7 D;  3M91 A;  3HTK B;  5AVX B;  5CBO A;  1O7W A;  3CC2 P;  5E79 E;  1KB9 H;  1NTK G;  1PP9 G;  3NXS A;  2M5A B;  3GF7 A;  4JF7 A;  1H88 A;  3AE8 C;  1YQ4 C;  3VTP C;  4EI2 A;  3L71 E;  1YI2 P;  2WIT A;  4QUP A;  4M3L A;  1NAY A;  3S9O A;  2H43 A;  2M0B A;  4H0L B;  3KDP B;  3JC2 2;  1IK9 A;  3L37 A;  3L71 J;  1JTH A;  2HOD A;  1L0L G;  4GKG A;  2E43 A;  2YO3 A;  1KQF B;  3IF4 A;  1EQ7 A;  5K5G B;  3V4Q A;  2FYZ A;  2QRX A;  2XR8 A;  2N1T D;  2RKL A;  1VL2 A;  2M3E A;  1G2C A;  2BCC D;  4H13 D;  1VF5 B;  1M56 D;  2KIK A;  1EXJ A;  1W2E A;  3G4S P;  2GA1 A;  3O6Q B;  2OQQ A;  1Y9B A;  3SFD C;  4EYY Q;  2PFX A;  2GUV A;  2B87 A;  1YJW P;  1ZXG A;  3MGN A;  1NO4 A;  3M9B A;  4YPC A;  2OYI B;  3L75 G;  4IFD K;  1SQB K;  2XSO A;  3A0B E;  1IFD A;  1X9V A;  3GF3 A;  3RK2 D;  2C9N Y;  5CCG D;  3VN0 A;  3A0H H;  2NRG A;  3GHG A;  2Y9Y A;  2JZA A;  4UB6 E;  1FJP A;  4QUQ A;  3SWF A;  1SQX G;  3FWN A;  2WSS H;  3H1K E;  4Z1M H;  1HBW A;  4GT1 A;  2CKF A;  2NPS B;  5KAI E;  3CC7 P;  1KYO H;  4HM5 A;  2JWA A;  3S4R A;  4HB1 A;  2QE7 H;  3CCL P;  2CK3 H;  2HG5 D;  1FZC B;  1FAV A;  1NTK E;  3H1K J;  1KB9 D;  1M1K Q;  5E79 H;  4TLF A;  2HLO A;  1SQQ E;  1WRG A;  1MUU A;  3RK3 D;  4L75 A;  5AVS B;  1ULI A;  3TGU E;  2QJY B;  1NTK J;  4YXW H;  1KFM A;  1SQQ J;  1VQ7 P;  1YQ3 C;  2E76 C;  2DE7 D;  3EN1 A;  4QMA A;  3TGU J;  2AEF A;  1UUV A;  4JQ0 D;  1Q90 D;  3H1J G;  5DJU B;  5GTI H;  3PP5 A;  1JY3 N;  5KJ7 C;  3H1I E;  1BCC G;  1UUW A;  3L74 D;  4WY4 A;  3TNU A;  2FYN B;  2O01 H;  2KZI A;  1JY2 O;  3H1I J;  3L70 D;  4D6T D;  1FOS F;  1XTC C;  2JP3 A;  1RQV A;  1Y47 A;  1SQX E;  1M90 Q;  2HMN A;  1PZQ A;  4YXD C;  1KIL B;  3GTE A;  1P84 H;  1HUC A;  5AVQ B;  3TK1 A;  1KYO D;  1SFC C;  2E74 B;  1SQX J;  1VQ6 P;  3AEC C;  2O01 N;  3HE4 A;  2DE5 D;  3DQY A;  2WT7 A;  1GW3 A;  1FDI A;  2I1K A;  3O8Z A;  1PIX A;  1FDM A;  1OIP A;  1Y8A A;  1L0N G;  3CC4 P;  2PGD A;  3GMA A;  1N7S A;  1VQM P;  2FFD C;  3PTZ A;  3RL0 B;  4H0L C;  2YXQ B;  5GTH E;  4K3A A;  1LTJ C;  3N0Q A;  3H1J E;  1SQV D;  1T2K C;  5AW9 B;  1PL5 A;  2H88 C;  5CCH D;  1SQP E;  4NBB D;  2H89 C;  2ZT9 B;  1USE A;  1ZOY C;  1VF5 C;  3ZDM A;  1URQ A;  2KNC B;  2P2U A;  3H1J J;  1RQU A;  4I6M C;  2WPR A;  3CCM P;  2M8R A;  1OXZ A;  3LW5 J;  5AVY B;  1RFS A;  1SQP J;  1OFC X;  4L76 A;  2YIU B;  1LT9 B;  2OYI C;  1NTZ G;  2BEZ F;  1LTT C;  4W80 A;  2NVE A;  5AW5 B;  3H1H E;  3GZX A;  1LNQ A;  3CCJ P;  1N2D C;  2SPZ A;  1NU1 G;  3HD7 A;  1P84 D;  1K8A Q;  1MV8 A;  2V7Q J;  3H1H J;  1WQL A;  1BGY E;  2IX7 C;  3F5H A;  1HWT C;  2KOG A;  4L74 A;  3D6Z A;  5L8R J;  3D70 A;  1K9M Q;  1BE3 E;  4ASV A;  2KLV A;  2KSE A;  2I7F A;  1MFT A;  1PP9 D;  2E76 D;  1BGY J;  2D2C B;  5KLV G;  1VQO P;  2WSF H;  4UB8 E;  4B86 A;  1L0N E;  1BE3 J;  3CD6 P;  1K04 A;  2WSC J;  4YTP C;  5KJ7 D;  2KP8 A;  3EWK A;  5CMZ A;  2L5G B;  3KZI E;  3S1K A;  1L0N J;  5GTH H;  3CX5 H;  1FE6 A;  1NGM B;  2OYO A;  1NTM E;  4IL6 E;  1VQL P;  1T6A A;  3ITK A;  2XSH A;  1EC5 A;  2YFJ A;  2NZ2 A;  1EG9 A;  4BRY A;  2XZR A;  1Q86 Q;  3VCA A;  1AVO A;  1MFZ A;  4AUW A;  4IOI H;  5B66 H;  1NTM J;  2J5U A;  3PHL A;  2J59 M;  4ZMD A;  2HMO A;  1N73 B;  1N7L A;  1NTZ E;  1N86 A;  5CCG A;  3BCC E;  3U1C A;  1E79 H;  1PGJ A;  4C7R A;  2XRX A;  2HPC A;  5CHX A;  2V7Q H;  1NU1 E;  2IPP A;  1NTZ J;  2KXP B;  3P7K A;  2WPS A;  2WQY C;  4U3F G;  3BCC J;  3SSU A;  1CZQ A;  1Q2N A;  1SLQ A;  5AW0 B;  5TJH A;  1VDF A;  1NU1 J;  3G6E P;  3CWB G;  2G8Y A;  2FYU K;  2OTK E;  1QVF O;  4H44 B;  4H0L D;  3BAT A;  1ZR2 A;  3A2A A;  3KHU A;  2JEE A;  3I5C A;  1T3J A;  1T2K D;  3MUD C;  2RH0 A;  4NBA D;  3V5B A;  1GL2 B;  1VF5 D;  3F89 A;  1HGZ A;  1SQB G;  3NTN A;  3CX5 D;  2QEX P;  3B5N A;  1S9K E;  4BWN A;  4IL6 H;  1DEE G;  2FBW C;  3QWO C;  3HRN A;  2ZT9 C;  2BCC E;  4XA4 A;  2JO1 A;  1BCC D;  2B9B A;  1VM9 A;  1LP1 A;  1T3U A;  1ZRT D;  2LR2 A;  2BCC J;  4OH8 B;  1LTG C;  1LT9 C;  1JY3 P;  1NYH A;  1NDO A;  4RO0 A;  1M1J C;  2NPS D;  3HUS B;  1LTS C;  3V2P A;  1RH5 B;  3I55 P;  1O7P A;  1JCD A;  2YMK A;  1VQ8 P;  2Q7C A;  2NUK A;  3G3Z A;  2LXC B;  2KI7 B;  4U3F E;  3D89 A;  3E7K A;  2PAJ A;  1J2J B;  1RE4 A;  3L71 G;  4A7P A;  1X0T A;  3BRT B;  3A5T A;  1X22 A;  4U3F J;  4DZO A;  2ZXE B;  3CCR P;  2YVJ B;  3H1L E;  1KQS O;  2D2C C;  2Q3W A;  2FKW B;  1GW4 A;  1RE3 A;  5CJ4 A;  1PPJ D;  1IZN B;  2QG4 A;  4OGQ B;  3L36 A;  3H1L J;  2WSE J;  1SQB E;  2AXT H;  5CCH A;  2YXR B;  2KYV A;  3SWK A;  3AEE C;  3IAO A;  2HMK A;  2HOD B;  4IFF A;  1SQB J;  2JWD A;  3BVH A;  4HKV A;  3WU2 E;  4C7N B;  1AVY A;  1D7M A;  5BVZ A;  1FOS E;  1KMI Z;  5H2F E;  4I7Z C;  1G2C B;  4NBD D;  1L4A A;  1CSB A;  1KIL D;  5BU5 A;  3G71 P;  3GL2 A;  1RF0 C;  4RJT A;  2YKP A;  3IN6 A;  2W6A A;  1SFC B;  2E74 D;  2HML A;  4BXL A;  4NBG D;  5AEU A;  1PGO A;  1H89 A;  2E75 B;  1RF1 A;  2AXC A;  1OVV A;  3V6I A;  1FDO A;  1SQQ G;  3AEG C;  2Q6Q A;  3TGU G;  1NWQ A;  2FFD B;  4H44 C;  3RL0 D;  3RBZ A;  3E1I A;  1LWU A;  2WMM A;  5KLV D;  1OVR A;  1JY2 N;  1LTJ B;  1EZV G;  3TYY A;  2DE6 D;  2ZT9 D;  2R5D A;  4LC1 A;  1LT1 A;  2IBZ E;  1GL2 C;  3H1I G;  2GUS A;  1R8E A;  1NOH A;  1AJY A;  3HE5 B;  1FZF A;  1JCC A;  1PGQ A;  3AE7 C;  5AVR B;  1NJI Q;  1S5L H;  3WU2 H;  4PV1 B;  3A3Y B;  2W6B A;  5APV A;  2XND H;  1LTB C;  2QSI A;  1EZV I;  2QM8 A;  2JJL A;  4HM3 A;  3W67 A;  2NUM A;  3HUS C;  1M8O B;  4HJG H;  3D71 A;  4K35 A;  4NBF D;  1UII A;  2V4H A;  1YYC A;  2L91 A;  3KXD A;  1VQN P;  5AW2 B;  3FOU A;  4EDF A;  2FXP A;  2C0W A;  1G8J B;  3SFE C;  1EZV E;  1KQG B;  1XTG B;  3HE4 B;  3C1L A;  2E4Q A;  2WT7 B;  1Z56 A;  1QLE D;  2XU6 A;  1SQP G;  1ZLL A;  4I2L C;  3AE4 C;  4OGQ C;  1OW7 A;  1HH0 A;  1N7S B;  2Q5U A;  1GDT A;  4PJ0 E;  1QL2 A;  2NVF A;  3WMM 0;  1PFI A;  1R5S A;  5AW3 B;  1ZV8 A;  1FC2 C;  3A0B H;  3CMA P;  4TT3 H;  1LJ2 A;  1SQV K;  4NBE D;  3H1H G;  2LKM A;  1R5L A;  3GTS A;  2Z4E A;  2NPS A;  3TSI A;  4P1B H;  2Y0C A;  4UB6 H;  4HJL A;  1EXI A;  2OAR A;  1FZC A;  2R3S A;  5KAI H;  2A06 G;  1BGY G;  1UIX A;  4H44 D;  1BE3 G;  2ITA A;  2WPV B;  4GOE A;  1JUN A;  2E75 C;  3GHG C;  2OTJ P;  1FU1 A;  3BRV B;  4NBH D;  3L71 D;  3CCE P;  2C0X A;  1AV1 A;  4N78 E;  1S3J A;  3GKE A;  1JNM A;  4HYT B;  1GL2 D;  3OW2 O;  3CLQ A;  1KD1 Q;  2WWW A;  2Z5H A;  1NTM G;  3CXH I;  3VMH D;  2R44 A;  1SP4 A;  2PP6 A;  3C0D A;  1GK6 A;  2VRS A;  3OJA B;  2YKQ A;  1FZE A;  4IFM A;  5DJT B;  1CW5 A;  4NB9 D;  2QJK B;  3V2N A;  1OW8 A;  2BMR A;  2YFI A;  1LGH B;  2LXB A;  2P1J A;  3WUV A;  2B24 A;  3E1R A;  1L0L K;  3L73 G;  1M1J B;  2QJP B;  1FZA A;  1KC8 Q;  3BCC G;  1VQK P;  1KIL A;  1ZRT E;  4PV1 C;  4BRY B;  4NB8 D;  2RMZ A;  2FYU E;  3PRJ A;  3KPE A;  3CXH E;  1GMJ A;  3H1K D;  2A06 E;  3C8V A;  1H0T B;  3EQQ A;  2E5Y A;  4ZKU A;  2FYU J;  2P7J A;  2AEJ A;  2O3J A;  1NTK D;  1G1I A;  2IFM A;  2W8Z A;  1SQQ D;  1EDL A;  3LID A;  1JO5 A;  5APT A;  3TGU D;  2QA4 P;  3H32 A;  4W7Y A;  1A02 J;  4OGQ D;  1L0L D;  4Y28 J;  1Q81 Q;  3AE6 C;  2N1T A;  5B5E E;  1O7N A;  4PD4 E;  1KV4 A;  1YTZ T;  1PPJ E;  1S1C X;  4Y99 C;  1VPC A;  4MN4 C;  2KNC A;  3LW5 H;  1IO4 A;  1VQ9 P;  1FQT A;  2BCC G;  1N7S C;  3H1I D;  4JYB A;  1JY2 P;  4DJG A;  3GCE A;  1QL1 A;  3Q5S A;  4I7Z B;  3V2R A;  2XV5 A;  3H6P A;  3FX0 A;  3TDK A;  3L73 E;  1KN7 A;  4P1C H;  3L75 D;  3B5N B;  4W7Z A;  2G3A A;  2Y9Z A;  1SFC D;  1JOC A;  3PJS K;  2N9Y B;  3MD0 A;  3L73 J;  1KIL E;  2E75 D;  2KK7 A;  3II6 A;  1URQ C;  1SQX D;  3AE5 C;  3L72 E;  1LP1 B;  4QDF B;  1O7H A;  3CXH H;  5AVU B;  1HTL C;  1ZME C;  3U1A A;  1W5C E;  5APQ A;  2KUB A;  3N7N A;  3L72 J;  1L2P A;  4C46 A;  1DD3 A;  2WSC H;  3H1L G;  3Q1M A;  1YHQ P;  4UB8 H;  1NKN A;  3AEF C;  3HD7 C;  3L35 A;  1IC2 A;  4XE5 B;  1AFO A;  2K3R A;  1OVU A;  3UIA A;  1NHL A;  1SS1 A;  5APS A;  1GZL A;  2Z5I A;  3KZI H;  2Q3E A;  3T97 B;  5AW4 B;  3OA7 A;  3H1J D;  4HM8 A;  1N73 A;  1CI6 A;  2IFN A;  1KB9 I;  2OYH A;  2QJK C;  1FZG A;  4PV1 D;  1KZU B;  1FBM A;  4LGD E;  2BEQ D;  2ZYA A;  1RF0 A;  5TIS E;  1RY3 A;  2NWF A;  2BAS A;  3L70 G;  2QJP C;  3R4Y A;  4H13 C;  2HYN A;  3MTU E;  3JCU E;  5M1B A;  1W2B O;  2E4P A;  1KQL A;  5AVW B;  2HMM A;  4LLH A;  2Q3I A;  3MIW A;  1L4A B;  1A02 F;  2ZYD A;  1YJ9 P;  1BGY D;  5C39 A;  5CCG C;  3CME P;  1KB9 E;  1BE3 D;  1SVF A;  1TU3 F;  3RK3 E;  1J1D B;  2R3C A;  2BMO A;  2ZJS E;  3Q5P A;  3KQG A;  3VMG D;  1NU1 K;  1KOR A;  1HGV A;  1L0N D;  1OZH A;  1GL2 A;  5AW1 B;  3VMX A;  3NFQ A;  1DEB A;  1DIP A;  4DCK A;  2KLU A;  1N7S D;  3B8E B;  1JM1 A;  2IBZ G;  2RN0 A;  1NTM D;  1SQV G;  2B88 A;  1JTH B;  1EDI A;  1RIE A;  2O1K A;  5KLV K;  2IYP A;  4WB4 A;  2H8P D;  3L74 E;  3V4W A;  4CPG A;  2MKV A;  3VOP A;  2M3B A;  3FGA D;  2IDB A;  3PLN A;  3RL0 g;  3MP7 B;  2E42 A;  3C9I A;  1Q90 C;  3L70 E;  4QCK A;  4D6T E;  2ZFC A;  1NTZ D;  3B5N C;  3L74 J;  1Q82 Q;  3VP8 A;  2B87 B;  4KJM A;  1U7M A;  3BCC D;  1J1E C;  3A0H E;  2HFE D;  2K9J A;  3JCU H;  2IBZ I;  3L70 J;  1GTW A;  2R32 A;  1NU1 D;  4D6T J;  5CXM A;  3CI9 A;  5APU A;  3D6Y A;  5APW A;  2WTY A;  1KYO E;  3GHG B;  3MZW B;  3ABV C;  4KHX A;  2HR3 A;  3N4X A;  3CCV P;  1O7M A;  2KS1 A;  2P10 A;  2XNX A;  1JB0 J;  1IJD B;  2WSE H;  2KSJ A;  2FXM A;  5KJ7 A;  4O9B A;  1JM0 A;  1GK4 A;  4HM4 A;  4N3Y B;  3EFF K;  2W83 C;  2YKO A;  1RE4 C;  2OGU A;  1DD4 A;  1WMK A;  4AIV A;  2GM4 A;  1SQV E;  1P84 I;  3AEA C;  2JDI H;  3AE9 C;  1WT6 A;  3M0D C;  1NYK A;  1IFN A;  2KB7 P;  1S9K D;  4C7N A;  5GTI E;  3EFG A;  1YBK A;  3TF5 A;  2K1A A;  1RE3 C;  1JEK A;  1SQV J;  2KZJ A;  5H2F H;  5AVV B;  5CCH C;  3RBX A;  1SFC A;  1KFN A;  1OW6 A;  3HTK A;  4WY4 B;  2J58 A;  1G1J A;  3AE2 C;  3TNU B;  3W68 A;  1PGP A;  2O01 J;  2M5A A;  4JYC A;  2I8D A;  1P84 E;  1LTI C;  3JSV C;  4U3F D;  2D2C D;  2K88 A;  2FFD A;  1YIT P;  2GBX A;  1ZP0 C;  2HMJ A;  2JO6 A;  2NVG A;  1L4A C;  1HF9 A;  5APY A;  3CWB D;  5KLI C; 
#chains in the Genus database with same CATH homology
 2BMQ A;  1BGY E;  4H0L D;  2B24 A;  2HMN A;  2ZT9 D;  4HM7 A;  2HMM A;  1PP9 E;  1ULJ A;  3GTE A;  2IBZ E;  2GBW A;  1O7M A;  1BE3 E;  2JZA A;  2NVF A;  2QPZ A;  2ZYL A;  2E75 D;  4QUQ A;  1ZRT E;  3H1K E;  2I7F A;  3L72 E;  1SQB E;  2CKF A;  4NB8 D;  1O7H A;  4QDF B;  2E76 D;  1KB9 E;  3CX5 E;  5AEW A;  4HM5 A;  4NBE D;  2FYU E;  1L0N E;  4EMJ B;  1VCK A;  3CXH E;  2Q3W A;  2DE5 D;  2YFL A;  4NBA D;  3DQY A;  3GTS A;  1VF5 D;  1L0L E;  4QDF A;  4HM4 A;  2HMK A;  2A06 E;  2BMO A;  4P1B H;  1NTK E;  4HJL A;  3VMG D;  2YIU C;  3VMI D;  2B1X A;  5HL4 A;  3EQQ A;  1BCC E;  3GZY A;  1O7W A;  1SQQ E;  4QDD A;  4HKV A;  4AIV A;  2FYN C;  3AZC A;  1NTM E;  1SQV E;  1ULI A;  4HM3 A;  2BCC E;  3TGU E;  1NYK A;  2NUM A;  4QUR A;  2XSH A;  4NBD D;  1JM1 A;  4H44 D;  3GOB A;  3L71 E;  2YFJ A;  1EG9 A;  5KLI C;  3N0Q A;  1VM9 A;  3H1J E;  4QUP A;  3GL2 A;  3VCA A;  5KKZ C;  2DE7 D;  3EN1 A;  3L75 E;  1SQP E;  1RIE A;  4AAY B;  4NBF D;  4NBB D;  1G8K B;  1UUV A;  4OGQ D;  3CWB E;  2E74 D;  4NBH D;  2HML A;  2HMO A;  1NDO A;  4NBG D;  5AEU A;  3L74 E;  1NTZ E;  1O7P A;  4HM8 A;  3GKE A;  1O7N A;  4PD4 E;  1RFS A;  3H1I E;  2NUK A;  4HM2 A;  1PPJ E;  3BCC E;  4HM0 A;  1Q90 C;  3L70 E;  4U3F E;  2XR8 A;  2XRX A;  1UUW A;  3VCP A;  2QJK C;  1FQT A;  4D6T E;  4QCK A;  3D89 A;  1SJG A;  1O7G A;  4PV1 D;  3FOU A;  3GL0 A;  1NU1 E;  3VMH D;  5KLV E;  2NVE A;  4H13 D;  4HM6 A;  1G8J B;  3C0D A;  1EZV E;  3H1H E;  3GCE A;  1P84 E;  2NWF A;  3GZX A;  4HM1 A;  3GB4 A;  2D2C D;  4QDC A;  2QJP C;  4NB9 D;  2E4Q A;  2GBX A;  5CXM A;  2HMJ A;  3L73 E;  2JO6 A;  2NVG A;  4NBC D;  5BOK A;  2YVJ B;  2XSO A;  4P1C H;  2BMR A;  2YFI A;  2E4P A;  1KYO E;  3H1L E;  2QJY C;  1WQL A;  2DE6 D;  1SQX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...