2IBZH

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2ibzH00
1NTMH 2BCCH 1L0LH 2IBZH 1NTZH 3L72H 3H1KH 1SQXH 3CWBH 1NU1H 1BCCH 3L71H 1KB9F 2A06H 3TGUH 3BCCH 3L74H 1BE3H 4PD4F 3H1IH 3H1HH 3L75H 1BGYH 1SQPH 3H1LH 1PP9H 3CX5F 1NTKH 1KYOF 1SQVH 1L0NH 1PPJH 3L73H 3H1JH 3L70H 5KLVH 4U3FH 1SQQH 3CXHF 2FYUH 1SQBH 1P84F 1EZVH 4D6TH
chains in the Genus database with same CATH superfamily
1KP2A 5LHHA 5L3DA 5FNVA 4BWAA 1NVPB 1AJPA 3ZHUA 2CK3G 3CRMA 4OPAA 2WLHA 3ABKB 3QF7A 4FLVA 1QR9A 3H1JH 3SJQC 4UV8A 4G27B 4BR6A 3K3WA 2RCVA 2XASA 1XMOB 4BIUA 1BQZA 2P6JA 4QGPA 4GKKB 5CN0A 4UVAA 1BHBA 5GTIZ 2PY5A 2Q67A 4PV1B 3VQYA 5L3EA 1VQ9V 4QIWF 2Q68A 1BMFG 1FPOA 3QO8A 4TSFG 4XDLA 1N36B 2ZDIA 4ZI7A 3CRCA 2B5UA 4IIJA 1FFTB 4H37A 3VBBA 5LA6B 5KHIA 2R72A 3ZMSA 1ZL8B 4JI2O 5B1BB 1B6QA 4X66B 3IFXA 1NH2B 3KZIZ 1N4CA 4DO2A 1HWYA 3SJAC 1AI4A 1IBKB 3SGIA 3OUFA 2WLLB 4JI4O 1XNRO 1Y74A 2VQFO 2XAGA 2QTOA 4J41A 5KHHA 2QEXV 3AG2B 2WLKA 5KHGA 4P30A 3QO5A 2EULA 4TV9A 2EX3A 4MW3A 3DSQA 1PP9H 3K04A 5LP6C 5ITZA 3E86A 4G2KA 4JAVA 1N32O 3E2EA 1BT8A 3I56V 3K79A 1WA8B 1SERA 5D5PA 4QNHB 3EVKA 3D36A 1HNWO 2P4KA 4TV8B 1MMMA 2Y4UA 1VQNV 1HR0B 1I94O 2HEPA 5LXTB 4I50A 2YEVA 4FMTA 2IU3A 1M93A 2AW9A 4PDMA 5KMGA 4RUEA 4CZZA 2RN9A 3FAVB 4J11A 3ZHQA 1NU1H 5BY1A 3L71H 1VQ4V 4H0LB 3BAAA 1PNLA 4LH7A 2G38A 1VF5B 1N8RW 1S72V 3ZMZA 1FXKA 1PPJH 2YC0A 3RWRD 1K33A 2RJZA 4F4LA 4WCEV 1IBMO 3CC7V 2E76B 1PL0A 3WB1A 3ZN0A 1CPYA 1T5EA 4JF3A 3GB7C 3JAMN 3CJHA 1ORQC 3I5DA 1F4MA 4X89A 3STLC 3ZHTA 5LHGA 3SJBC 2P90A 4JI3O 3RYFB 3CS5A 2XAQA 1VQKV 2D3OW 3AG3B 4O2BB 3NXSA 3A2FA 5B3SB 3RFRA 5LHIA 1DF4A 1VQ5V 3CSXA 4P9OA 2PI4A 3BCCH 4DV4B 4AQYO 1XNQB 5IJ0B 4U7OA 3SDLA 2EIKC 2ZT9B 4YJ2B 4I5SA 2UXCO 4LWSA 1QCEA 3K9AA 2LP7A 3KCXA 4ZKIA 4MS2A 4NXMO 1BS3A 4X8AA 3HR0A 5EIBC 3ABMC 3AG4B 4KHPB 1CXZB 1R1BA 3OGIB 5J2UA 5JQGB 4MSWC 3OTOB 4LF4O 4PA9A 4DV7B 2CTPA 4DV5O 4FJCC 1DK1A 3Q4HA 4QE9A 2FYUH 4I55B 2XAJA 1L0LH 4FFBB 3UT5B 4PA7A 1RM1B 1YZBA 4LNUA 5CA0A 4U3JB 4I0XA 1ZLZA 4TWKA 2JVDA 3JCUZ 2EIJB 3JD3A 2VS0A 1XEQA 4X20A 2GUZB 3OEEG 1MABG 5B1OA 3KG2A 5JCOA 1G6UA 3APQA 3JD0A 1R3KC 4DV1B 1IURA 1SS3A 3JARA 2YXYA 5H5NA 3RYIB 3W7WA 4QJFB 4X62O 1VQ7V 1AI6A 2V7QG 1GMGA 5KUKA 1V55B 2F43G 4ICGA 4MT8A 1BHAA 4EFEA 1VMGA 1Q5OA 1XMQO 5H9CA 3CB2A 3OE7G 1W0KG 1Q82W 3SJCC 4GYCB 2FMLA 2WLNA 3JATA 5HFLA 3ABKC 3VQXA 4NXNO 2A7WA 1R6TA 1N34O 2WSSG 4MVUA 4CC5A 4C7UA 3QNEA 5C93A 4JI3B 3CMAV 5IDJA 4TOIA 4HAMA 2PUSA 1ZWIC 3TCUA 3A8TA 4DRXB 5CBGA 2UU9B 4O4JA 4B3RB 3FKSG 1QU7A 1WLEA 3ZMTA 5JVDB 2UUCO 5IYZB 3TJTA 1Q6HA 4FVMA 1VIBA 4X64B 2ZM6B 1EBOA 4JV5B 2NN4A 3BA9A 3JAKB 3RYCA 3L74H 2GBOA 1I0HA 2WLIB 3BABA 1KKCA 4O4IB 4O4HB 4JTDB 1MSWD 4FZ0A 3ZBHA 2GHYA 3MD0A 3SPHA 5B1BC 4ZHQB 4K8XA 2WWWA 5KA6A 1SRYA 1RPRA 1Z5VA 3T1CA 1Q6IA 5B5EZ 4E4EA 1ZSPA 5IY5C 4FPPA 3JALB 2OIEA 1EM1A 4BIZA 3AG2C 1K9MW 2ZKOA 3ETGA 4FK5C 4DV6O 3T1YO 3IJ4A 3T1HO 3IAYA 3UO3A 3HKBA 3A0BZ 4JYAO 1VQMV 2AHYA 4X1IB 3PN1A 3ZHSA 5GONB 1M57B 1VF7A 1I08A 1S5HC 2FKXA 4J42A 1L0NH 3JAWA 3OR6C 2F93B 2ITDC 2ZE7A 4E2LA 3APOA 1GM8A 1YTFD 2XNDG 4JZ2A 1U97A 2P5OA 2L6LA 4JI5B 5A9GA 4RAIA 3RYHA 2B1IA 1WB8A 3TGUH 4UV9A 4WBNA 1N34B 2Y48A 3IC9A 4O4LA 2A79B 1LUVA 4BW5A 4JI0B 4FLTA 4FLYA 1YDXA 4D7SA 2PYLA 2YIAA 4X1YA 2C2AA 4HBNA 1PL4A 5GTHZ 3DXRA 1AP6A 1TAEA 2JGDA 4LF8B 1VQ8V 4LC1A 1IX9A 1H38A 5LGUA 1BCCH 3ZRWA 5B3SC 4NTXA 2IH3C 3EFFK 1XMOO 3RVZA 1AVMA 3LSUA 3SPGA 1GN4A 4HNAA 2ZR3A 4ZI7B 1Y76A 2DYSB 3LNNA 2V4DA 4I9QA 4JAAA 3CCQV 2EBOA 5KHJA 4GKKO 2PZSA 4MW8A 5C8YA 4KXRA 2QE7G 1SQBH 1N33B 1F23A 2FL4A 3MAQA 4YHHB 2OWOA 1YF2A 5H2FZ 1N36O 2LGQA 4HYOA 2GDSA 2LFRA 2W0XA 1K4CC 3I55V 1Y74B 3AG4C 4X66O 1FAFA 4DXWA 1P7GA 2CH7A 4ZIBA 1TUEB 1H2LA 2HR3A 2QKCA 1EZJA 5CB4A 2UUAB 1IBKO 1M56C 4TV9B 3H1KH 4W4KA 1WNSA 2A06H 5ITZB 5EYPA 4AILC 3HKCA 4PD4F 2Y4TA 5LL6Y 1RM1C 4B08A 4EB6A 1FXHA 4EEQA 2M7WA 2ZE5A 5CA3A 1Y66A 2EIJC 2ZD9A 1G1XB 2BOBC 4I50B 2YEVB 2QWRB 4QE7A 5LOVA 1BSMA 1JFFA 2AXTZ 1HR0O 1S3JA 5KMGB 4MTGA 2WPDG 3CCLV 4KL1A 3WB0A 1IZ3A 2N04A 1V55C 3E8GA 3E35A 3CCEV 2QSAA 4XDKA 5EZYB 4CBCA 1U96A 1FXKB 2CAZC 2O57A 1PV0A 1TUBA 1OV9A 5EC2C 3CRAA 3ZHRA 1Q86W 3JCZA 1SC5B 1XL4A 2QM7A 1YI2V 1ZUQA 3CJHB 2Q7GA 3SR2C 1E1RG 2JDIG 3BHPA 2RQ6A 1F51A 3UQ8A 2ZNIA 4A5UB 2ZE8A 4X65B 1JX9A 3J7AU 4PDVA 4U3FH 2IJJA 1P84F 1KQSU 3H9VA 1AILA 2A0LA 3D8CA 3GWKC 2XHBA 1E79G 4B3SB 3D3QA 4MVRA 3R65A 2ITCC 2Q5ZA 4LWSB 1BE3H 2HG5C 4GX0A 1HDJA 3H1HH 3G6EV 1H2SB 1OZ0A 4YJ3A 1DTOA 4DV4O 4LFCB 1XNQO 1PD3A 2QM8A 4YY3O 1S5LZ 1OJHA 5J2UB 4LCUC 4CS4A 3WFVA 2OT5A 2WLMA 3D3IA 5IY5B 1OCCC 4L87A 1WN7A 1OCRB 4IYHA 2V1DA 5KA5A 5EBMC 3F7VC 4KHPO 4ABMA 3OM3B 1DGSA 3OTOO 4JYYA 3B2EE 3K5LA 2YXLA 2EINB 3N2GA 3AEIA 4DR5B 4DV7O 4AHCA 2ZCEA 3QG5A 5KLVH 2UXXA 4LNUB 1JVMA 1M9NA 3FB8C 3C90A 1VQOV 1M57C 3CE2A 1BL8A 1EN6A 1XHXA 4X20B 3RVYA 3S3WA 4JPRA 2Q8VA 2HJDA 3SYAA 3ZS8C 1XQ8A 4I4TA 3A0RA 5TISZ 4JI1B 3H1IH 4X1KA 3JARB 1K73W 3OT7A 4GT1A 2JJ2G 2YUAA 1WPXA 5LMUB 1SETA 3ASNB 1DF5A 4RO2A 1YITV 2OCCB 4OPHA 4L8JA 1WP8A 4J10A 4DV1O 1SQXH 1Q6UA 2KG7A 4PA6A 2ATKC 2WA4A 4LFAB 3FD9A 1K7DA 3F5WC 4YXWG 1GM7A 1OCOC 1KP3A 2DN9A 3OFNG 2WAMA 4I7ZB 3JATB 3ETQA 2Z3YA 5KAIZ 5IYBO 5K1PA 1WPBA 2HHHB 2JIZG 1AI5A 1XL6A 1Q81W 4O2AA 3IC7A 4ZOLA 3DC5A 4O4JB 5CA1A 4JI8B 3X2QB 4J9YB 5JJJB 3UM7A 5B66Z 1IXMA 3CYOA 1KD1W 3CRQA 1VF6A 2UU9O 4Z2WA 2QKSA 1VEWA 1V54B 3E22A 4JASA 4B3RO 3RYCB 2ZDIC 2HP8A 3ZRVA 2DYSC 1ZX3A 4JGSA 2YI9A 4CS3A 1OHHG 2XAFA 3LDCA 2HLDG 4X64O 3LNMB 5B1AB 2ZM6O 3H01A 3MHHC 1K4DC 4JV5O 1MA1A 3TK1A 4MVMA 2QWQB 1HW7A 4YY3B 2K1EA 5LBQA 1KKDA 4N23A 1IBLB 1V9PA 2VQEB 3U10A 1QHTA 4GX1A 4DUYB 3JD2A 1GO3F 1YXBA 4PA3A 3OD4A 1J5EB 1FJGB 2X6CA 4UFZA 3L75H 5LA6A 4JI6B 1NTKH 1KYOF 1M56B 1UFIA 3HKBB 1QLEB 5IYDO 2ZXWB 4CH3A 3L73H 4D6TH 3D36C 2D2CB 4TQDA 4GLXA 3K5OA 4OX9B 1W2BU 5IJ9A 3U11A 3JAWB 5L3BA 1F4NA 3BEHA 3SYPA 4PELA 1VQLV 2A3QA 3EXAA 3C3TA 5JH7A 4JYCA 1N0JA 3ZJZA 2QTSA 4F6EA 5BR8B 1KECA 4B7EA 1RPOA 1WA8A 5L3FA 3HPLC 1GAXA 4DW1A 4WBNB 1HNZB 5H6RA 4JI5O 1O9HA 3UCSC 1FXKC 4DV2B 1XILA 1ZAUA 4BIOA 3BFRA 4O4LB 3HKEA 2YIBA 4DV0B 2X6BA 4P9PA 3CCSV 4X1YB 2F95B 4K3AA 4DR7B 5E1AC 1NBMG 2Q9LA 2R9IA 2N74A 2Y0IA 3FYEB 4J7ZA 3ZHVA 3DXRB 4ASUG 4JI0O 3H1LH 3GWOA 4FLZA 2UXBB 4BAYA 1P4RA 3CPWU 4DR1B 3ZRWB 4XDJA 4B3TB 4J7KA 2H3OA 1FD9A 1JA8A 4LF5O 2QKAA 1KC8W 2JS5A 1AROP 5A2QN 4HNAB 1QLNA 1Z5WA 3E8HA 2EZOA 1N0NA 3CWBH 3B8NA 3ABLB 2IJIA 4LF8O 1JPXA 4TT3G 5C8YB 5L3GA 2LJ2A 1LUWA 3BRCA 1I7FA 2VWKA 4CH4A 1J95A 4DK0A 4JAUA 5HFMA 3P3PA 4XBFA 2FTKA 1N33O 3ABUA 1Q3EA 1YJWV 1KB9F 1H2NA 4YHHO 4UB6Z 2BOCC 3WB2A 2CTQA 2CH7B 4DR2B 2EIMB 1EN5A 1FFXA 4DV3B 5CB4B 2W6JG 2XTAA 1OCRC 2YIBD 1B3QA 4DYLA 5DM6V 1OCCB 5EYPB 3K06A 5EC1C 2IJKA 3ETDA 3HKCB 1EZVH 2EINC 1I5XA 2LQTA 5KX5A 2UUAO 1XOUA 4JI7B 2F23A 1GTOA 2BTOA 1URFA 4EB6B 3CP1A 2ODMA 3L9DA 3LDEA 2XUMA 3J81N 2M6YA 1IXBA 4UCVA 1GK9A 4QPKA 5JQGA 3HKDB 5JCOC 4X88A 3FB5C 3P3NA 1FYJA 2ZNJA 3AG7A 5LOVB 1JFFB 2BE3A 2Y0PA 2CGNA 4FM0A 5IYCO 4WFBV 3ASNC 5B1NA 2OCCC 2JJ1G 4GCZA 2GV9A 3UT5A 3ZEDA 4GKJO 5BMVA 1R3LC 1O9GA 2ZINA 1YJNV 1NR7A 1US6A 2MK3A 2Z5UA 3VOUA 5FNVB 1TUBB 2AZ0A 1AJNA 2AHZA 2GTAA 2QGNA 1OCOB 3CRRA 1PKXA 1THZA 2DOSA 2IJHA 3OMIB 2DWDC 1RSOA 2EILB 2UUBB 3OTFA 3KCYA 4DUZB 1HP8A 4CH5A 3B09A 3X2QC 4LF5B 2YICA 4DR3B 4PI0A 1QVGU 1OCZB 4PA4A 3SPIA 2F1MA 1SKVA 4GUNA 1V54C 3HB3B 2PI5A 3LSQA 5K1XA 4X65O 5JJNB 4IIJB 1G4YB 4PHZA 2DMXA 5B1AC 2LGWA 3K08A 3SYCA 5E79Z 3K0GA 1KU9A 5EK0A 2QM4A 1NTZH 2NNUA 4YJ3B 3CCVV 2E5LB 2XOKG 4FM1A 1MOFA 1B06A 4B3SO 5KAFZ 1P7BA 3R66A 3S3XA 1JJ2U 4K0KB 2XT9A 1R6NA 3JASA 2K9PA 5IWAB 2UXDB 3ZRSA 3C3SA 5CBFA 4LFCO 2YXHA 2NLJC 4UVBA 4OXSA 4LFBB 1K5SA 1NI8A 3ZX6A 3ML0A 3N2GB 1QLEC 3ABTA 4MTFA 1XI1A 2ZXWC 4PI2A 2E74B 2OTJV 3K5MA 4W4LA 1AB3A 2ZQMA 2YIDA 5CMUA 2JEXA 4PDLA 3VQVA 4LF9B 3O9OA 3CEIA 4DR5O 1NT2B 3G80A 1NZ6A 1YJ9V 4EFBA 3L72H 4UCUA 4TUYA 3LSSA 1L1FA 4IT5A 4GKJB 1H2MA 1S0VA 1S77D 2Q73A 4QPJA 4Z1VA 4NTWA 4DR4B 5LP6A 4TQFA 1CP9A 4GX2A 4JI1O 4RUFA 1KBHA 2P4VA 1D5AA 3SPJA 2KG7B 1YCIA 5LMUO 2AGAA 2QWPB 1GN3A 1XREA 3N2KA 5LMNB 3CXCU 2CE4A 2ADQB 3WG7B 4DR6B 4ZBMA 2VWJA 2OTLV 5J2TA 1CEZA 2Z0AA 4LFAO 4O2AB 2QA4V 4ZOLB 4J7JA 3L70H 5CA1B 3CCJV 2HHHO 1BZKA 2CDYA 3QTCA 3E22B 4JI8O 4LR3A 1MZEA 1JMKC 1SESA 1RP3B 3ABLC 4BW9A 1K97A 4K8ZA 1NKDA 4LF6B 2DQ0A 4UCSA 4R8CA 4MVZA 3T4DA 3BY6A 1JCHA 4IGGA 1W59A 3FFQA 3CCRV 2OYQA 5KUMA 4D7TA 4UB8Z 4NR1A 2JK5C 3CCMV 2NR5A 1K5QA 3M7MX 2EIMC 1L8DA 1PNKA 2QWNB 3OEHG 1IBLO 5GW7A 2VQEO 5BZBA 1HNXB 3BVOA 5FL7G 1GN6A 4DUYO 3Q4HB 4LBEC 4Q6GA 2F4VB 1J5EO 1Q7YW 5D5QA 1SQVH 1FJGO 4JI6O 3WU2Z 5IJ9B 5CA0B 4IHJA 5DN6G 4I0XB 1SZXA 2HKOA 2LO1A 4WFGA 5LYJA 3AK1A 4LH6A 4LF7B 1WB7A 1XUQA 1LNQA 5FPRA 5JH7B 2BTQA 2PGGA 1M5IA 4WFFA 4KFMA 4OX9O 3G67A 3SYQA 5LGTA 1ROPA 4B3MB 4JTAB 3LUTB 1GM9A 2BSKA 1H2KA 3AG1B 1QR8A 4MVSA 1SA0A 3ZN1A 2AZ2A 1R73A 2CTRA 2IBZH 4Z1MG 1X59A 2FB5A 1TVKA 3JD4A 4WFAV 3A0HZ 4F6RA 5BR8O 1SF9A 1AR1B 5L3CA 2ETNA 3RBZA 3HKEB 2EJRA 1R3JC 1JQ0A 3AK2A 3B40A 4CH6A 2EILC 2JRIA 4WFHA 1HNZO 4DV2O 1JJOA 4FLUA 3E8BA 4NVPA 1Q90D 4DV0O 1YIJV 3K5NA 4GZRB 3K57A 3RW0A 3ZCCA 4UCTA 1K8AW 3K58A 4JZGA 5EZYA 4DR7O 1OCZC 4J9ZB 2L35A 3SYOA 4PDRA 4FLWA 1Y67A 2UXBO 5EIBD 4DR1O 1VP7A 2IH1C 4B3TO 2OCHA 1YTFB 1JR9A 3UKMA 1H8EG 2W6IG 2Q7HA 4MTXA 2DYRB 2R70A 1S5JA 1D5NA 1LR1A 1G8MA 5H6QA 4H13B 2F66C 1MNGA 2KSDA 1Q43A 2HVKC 1PNMA 1FFXB 2IW5A 1Y4MA 4JI2B 1FS0G 1YVWA 1H2GA 5CBHA 2Q69A 4NYKA 3G71V 4DR2O 4DV3O 4LP8A 1M90W 1ZL8A 5KX5B 4JI4B 1XNRB 1AI7A 2VQFB 3J80N 2P67A 1AP5A 1VQPV 1XHZA 5JWPA 4NTYA 4I9WA 2JEUA 1ENVA 2QJ1A 4DK1A 2WLLA 4JI7O 1NVPD 4FFKA 3RN4A 1WP7A 3CX5F 1N32B 3ICXA 2ARHA 2QR4A 1H8HG 1HNWB 3ASOB 2R9AA 3NR7A 3QO7A 3ZMUA 1GRJA 5BMVB 1I94B 2CGOA 3RYHB 3OMAB 2JS3A 3O65A 1GN2A 2XAHA 4TV8A 3ZRXA 2CUGA 3WG7C 3K9SA 5JJEB 2EJ7A 3DTUB 2OIGA 1RSOB 2P22C 5LXTA 3T4ZA 4OGQB 1WAZA 3E89A 3OMNB 3W7XA 1R3IC 5EBLC 2Y69B 4MVQA 2ZIOA 2WLJA 1D2DA 2IU0A 3FAVA 4JYBA 3G4SV 3E8FA 4U7NA 3OAAG 1B04A 4CC6A 2UUBO 5IT9N 3K0DA 2JGDB 3N27A 3RT3C 4DUZO 5J9PC 1IBMB 1VF6C 3P30A 1NH2D 2QDOA 3F5TA 2HVJC 2VRZA 3B8MA 4KP4A 3G6BA 4DR3O 4UCRA 3ZMVA 1Y76B 1P49A 4NKGB 2GTSA 1AR4A 4RQFA 3E83A 1DLBA 1GKFA 1XBLA 1Z2GA 3F7YC 5DECA 3TXSA 3CC4V 1K92A 2X7RB 3TETA 1GH6A 4UUJC 3RYFA 1M4UA 1AR5A 1FKAO 2P7TC 4O2BA 4RQEA 3UO2A 2YS8A 3JASB 2R9RB 3EHBB 2Q0OC 4AQYB 1QNMA 1Y6XA 2E5LO 1MZFA 1RFYA 2PTMA 1K3EA 2UXCB 4MTOA 2JGUA 4K0KO 1XDCA 4NXMB 2X6AA 2EZPA 5IWAO 2UXDO 4UXNA 2BCCH 5IJ0A 3IGAC 4LF4B 1QVFU 4LFBO 4YJ2A 2P06A 4MVOA 1WJZA 2CTWA 4FM2A 4DV5B 1KUQA 3ETEA 3CMEV 3M99B 3W7UA 4FLXA 5KHKA 1UPGA 4X9QA 3SPCA 4K35A 2KB1A 4TUYB 4LF9O 2GSMB 2ZIMA 3QVNA 2N05A 4RWUA 3ZIAG 2DE0X 5LP6B 3AG1C 2IM9A 3JD1A 2A9HA 5F2VO 4I55A 1UJWB 4IL6Z 2ADPA 1Q8IA 4FFBA 2LW1A 1VARA 5FPOA 3N2KB 3PJSK 4U3JA 2Q0AA 3CCUV 3JYCA 1TGOA 4DR4O 2E75B 4UCOA 1SQQH 4R6ZA 1F7YA 5J2TB 4X62B 2GUZA 1QBZA 3GVMA 5LMNO 1K34A 3THOA 4DR6O 4NB5A 2RMKB 3B77A 4KUMA 3STZC 1XMQB 1EN4A 2W0FC 3RYIA 3DGEA 1YHQV 4R7CA 1SQFA 1SQGA 3VQWA 2WA3A 2ILMA 1KMIZ 1VQ6V 1A32A 4NXNB 3CC2V 3OR7C 3OW2U 2Q4PA 3W7SA 3CHXA 3TXQA 4R50A 5IE9A 3B4SA 2B9ZA 3K59A 4P2ZA 4DW0A 1SQPH 3T2MA 1JOYA 4FZ1A 2UUCB 4FIPC 3BA8A 1X4TA 2X0LA 4H44B 2DYRC 4DRXA 3CD6V 2ZE6A 3AG3C 1E1QG 3RGBA 1QQCA 2LW7A 4LF6O 5JVDA 4B7KA 5IYZA 3KKYA 4JTCB 1YEWA 4PJ0Z 2YI8A 3FB7C 3AK3A 1COWG 4AI8A 3FYIB 1TA8A 1ZTEA 3JAKA 2RDCA 4CS2A 3FX7A 4YIPA 2WLIA 4O4IA 2YDEA 4O4HA 1YSCA 3BPZA 1SZTA 1AJQA 2H94A 4ZHQA 3W7TA 1NQTA 4N21A 2EIKB 1HNXO 1I5YA 3U0ZA 2DQ3A 4IHJB 1NJIW 2PYJA 2ZR2A 5LYJB 3ABMB 2F4VO 4DV6B 4G28B 3T1YB 3LDDA 3P32A 2BTQB 4GX5A 4Q20A 3T1HB 1S76D 3M8AA 3JALA 1NTMH 1MSDA 2Q6AA 1W0JG 2KQXA 4I4TB 2DW4A 1M1KW 4X1KB 4UVCA 1IVSA 4JYAB 2PF4E 2QWOB 4WF9V 2BSKB 4LF7O 3ASOC 3JSNA 1SA0B 4H33A 4WFEA 1MG1A 1EFRG 1R6KA 5EBWC 1PM9A 1TVKB 3MDSA 3MHSC 3FB6C 4B3MO 3K03A 5DEDA 3DC6A 4X1IA 4F6RB 3OGCC 1BQ0A 3CXHF 5GONA 2B1GA 1NR1A 4HZ3A 3HKDA 1FXVA 5LGNA 5FLXN 2UXNA 2LFSA 3OUSA 2HFEC 1BGYH 4YIOA 2DWEC 5AG2A 2H8PC 2KKWA 1NS1A 2DJVA 2Y69C 2MW2B 3JSLA 4J80A 2Q7EA 2RNBA 2YSUB 2HJFC 2E3CA 1IDSA 5BXZA 4EKWA 4IYIA
chains in the Genus database with same CATH topology
1NTMH 2BCCH 1L0LH 2IBZH 1NTZH 3L72H 3H1KH 1SQXH 3CWBH 1NU1H 1BCCH 3L71H 1KB9F 2A06H 3TGUH 3BCCH 3L74H 1BE3H 4PD4F 3H1IH 3H1HH 3L75H 1BGYH 1SQPH 3H1LH 1PP9H 3CX5F 1NTKH 1KYOF 1SQVH 1L0NH 1PPJH 3L73H 3H1JH 3L70H 5KLVH 4U3FH 1SQQH 3CXHF 2FYUH 1SQBH 1P84F 1EZVH 4D6TH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM H;  2BCC H;  1L0L H;  2IBZ H;  1NTZ H;  3L72 H;  3H1K H;  1SQX H;  3CWB H;  1NU1 H;  1BCC H;  3L71 H;  1KB9 F;  2A06 H;  3TGU H;  3BCC H;  3L74 H;  1BE3 H;  4PD4 F;  3H1I H;  3H1H H;  3L75 H;  1BGY H;  1SQP H;  3H1L H;  1PP9 H;  3CX5 F;  1NTK H;  1KYO F;  1SQV H;  1L0N H;  1PPJ H;  3L73 H;  3H1J H;  3L70 H;  5KLV H;  4U3F H;  1SQQ H;  3CXH F;  2FYU H;  1SQB H;  1P84 F;  1EZV H;  4D6T H; 
#chains in the Genus database with same CATH topology
 1KP2 A;  5LHH A;  5L3D A;  5FNV A;  4BWA A;  1NVP B;  1AJP A;  3ZHU A;  2CK3 G;  3CRM A;  4OPA A;  2WLH A;  3ABK B;  3QF7 A;  4FLV A;  1QR9 A;  3H1J H;  3SJQ C;  4UV8 A;  4G27 B;  4BR6 A;  3K3W A;  2RCV A;  2XAS A;  1XMO B;  4BIU A;  1BQZ A;  2P6J A;  4QGP A;  4GKK B;  5CN0 A;  4UVA A;  1BHB A;  5GTI Z;  2PY5 A;  2Q67 A;  4PV1 B;  3VQY A;  5L3E A;  1VQ9 V;  4QIW F;  2Q68 A;  1BMF G;  1FPO A;  3QO8 A;  4TSF G;  4XDL A;  1N36 B;  2ZDI A;  4ZI7 A;  3CRC A;  2B5U A;  4IIJ A;  1FFT B;  4H37 A;  3VBB A;  5LA6 B;  5KHI A;  2R72 A;  3ZMS A;  1ZL8 B;  4JI2 O;  5B1B B;  1B6Q A;  4X66 B;  3IFX A;  1NH2 B;  3KZI Z;  1N4C A;  4DO2 A;  1HWY A;  3SJA C;  1AI4 A;  1IBK B;  3SGI A;  3OUF A;  2WLL B;  4JI4 O;  1XNR O;  1Y74 A;  2VQF O;  2XAG A;  2QTO A;  4J41 A;  5KHH A;  2QEX V;  3AG2 B;  2WLK A;  5KHG A;  4P30 A;  3QO5 A;  2EUL A;  4TV9 A;  2EX3 A;  4MW3 A;  3DSQ A;  1PP9 H;  3K04 A;  5LP6 C;  5ITZ A;  3E86 A;  4G2K A;  4JAV A;  1N32 O;  3E2E A;  1BT8 A;  3I56 V;  3K79 A;  1WA8 B;  1SER A;  5D5P A;  4QNH B;  3EVK A;  3D36 A;  1HNW O;  2P4K A;  4TV8 B;  1MMM A;  2Y4U A;  1VQN V;  1HR0 B;  1I94 O;  2HEP A;  5LXT B;  4I50 A;  2YEV A;  4FMT A;  2IU3 A;  1M93 A;  2AW9 A;  4PDM A;  5KMG A;  4RUE A;  4CZZ A;  2RN9 A;  3FAV B;  4J11 A;  3ZHQ A;  1NU1 H;  5BY1 A;  3L71 H;  1VQ4 V;  4H0L B;  3BAA A;  1PNL A;  4LH7 A;  2G38 A;  1VF5 B;  1N8R W;  1S72 V;  3ZMZ A;  1FXK A;  1PPJ H;  2YC0 A;  3RWR D;  1K33 A;  2RJZ A;  4F4L A;  4WCE V;  1IBM O;  3CC7 V;  2E76 B;  1PL0 A;  3WB1 A;  3ZN0 A;  1CPY A;  1T5E A;  4JF3 A;  3GB7 C;  3JAM N;  3CJH A;  1ORQ C;  3I5D A;  1F4M A;  4X89 A;  3STL C;  3ZHT A;  5LHG A;  3SJB C;  2P90 A;  4JI3 O;  3RYF B;  3CS5 A;  2XAQ A;  1VQK V;  2D3O W;  3AG3 B;  4O2B B;  3NXS A;  3A2F A;  5B3S B;  3RFR A;  5LHI A;  1DF4 A;  1VQ5 V;  3CSX A;  4P9O A;  2PI4 A;  3BCC H;  4DV4 B;  4AQY O;  1XNQ B;  5IJ0 B;  4U7O A;  3SDL A;  2EIK C;  2ZT9 B;  4YJ2 B;  4I5S A;  2UXC O;  4LWS A;  1QCE A;  3K9A A;  2LP7 A;  3KCX A;  4ZKI A;  4MS2 A;  4NXM O;  1BS3 A;  4X8A A;  3HR0 A;  5EIB C;  3ABM C;  3AG4 B;  4KHP B;  1CXZ B;  1R1B A;  3OGI B;  5J2U A;  5JQG B;  4MSW C;  3OTO B;  4LF4 O;  4PA9 A;  4DV7 B;  2CTP A;  4DV5 O;  4FJC C;  1DK1 A;  3Q4H A;  4QE9 A;  2FYU H;  4I55 B;  2XAJ A;  1L0L H;  4FFB B;  3UT5 B;  4PA7 A;  1RM1 B;  1YZB A;  4LNU A;  5CA0 A;  4U3J B;  4I0X A;  1ZLZ A;  4TWK A;  2JVD A;  3JCU Z;  2EIJ B;  3JD3 A;  2VS0 A;  1XEQ A;  4X20 A;  2GUZ B;  3OEE G;  1MAB G;  5B1O A;  3KG2 A;  5JCO A;  1G6U A;  3APQ A;  3JD0 A;  1R3K C;  4DV1 B;  1IUR A;  1SS3 A;  3JAR A;  2YXY A;  5H5N A;  3RYI B;  3W7W A;  4QJF B;  4X62 O;  1VQ7 V;  1AI6 A;  2V7Q G;  1GMG A;  5KUK A;  1V55 B;  2F43 G;  4ICG A;  4MT8 A;  1BHA A;  4EFE A;  1VMG A;  1Q5O A;  1XMQ O;  5H9C A;  3CB2 A;  3OE7 G;  1W0K G;  1Q82 W;  3SJC C;  4GYC B;  2FML A;  2WLN A;  3JAT A;  5HFL A;  3ABK C;  3VQX A;  4NXN O;  2A7W A;  1R6T A;  1N34 O;  2WSS G;  4MVU A;  4CC5 A;  4C7U A;  3QNE A;  5C93 A;  4JI3 B;  3CMA V;  5IDJ A;  4TOI A;  4HAM A;  2PUS A;  1ZWI C;  3TCU A;  3A8T A;  4DRX B;  5CBG A;  2UU9 B;  4O4J A;  4B3R B;  3FKS G;  1QU7 A;  1WLE A;  3ZMT A;  5JVD B;  2UUC O;  5IYZ B;  3TJT A;  1Q6H A;  4FVM A;  1VIB A;  4X64 B;  2ZM6 B;  1EBO A;  4JV5 B;  2NN4 A;  3BA9 A;  3JAK B;  3RYC A;  3L74 H;  2GBO A;  1I0H A;  2WLI B;  3BAB A;  1KKC A;  4O4I B;  4O4H B;  4JTD B;  1MSW D;  4FZ0 A;  3ZBH A;  2GHY A;  3MD0 A;  3SPH A;  5B1B C;  4ZHQ B;  4K8X A;  2WWW A;  5KA6 A;  1SRY A;  1RPR A;  1Z5V A;  3T1C A;  1Q6I A;  5B5E Z;  4E4E A;  1ZSP A;  5IY5 C;  4FPP A;  3JAL B;  2OIE A;  1EM1 A;  4BIZ A;  3AG2 C;  1K9M W;  2ZKO A;  3ETG A;  4FK5 C;  4DV6 O;  3T1Y O;  3IJ4 A;  3T1H O;  3IAY A;  3UO3 A;  3HKB A;  3A0B Z;  4JYA O;  1VQM V;  2AHY A;  4X1I B;  3PN1 A;  3ZHS A;  5GON B;  1M57 B;  1VF7 A;  1I08 A;  1S5H C;  2FKX A;  4J42 A;  1L0N H;  3JAW A;  3OR6 C;  2F93 B;  2ITD C;  2ZE7 A;  4E2L A;  3APO A;  1GM8 A;  1YTF D;  2XND G;  4JZ2 A;  1U97 A;  2P5O A;  2L6L A;  4JI5 B;  5A9G A;  4RAI A;  3RYH A;  2B1I A;  1WB8 A;  3TGU H;  4UV9 A;  4WBN A;  1N34 B;  2Y48 A;  3IC9 A;  4O4L A;  2A79 B;  1LUV A;  4BW5 A;  4JI0 B;  4FLT A;  4FLY A;  1YDX A;  4D7S A;  2PYL A;  2YIA A;  4X1Y A;  2C2A A;  4HBN A;  1PL4 A;  5GTH Z;  3DXR A;  1AP6 A;  1TAE A;  2JGD A;  4LF8 B;  1VQ8 V;  4LC1 A;  1IX9 A;  1H38 A;  5LGU A;  1BCC H;  3ZRW A;  5B3S C;  4NTX A;  2IH3 C;  3EFF K;  1XMO O;  3RVZ A;  1AVM A;  3LSU A;  3SPG A;  1GN4 A;  4HNA A;  2ZR3 A;  4ZI7 B;  1Y76 A;  2DYS B;  3LNN A;  2V4D A;  4I9Q A;  4JAA A;  3CCQ V;  2EBO A;  5KHJ A;  4GKK O;  2PZS A;  4MW8 A;  5C8Y A;  4KXR A;  2QE7 G;  1SQB H;  1N33 B;  1F23 A;  2FL4 A;  3MAQ A;  4YHH B;  2OWO A;  1YF2 A;  5H2F Z;  1N36 O;  2LGQ A;  4HYO A;  2GDS A;  2LFR A;  2W0X A;  1K4C C;  3I55 V;  1Y74 B;  3AG4 C;  4X66 O;  1FAF A;  4DXW A;  1P7G A;  2CH7 A;  4ZIB A;  1TUE B;  1H2L A;  2HR3 A;  2QKC A;  1EZJ A;  5CB4 A;  2UUA B;  1IBK O;  1M56 C;  4TV9 B;  3H1K H;  4W4K A;  1WNS A;  2A06 H;  5ITZ B;  5EYP A;  4AIL C;  3HKC A;  4PD4 F;  2Y4T A;  5LL6 Y;  1RM1 C;  4B08 A;  4EB6 A;  1FXH A;  4EEQ A;  2M7W A;  2ZE5 A;  5CA3 A;  1Y66 A;  2EIJ C;  2ZD9 A;  1G1X B;  2BOB C;  4I50 B;  2YEV B;  2QWR B;  4QE7 A;  5LOV A;  1BSM A;  1JFF A;  2AXT Z;  1HR0 O;  1S3J A;  5KMG B;  4MTG A;  2WPD G;  3CCL V;  4KL1 A;  3WB0 A;  1IZ3 A;  2N04 A;  1V55 C;  3E8G A;  3E35 A;  3CCE V;  2QSA A;  4XDK A;  5EZY B;  4CBC A;  1U96 A;  1FXK B;  2CAZ C;  2O57 A;  1PV0 A;  1TUB A;  1OV9 A;  5EC2 C;  3CRA A;  3ZHR A;  1Q86 W;  3JCZ A;  1SC5 B;  1XL4 A;  2QM7 A;  1YI2 V;  1ZUQ A;  3CJH B;  2Q7G A;  3SR2 C;  1E1R G;  2JDI G;  3BHP A;  2RQ6 A;  1F51 A;  3UQ8 A;  2ZNI A;  4A5U B;  2ZE8 A;  4X65 B;  1JX9 A;  3J7A U;  4PDV A;  4U3F H;  2IJJ A;  1P84 F;  1KQS U;  3H9V A;  1AIL A;  2A0L A;  3D8C A;  3GWK C;  2XHB A;  1E79 G;  4B3S B;  3D3Q A;  4MVR A;  3R65 A;  2ITC C;  2Q5Z A;  4LWS B;  1BE3 H;  2HG5 C;  4GX0 A;  1HDJ A;  3H1H H;  3G6E V;  1H2S B;  1OZ0 A;  4YJ3 A;  1DTO A;  4DV4 O;  4LFC B;  1XNQ O;  1PD3 A;  2QM8 A;  4YY3 O;  1S5L Z;  1OJH A;  5J2U B;  4LCU C;  4CS4 A;  3WFV A;  2OT5 A;  2WLM A;  3D3I A;  5IY5 B;  1OCC C;  4L87 A;  1WN7 A;  1OCR B;  4IYH A;  2V1D A;  5KA5 A;  5EBM C;  3F7V C;  4KHP O;  4ABM A;  3OM3 B;  1DGS A;  3OTO O;  4JYY A;  3B2E E;  3K5L A;  2YXL A;  2EIN B;  3N2G A;  3AEI A;  4DR5 B;  4DV7 O;  4AHC A;  2ZCE A;  3QG5 A;  5KLV H;  2UXX A;  4LNU B;  1JVM A;  1M9N A;  3FB8 C;  3C90 A;  1VQO V;  1M57 C;  3CE2 A;  1BL8 A;  1EN6 A;  1XHX A;  4X20 B;  3RVY A;  3S3W A;  4JPR A;  2Q8V A;  2HJD A;  3SYA A;  3ZS8 C;  1XQ8 A;  4I4T A;  3A0R A;  5TIS Z;  4JI1 B;  3H1I H;  4X1K A;  3JAR B;  1K73 W;  3OT7 A;  4GT1 A;  2JJ2 G;  2YUA A;  1WPX A;  5LMU B;  1SET A;  3ASN B;  1DF5 A;  4RO2 A;  1YIT V;  2OCC B;  4OPH A;  4L8J A;  1WP8 A;  4J10 A;  4DV1 O;  1SQX H;  1Q6U A;  2KG7 A;  4PA6 A;  2ATK C;  2WA4 A;  4LFA B;  3FD9 A;  1K7D A;  3F5W C;  4YXW G;  1GM7 A;  1OCO C;  1KP3 A;  2DN9 A;  3OFN G;  2WAM A;  4I7Z B;  3JAT B;  3ETQ A;  2Z3Y A;  5KAI Z;  5IYB O;  5K1P A;  1WPB A;  2HHH B;  2JIZ G;  1AI5 A;  1XL6 A;  1Q81 W;  4O2A A;  3IC7 A;  4ZOL A;  3DC5 A;  4O4J B;  5CA1 A;  4JI8 B;  3X2Q B;  4J9Y B;  5JJJ B;  3UM7 A;  5B66 Z;  1IXM A;  3CYO A;  1KD1 W;  3CRQ A;  1VF6 A;  2UU9 O;  4Z2W A;  2QKS A;  1VEW A;  1V54 B;  3E22 A;  4JAS A;  4B3R O;  3RYC B;  2ZDI C;  2HP8 A;  3ZRV A;  2DYS C;  1ZX3 A;  4JGS A;  2YI9 A;  4CS3 A;  1OHH G;  2XAF A;  3LDC A;  2HLD G;  4X64 O;  3LNM B;  5B1A B;  2ZM6 O;  3H01 A;  3MHH C;  1K4D C;  4JV5 O;  1MA1 A;  3TK1 A;  4MVM A;  2QWQ B;  1HW7 A;  4YY3 B;  2K1E A;  5LBQ A;  1KKD A;  4N23 A;  1IBL B;  1V9P A;  2VQE B;  3U10 A;  1QHT A;  4GX1 A;  4DUY B;  3JD2 A;  1GO3 F;  1YXB A;  4PA3 A;  3OD4 A;  1J5E B;  1FJG B;  2X6C A;  4UFZ A;  3L75 H;  5LA6 A;  4JI6 B;  1NTK H;  1KYO F;  1M56 B;  1UFI A;  3HKB B;  1QLE B;  5IYD O;  2ZXW B;  4CH3 A;  3L73 H;  4D6T H;  3D36 C;  2D2C B;  4TQD A;  4GLX A;  3K5O A;  4OX9 B;  1W2B U;  5IJ9 A;  3U11 A;  3JAW B;  5L3B A;  1F4N A;  3BEH A;  3SYP A;  4PEL A;  1VQL V;  2A3Q A;  3EXA A;  3C3T A;  5JH7 A;  4JYC A;  1N0J A;  3ZJZ A;  2QTS A;  4F6E A;  5BR8 B;  1KEC A;  4B7E A;  1RPO A;  1WA8 A;  5L3F A;  3HPL C;  1GAX A;  4DW1 A;  4WBN B;  1HNZ B;  5H6R A;  4JI5 O;  1O9H A;  3UCS C;  1FXK C;  4DV2 B;  1XIL A;  1ZAU A;  4BIO A;  3BFR A;  4O4L B;  3HKE A;  2YIB A;  4DV0 B;  2X6B A;  4P9P A;  3CCS V;  4X1Y B;  2F95 B;  4K3A A;  4DR7 B;  5E1A C;  1NBM G;  2Q9L A;  2R9I A;  2N74 A;  2Y0I A;  3FYE B;  4J7Z A;  3ZHV A;  3DXR B;  4ASU G;  4JI0 O;  3H1L H;  3GWO A;  4FLZ A;  2UXB B;  4BAY A;  1P4R A;  3CPW U;  4DR1 B;  3ZRW B;  4XDJ A;  4B3T B;  4J7K A;  2H3O A;  1FD9 A;  1JA8 A;  4LF5 O;  2QKA A;  1KC8 W;  2JS5 A;  1ARO P;  5A2Q N;  4HNA B;  1QLN A;  1Z5W A;  3E8H A;  2EZO A;  1N0N A;  3CWB H;  3B8N A;  3ABL B;  2IJI A;  4LF8 O;  1JPX A;  4TT3 G;  5C8Y B;  5L3G A;  2LJ2 A;  1LUW A;  3BRC A;  1I7F A;  2VWK A;  4CH4 A;  1J95 A;  4DK0 A;  4JAU A;  5HFM A;  3P3P A;  4XBF A;  2FTK A;  1N33 O;  3ABU A;  1Q3E A;  1YJW V;  1KB9 F;  1H2N A;  4YHH O;  4UB6 Z;  2BOC C;  3WB2 A;  2CTQ A;  2CH7 B;  4DR2 B;  2EIM B;  1EN5 A;  1FFX A;  4DV3 B;  5CB4 B;  2W6J G;  2XTA A;  1OCR C;  2YIB D;  1B3Q A;  4DYL A;  5DM6 V;  1OCC B;  5EYP B;  3K06 A;  5EC1 C;  2IJK A;  3ETD A;  3HKC B;  1EZV H;  2EIN C;  1I5X A;  2LQT A;  5KX5 A;  2UUA O;  1XOU A;  4JI7 B;  2F23 A;  1GTO A;  2BTO A;  1URF A;  4EB6 B;  3CP1 A;  2ODM A;  3L9D A;  3LDE A;  2XUM A;  3J81 N;  2M6Y A;  1IXB A;  4UCV A;  1GK9 A;  4QPK A;  5JQG A;  3HKD B;  5JCO C;  4X88 A;  3FB5 C;  3P3N A;  1FYJ A;  2ZNJ A;  3AG7 A;  5LOV B;  1JFF B;  2BE3 A;  2Y0P A;  2CGN A;  4FM0 A;  5IYC O;  4WFB V;  3ASN C;  5B1N A;  2OCC C;  2JJ1 G;  4GCZ A;  2GV9 A;  3UT5 A;  3ZED A;  4GKJ O;  5BMV A;  1R3L C;  1O9G A;  2ZIN A;  1YJN V;  1NR7 A;  1US6 A;  2MK3 A;  2Z5U A;  3VOU A;  5FNV B;  1TUB B;  2AZ0 A;  1AJN A;  2AHZ A;  2GTA A;  2QGN A;  1OCO B;  3CRR A;  1PKX A;  1THZ A;  2DOS A;  2IJH A;  3OMI B;  2DWD C;  1RSO A;  2EIL B;  2UUB B;  3OTF A;  3KCY A;  4DUZ B;  1HP8 A;  4CH5 A;  3B09 A;  3X2Q C;  4LF5 B;  2YIC A;  4DR3 B;  4PI0 A;  1QVG U;  1OCZ B;  4PA4 A;  3SPI A;  2F1M A;  1SKV A;  4GUN A;  1V54 C;  3HB3 B;  2PI5 A;  3LSQ A;  5K1X A;  4X65 O;  5JJN B;  4IIJ B;  1G4Y B;  4PHZ A;  2DMX A;  5B1A C;  2LGW A;  3K08 A;  3SYC A;  5E79 Z;  3K0G A;  1KU9 A;  5EK0 A;  2QM4 A;  1NTZ H;  2NNU A;  4YJ3 B;  3CCV V;  2E5L B;  2XOK G;  4FM1 A;  1MOF A;  1B06 A;  4B3S O;  5KAF Z;  1P7B A;  3R66 A;  3S3X A;  1JJ2 U;  4K0K B;  2XT9 A;  1R6N A;  3JAS A;  2K9P A;  5IWA B;  2UXD B;  3ZRS A;  3C3S A;  5CBF A;  4LFC O;  2YXH A;  2NLJ C;  4UVB A;  4OXS A;  4LFB B;  1K5S A;  1NI8 A;  3ZX6 A;  3ML0 A;  3N2G B;  1QLE C;  3ABT A;  4MTF A;  1XI1 A;  2ZXW C;  4PI2 A;  2E74 B;  2OTJ V;  3K5M A;  4W4L A;  1AB3 A;  2ZQM A;  2YID A;  5CMU A;  2JEX A;  4PDL A;  3VQV A;  4LF9 B;  3O9O A;  3CEI A;  4DR5 O;  1NT2 B;  3G80 A;  1NZ6 A;  1YJ9 V;  4EFB A;  3L72 H;  4UCU A;  4TUY A;  3LSS A;  1L1F A;  4IT5 A;  4GKJ B;  1H2M A;  1S0V A;  1S77 D;  2Q73 A;  4QPJ A;  4Z1V A;  4NTW A;  4DR4 B;  5LP6 A;  4TQF A;  1CP9 A;  4GX2 A;  4JI1 O;  4RUF A;  1KBH A;  2P4V A;  1D5A A;  3SPJ A;  2KG7 B;  1YCI A;  5LMU O;  2AGA A;  2QWP B;  1GN3 A;  1XRE A;  3N2K A;  5LMN B;  3CXC U;  2CE4 A;  2ADQ B;  3WG7 B;  4DR6 B;  4ZBM A;  2VWJ A;  2OTL V;  5J2T A;  1CEZ A;  2Z0A A;  4LFA O;  4O2A B;  2QA4 V;  4ZOL B;  4J7J A;  3L70 H;  5CA1 B;  3CCJ V;  2HHH O;  1BZK A;  2CDY A;  3QTC A;  3E22 B;  4JI8 O;  4LR3 A;  1MZE A;  1JMK C;  1SES A;  1RP3 B;  3ABL C;  4BW9 A;  1K97 A;  4K8Z A;  1NKD A;  4LF6 B;  2DQ0 A;  4UCS A;  4R8C A;  4MVZ A;  3T4D A;  3BY6 A;  1JCH A;  4IGG A;  1W59 A;  3FFQ A;  3CCR V;  2OYQ A;  5KUM A;  4D7T A;  4UB8 Z;  4NR1 A;  2JK5 C;  3CCM V;  2NR5 A;  1K5Q A;  3M7M X;  2EIM C;  1L8D A;  1PNK A;  2QWN B;  3OEH G;  1IBL O;  5GW7 A;  2VQE O;  5BZB A;  1HNX B;  3BVO A;  5FL7 G;  1GN6 A;  4DUY O;  3Q4H B;  4LBE C;  4Q6G A;  2F4V B;  1J5E O;  1Q7Y W;  5D5Q A;  1SQV H;  1FJG O;  4JI6 O;  3WU2 Z;  5IJ9 B;  5CA0 B;  4IHJ A;  5DN6 G;  4I0X B;  1SZX A;  2HKO A;  2LO1 A;  4WFG A;  5LYJ A;  3AK1 A;  4LH6 A;  4LF7 B;  1WB7 A;  1XUQ A;  1LNQ A;  5FPR A;  5JH7 B;  2BTQ A;  2PGG A;  1M5I A;  4WFF A;  4KFM A;  4OX9 O;  3G67 A;  3SYQ A;  5LGT A;  1ROP A;  4B3M B;  4JTA B;  3LUT B;  1GM9 A;  2BSK A;  1H2K A;  3AG1 B;  1QR8 A;  4MVS A;  1SA0 A;  3ZN1 A;  2AZ2 A;  1R73 A;  2CTR A;  2IBZ H;  4Z1M G;  1X59 A;  2FB5 A;  1TVK A;  3JD4 A;  4WFA V;  3A0H Z;  4F6R A;  5BR8 O;  1SF9 A;  1AR1 B;  5L3C A;  2ETN A;  3RBZ A;  3HKE B;  2EJR A;  1R3J C;  1JQ0 A;  3AK2 A;  3B40 A;  4CH6 A;  2EIL C;  2JRI A;  4WFH A;  1HNZ O;  4DV2 O;  1JJO A;  4FLU A;  3E8B A;  4NVP A;  1Q90 D;  4DV0 O;  1YIJ V;  3K5N A;  4GZR B;  3K57 A;  3RW0 A;  3ZCC A;  4UCT A;  1K8A W;  3K58 A;  4JZG A;  5EZY A;  4DR7 O;  1OCZ C;  4J9Z B;  2L35 A;  3SYO A;  4PDR A;  4FLW A;  1Y67 A;  2UXB O;  5EIB D;  4DR1 O;  1VP7 A;  2IH1 C;  4B3T O;  2OCH A;  1YTF B;  1JR9 A;  3UKM A;  1H8E G;  2W6I G;  2Q7H A;  4MTX A;  2DYR B;  2R70 A;  1S5J A;  1D5N A;  1LR1 A;  1G8M A;  5H6Q A;  4H13 B;  2F66 C;  1MNG A;  2KSD A;  1Q43 A;  2HVK C;  1PNM A;  1FFX B;  2IW5 A;  1Y4M A;  4JI2 B;  1FS0 G;  1YVW A;  1H2G A;  5CBH A;  2Q69 A;  4NYK A;  3G71 V;  4DR2 O;  4DV3 O;  4LP8 A;  1M90 W;  1ZL8 A;  5KX5 B;  4JI4 B;  1XNR B;  1AI7 A;  2VQF B;  3J80 N;  2P67 A;  1AP5 A;  1VQP V;  1XHZ A;  5JWP A;  4NTY A;  4I9W A;  2JEU A;  1ENV A;  2QJ1 A;  4DK1 A;  2WLL A;  4JI7 O;  1NVP D;  4FFK A;  3RN4 A;  1WP7 A;  3CX5 F;  1N32 B;  3ICX A;  2ARH A;  2QR4 A;  1H8H G;  1HNW B;  3ASO B;  2R9A A;  3NR7 A;  3QO7 A;  3ZMU A;  1GRJ A;  5BMV B;  1I94 B;  2CGO A;  3RYH B;  3OMA B;  2JS3 A;  3O65 A;  1GN2 A;  2XAH A;  4TV8 A;  3ZRX A;  2CUG A;  3WG7 C;  3K9S A;  5JJE B;  2EJ7 A;  3DTU B;  2OIG A;  1RSO B;  2P22 C;  5LXT A;  3T4Z A;  4OGQ B;  1WAZ A;  3E89 A;  3OMN B;  3W7X A;  1R3I C;  5EBL C;  2Y69 B;  4MVQ A;  2ZIO A;  2WLJ A;  1D2D A;  2IU0 A;  3FAV A;  4JYB A;  3G4S V;  3E8F A;  4U7N A;  3OAA G;  1B04 A;  4CC6 A;  2UUB O;  5IT9 N;  3K0D A;  2JGD B;  3N27 A;  3RT3 C;  4DUZ O;  5J9P C;  1IBM B;  1VF6 C;  3P30 A;  1NH2 D;  2QDO A;  3F5T A;  2HVJ C;  2VRZ A;  3B8M A;  4KP4 A;  3G6B A;  4DR3 O;  4UCR A;  3ZMV A;  1Y76 B;  1P49 A;  4NKG B;  2GTS A;  1AR4 A;  4RQF A;  3E83 A;  1DLB A;  1GKF A;  1XBL A;  1Z2G A;  3F7Y C;  5DEC A;  3TXS A;  3CC4 V;  1K92 A;  2X7R B;  3TET A;  1GH6 A;  4UUJ C;  3RYF A;  1M4U A;  1AR5 A;  1FKA O;  2P7T C;  4O2B A;  4RQE A;  3UO2 A;  2YS8 A;  3JAS B;  2R9R B;  3EHB B;  2Q0O C;  4AQY B;  1QNM A;  1Y6X A;  2E5L O;  1MZF A;  1RFY A;  2PTM A;  1K3E A;  2UXC B;  4MTO A;  2JGU A;  4K0K O;  1XDC A;  4NXM B;  2X6A A;  2EZP A;  5IWA O;  2UXD O;  4UXN A;  2BCC H;  5IJ0 A;  3IGA C;  4LF4 B;  1QVF U;  4LFB O;  4YJ2 A;  2P06 A;  4MVO A;  1WJZ A;  2CTW A;  4FM2 A;  4DV5 B;  1KUQ A;  3ETE A;  3CME V;  3M99 B;  3W7U A;  4FLX A;  5KHK A;  1UPG A;  4X9Q A;  3SPC A;  4K35 A;  2KB1 A;  4TUY B;  4LF9 O;  2GSM B;  2ZIM A;  3QVN A;  2N05 A;  4RWU A;  3ZIA G;  2DE0 X;  5LP6 B;  3AG1 C;  2IM9 A;  3JD1 A;  2A9H A;  5F2V O;  4I55 A;  1UJW B;  4IL6 Z;  2ADP A;  1Q8I A;  4FFB A;  2LW1 A;  1VAR A;  5FPO A;  3N2K B;  3PJS K;  4U3J A;  2Q0A A;  3CCU V;  3JYC A;  1TGO A;  4DR4 O;  2E75 B;  4UCO A;  1SQQ H;  4R6Z A;  1F7Y A;  5J2T B;  4X62 B;  2GUZ A;  1QBZ A;  3GVM A;  5LMN O;  1K34 A;  3THO A;  4DR6 O;  4NB5 A;  2RMK B;  3B77 A;  4KUM A;  3STZ C;  1XMQ B;  1EN4 A;  2W0F C;  3RYI A;  3DGE A;  1YHQ V;  4R7C A;  1SQF A;  1SQG A;  3VQW A;  2WA3 A;  2ILM A;  1KMI Z;  1VQ6 V;  1A32 A;  4NXN B;  3CC2 V;  3OR7 C;  3OW2 U;  2Q4P A;  3W7S A;  3CHX A;  3TXQ A;  4R50 A;  5IE9 A;  3B4S A;  2B9Z A;  3K59 A;  4P2Z A;  4DW0 A;  1SQP H;  3T2M A;  1JOY A;  4FZ1 A;  2UUC B;  4FIP C;  3BA8 A;  1X4T A;  2X0L A;  4H44 B;  2DYR C;  4DRX A;  3CD6 V;  2ZE6 A;  3AG3 C;  1E1Q G;  3RGB A;  1QQC A;  2LW7 A;  4LF6 O;  5JVD A;  4B7K A;  5IYZ A;  3KKY A;  4JTC B;  1YEW A;  4PJ0 Z;  2YI8 A;  3FB7 C;  3AK3 A;  1COW G;  4AI8 A;  3FYI B;  1TA8 A;  1ZTE A;  3JAK A;  2RDC A;  4CS2 A;  3FX7 A;  4YIP A;  2WLI A;  4O4I A;  2YDE A;  4O4H A;  1YSC A;  3BPZ A;  1SZT A;  1AJQ A;  2H94 A;  4ZHQ A;  3W7T A;  1NQT A;  4N21 A;  2EIK B;  1HNX O;  1I5Y A;  3U0Z A;  2DQ3 A;  4IHJ B;  1NJI W;  2PYJ A;  2ZR2 A;  5LYJ B;  3ABM B;  2F4V O;  4DV6 B;  4G28 B;  3T1Y B;  3LDD A;  3P32 A;  2BTQ B;  4GX5 A;  4Q20 A;  3T1H B;  1S76 D;  3M8A A;  3JAL A;  1NTM H;  1MSD A;  2Q6A A;  1W0J G;  2KQX A;  4I4T B;  2DW4 A;  1M1K W;  4X1K B;  4UVC A;  1IVS A;  4JYA B;  2PF4 E;  2QWO B;  4WF9 V;  2BSK B;  4LF7 O;  3ASO C;  3JSN A;  1SA0 B;  4H33 A;  4WFE A;  1MG1 A;  1EFR G;  1R6K A;  5EBW C;  1PM9 A;  1TVK B;  3MDS A;  3MHS C;  3FB6 C;  4B3M O;  3K03 A;  5DED A;  3DC6 A;  4X1I A;  4F6R B;  3OGC C;  1BQ0 A;  3CXH F;  5GON A;  2B1G A;  1NR1 A;  4HZ3 A;  3HKD A;  1FXV A;  5LGN A;  5FLX N;  2UXN A;  2LFS A;  3OUS A;  2HFE C;  1BGY H;  4YIO A;  2DWE C;  5AG2 A;  2H8P C;  2KKW A;  1NS1 A;  2DJV A;  2Y69 C;  2MW2 B;  3JSL A;  4J80 A;  2Q7E A;  2RNB A;  2YSU B;  2HJF C;  2E3C A;  1IDS A;  5BXZ A;  4EKW A;  4IYI A; 
#chains in the Genus database with same CATH homology
 1NTM H;  2BCC H;  1L0L H;  2IBZ H;  1NTZ H;  3L72 H;  3H1K H;  1SQX H;  3CWB H;  1NU1 H;  1BCC H;  3L71 H;  1KB9 F;  2A06 H;  3TGU H;  3BCC H;  3L74 H;  1BE3 H;  4PD4 F;  3H1I H;  3H1H H;  3L75 H;  1BGY H;  1SQP H;  3H1L H;  1PP9 H;  3CX5 F;  1NTK H;  1KYO F;  1SQV H;  1L0N H;  1PPJ H;  3L73 H;  3H1J H;  3L70 H;  5KLV H;  4U3F H;  1SQQ H;  3CXH F;  2FYU H;  1SQB H;  1P84 F;  1EZV H;  4D6T H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...