2IBZH

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2ibzH00
3L71H 1SQBH 3CX5F 3H1HH 4U3FH 1BGYH 3L74H 1EZVH 1SQVH 2IBZH 3BCCH 3TGUH 1KB9F 3H1JH 1KYOF 1NTKH 1PP9H 1BE3H 1L0NH 1SQPH 2BCCH 3H1IH 3L70H 1BCCH 4PD4F 1L0LH 1NU1H 1NTMH 3CXHF 1PPJH 4D6TH 1SQXH 1SQQH 2FYUH 3L72H 3H1LH 2A06H 1NTZH 1P84F 3L75H 3CWBH 3H1KH 5KLVH 3L73H
chains in the Genus database with same CATH superfamily
2ZQMA 1PNKA 3JARB 3GWOA 2UXXA 2Q67A 5J2UB 4UV8A 2WWWA 5KX5A 4PA7A 1XMQB 4B3TB 2WLLA 3IC9A 1WB8A 2R9IA 1M4UA 5L3CA 2WA4A 3FB8C 4X66B 4I50B 3OE7G 3E22A 1NVPB 3L73H 2QWRB 2E76B 2UUBB 3CPWU 3QTCA 4I4TB 4TUYB 1R3LC 3BA9A 4CH6A 4WFGA 5DEDA 5J2TB 1FXVA 4FVMA 3DXRB 2UXCB 2YIBA 1OZ0A 3JATB 5A9GA 2ZINA 2QWQB 1JQ0A 3RT3C 1Y66A 4LF4B 1XHXA 2QWOB 5LGUA 3IFXA 5KLVH 4X20A 3JASA 1MNGA 3K0DA 3H9VA 1FKAO 5KAIZ 4GX2A 2YS8A 3HKEA 3GB7C 4LR3A 3CCJV 4X1IB 2XTAA 3JD2A 2KSDA 4DR3B 3CE2A 3K03A 1SC5B 5LHGA 3CRRA 3O9OA 1YHQV 1XNQO 2UXBO 4DV4B 1QBZA 4JASA 4X1YA 4RQEA 1XMOB 5GONB 3S3WA 3QNEA 4BR6A 1N36B 4CS4A 4O4IB 5H9CA 3K04A 4JV5O 5IDJA 4AHCA 4MTGA 4JI5B 2WLNA 4CH3A 4YJ2B 4F6EA 5B1NA 1Q6IA 1JOYA 5LBQA 1XMQO 4ASUG 2YICA 1BZKA 1Y76A 3F5WC 2Y4TA 2HG5C 4NR1A 5DM6V 2JK5C 4ZBMA 2IH3C 3HKDA 4X88A 1HNXB 5CA1A 2BTQB 4O4LA 4DYLA 1ZTEA 3AK3A 3AEIA 1R6KA 2LP7A 1WP8A 1QHTA 4MW8A 4ZKIA 1VF6A 1GTOA 1GM7A 2P4VA 1F4NA 1GN3A 1YTFD 1EZJA 2ZR3A 4PA6A 2P06A 3JAKA 3BPZA 2X6BA 1VQPV 4FK5C 4TV8A 2WLIA 1AI6A 1CEZA 2RQ6A 4B7EA 4MVRA 3CXCU 4X66O 5H2FZ 1VF5B 2A0LA 1W0KG 2Q4PA 1VP7A 1KMIZ 3CEIA 2IJIA 2W0XA 1QQCA 1TUBB 1FXHA 2V4DA 2YXHA 4LFAO 3K06A 3HKCA 1MMMA 5EZYA 3QO8A 4JGSA 2YUAA 5TISZ 3RYHA 3ZN1A 2QM7A 4JI7B 3B8NA 1KP3A 4QGPA 2GUZA 3D3QA 2JVDA 1UJWB 3SPJA 1YF2A 2FTKA 1EM1A 1AR5A 3MDSA 1H2GA 3AG3C 4H44B 4K8ZA 2BE3A 3JALA 1THZA 2IJHA 5FPOA 2P7TC 1VQOV 2Q8VA 4GX5A 4MTOA 3VQWA 2D3OW 4JI4O 2E75B 3OT7A 1GN4A 3L71H 5KHJA 3T2MA 3FKSG 1JX9A 1K33A 4KP4A 2NN4A 1Q6HA 1K3EA 5KUMA 5J2UA 1HDJA 4X62O 4I0XB 1YTFB 4FFKA 4NXNB 5CA3A 3L72H 4TT3G 1GAXA 2QM8A 3RVZA 4QE9A 3ZHQA 2QSAA 5LOVA 4BIOA 4QJFB 3AG2B 5C93A 2PZSA 1KYOF 4YIOA 2F4VO 2FKXA 2KG7B 1SQPH 4TV9A 1XI1A 2ZDIA 2Z3YA 2YIDA 4WCEV 3P3PA 5J2TA 2Z0AA 4DR4B 4O2BB 3VOUA 1ZWIC 1VQ6V 3CCRV 4J80A 4MTXA 1K5QA 3SR2C 4X1KA 1YXBA 4XDJA 3ABTA 1SQVH 2P67A 4JI0O 3GWKC 1NTKH 1WPBA 5IWAB 1AJNA 1SKVA 2WLJA 1JA8A 4PA3A 3OMIB 4CH5A 2PTMA 1FXKB 2OCHA 3OUSA 3C90A 3CWBH 2OCCC 2UUCO 3U10A 3OM3B 5EBLC 4JI2B 4IT5A 2ADPA 3G6BA 2ZXWB 4DR3O 2XNDG 1HNZB 4DR2O 5LP6A 4R50A 3ZRWA 2IJJA 1NJIW 5KHIA 2LW7A 1XMOO 4DV1B 4NTWA 2ZE8A 2QKSA 3CCMV 1YIJV 3FB7C 1TVKA 3DC5A 5JH7A 2F95B 2HEPA 1HWYA 3NR7A 4J42A 4O4HB 1KKDA 2P6JA 4FLYA 2HVJC 5FL7G 1ZLZA 1RSOA 4CS3A 4UVAA 2PUSA 2GTAA 2ZM6O 2YEVB 4GZRB 1PL0A 5B1BB 3RFRA 2JGDB 5IY5C 4ZOLA 4Z1MG 3FB5C 2ZNJA 3OEHG 3OD4A 2F23A 1N36O 1R6TA 3E35A 5AG2A 1I94B 1GM9A 4H37A 1OCZC 3ABKC 3AG4C 2ZNIA 1Y67A 3UKMA 1QNMA 2HLDG 4PI2A 3ZMZA 4IYIA 4GX0A 1B3QA 1P49A 5B1AC 3CRCA 2IJKA 2N05A 4B3SO 4UVBA 2XASA 2PI5A 4A5UB 1YEWA 1WN7A 2EJRA 2GUZB 1OCCC 3CRQA 3K57A 4B3TO 1WAZA 4LF8O 2XAHA 1VQLV 4D6TH 4LCUC 4FZ1A 1N8RW 4PDVA 2ADQB 3BVOA 1FXKC 4LFAB 1NQTA 2Q6AA 1COWG 3UCSC 2WAMA 2F1MA 2EIJC 4EFBA 5LYJB 2PY5A 3KZIZ 3VQXA 3OFNG 4PV1B 4Z2WA 4NXNO 4JI8O 1W2BU 1M5IA 2UUCB 2ODMA 4ZHQB 3RYFB 1VEWA 1IVSA 3TXSA 3OMAB 4O4JA 4I7ZB 3ZMVA 4GX1A 1H8EG 3K9AA 3P30A 3E8FA 1URFA 4UB8Z 1O9GA 5ITZA 4G27B 2IW5A 2V1DA 1KQSU 1LUVA 3E8BA 3F7YC 2Q9LA 4DV1O 4ABMA 1XEQA 1NR7A 4JTCB 1Z5WA 1L0LH 2YIBD 1X59A 1I7FA 1JJOA 2PF4E 1PPJH 5CN0A 2R70A 5BXZA 3ZBHA 2OIEA 3K5LA 4EEQA 2PYJA 3OGIB 4X89A 3RVYA 3CRMA 3N27A 2FB5A 1S5JA 2K9PA 1T5EA 5GW7A 1U96A 4IL6Z 1OHHG 4FIPC 4L87A 4NB5A 4LF9O 2ITCC 3THOA 2DWEC 4DR4O 1KUQA 1D5AA 3S3XA 3CCVV 2CGNA 2A3QA 4U3JA 3ABKB 3AG4B 4WFHA 3BHPA 1FXKA 3ZN0A 1G8MA 3LDDA 1J5EO 1BQ0A 1FS0G 3A2FA 4FZ0A 2X6CA 3HKDB 4JYAO 3DTUB 2KQXA 1XNRO 1S5LZ 1OCCB 1IURA 4ZI7A 3CYOA 4J11A 4YIPA 3E89A 2VQFB 1JFFA 4DK0A 2AHYA 1VQ4V 2A06H 4JTDB 4B08A 3K58A 4P9OA 4OGQB 1FFXB 3L74H 3FD9A 1AI4A 3RWRD 3SDLA 5B3SC 1S0VA 1W59A 1EN6A 2VQEO 2ZM6B 4NTXA 4B3RO 4DK1A 4O4HA 3M99B 1AR1B 4LF6O 2BSKA 2NR5A 2XAQA 1RSOB 5KHGA 2Z5UA 2Q7GA 2YEVA 3RYHB 2OTJV 5JJNB 2Y69B 1SF9A 1ENVA 2AGAA 1P7BA 5IYBO 1VIBA 3Q4HB 3OTOB 1JJ2U 2ZE5A 1FAFA 1UFIA 1N34O 2VRZA 2IU3A 4JI4B 4JI6O 3CX5F 1J5EB 2RN9A 4WBNB 1V55C 3ETEA 1VQMV 2QM4A 4HBNA 2OYQA 4KHPB 1E79G 3ASOC 5E79Z 4XBFA 1KECA 5CBFA 3HPLC 3A0HZ 2Y69C 4UFZA 5BY1A 3CC2V 1J95A 3UO3A 3I5DA 3ZX6A 4HYOA 2UXNA 4MVMA 1SZXA 5LMUB 1VQ8V 3RGBA 4EFEA 2CTRA 4PDRA 1IBKO 2DOSA 3RYIB 3D36A 4J41A 3QVNA 4E2LA 2KB1A 5CA0A 4GUNA 2KG7A 1K92A 4JYAB 2L6LA 3PJSK 4B3RB 4YHHB 3ZIAG 2Y4UA 2IU0A 1KKCA 2CTQA 4MTFA 3K9SA 2PGGA 1VQ7V 2QA4V 1TGOA 1SRYA 3NXSA 2HHHB 4FLZA 3ZHRA 5ITZB 4JI8B 1AJPA 3G71V 1V9PA 1GO3F 3AG1C 1F23A 2VWKA 1NU1H 3LSQA 1NS1A 1Y74A 1K73W 5JQGA 2A9HA 4TUYA 3AG2C 1YJ9V 1IZ3A 5L3FA 3H1KH 4GT1A 2CH7A 1RFYA 2OTLV 4LFCB 2ZKOA 4EKWA 2GBOA 4MVZA 2Q7HA 2YXYA 3T4ZA 5JVDB 4J10A 3JD3A 4X65B 3K5NA 4DR6B 3OR6C 1Q6UA 1CP9A 5IYZA 3JASB 1SETA 4MVQA 3KCYA 4JI3B 2VWJA 4IHJA 2HKOA 1A32A 1VQNV 4YY3O 1HP8A 2E74B 4BWAA 1TVKB 1AP6A 5JH7B 5JJJB 4B3SB 2OIGA 1BHBA 2ILMA 1AB3A 3HKBB 4JI7O 1F7YA 4C7UA 5D5PA 1XNQB 4IIJA 2DYRC 2CTWA 4WFAV 4FMTA 5IT9N 5BMVA 1XILA 5IJ0B 5LMUO 1TA8A 3SPGA 2JJ2G 5HFMA 5EC1C 2QGNA 1AJQA 2BTQA 4D7SA 1YJWV 3ZMUA 4BW5A 3TXQA 1IX9A 3FX7A 3O65A 5EC2C 3D3IA 4TOIA 3OMNB 5K1PA 1EFRG 3IJ4A 3MD0A 2YXLA 2BSKB 2YI9A 1WJZA 3MAQA 1M56C 1FD9A 3RW0A 3BRCA 3T1HB 1RM1C 3FAVA 5LXTA 3JCUZ 3QG5A 3M8AA 2C2AA 5C8YB 4X8AA 4JYBA 3UT5A 4U3FH 5IY5B 2E3CA 4ZIBA 4DV3O 1KB9F 3CHXA 5LYJA 1S72V 3WG7C 4AQYO 5KMGB 1FJGB 2EIKC 3OW2U 3STZC 5CB4A 1DF5A 1IBKB 1XUQA 4O4JB 3L9DA 2CGOA 1LNQA 1V54B 4CH4A 3BCCH 3RN4A 4BAYA 1L1FA 2Y48A 3QF7A 4W4LA 2UU9O 4TQDA 1NVPD 5EYPA 1RPRA 1WNSA 1Q8IA 3E22B 2UUAB 1SQFA 5CA0B 4I4TA 1GM8A 5D5QA 3WB2A 2UXDO 4FLWA 1NR1A 3CCQV 4U7NA 1SQBH 1L8DA 2CTPA 4FLTA 2M7WA 1Z5VA 1P4RA 3ZCCA 1EZVH 4LH6A 3JATA 1IBMO 4K3AA 4JI6B 1YCIA 2Q5ZA 1H38A 2EILC 2QJ1A 2Y0PA 3DC6A 1Q82W 5JCOC 3X2QC 4JI0B 3AK2A 3B09A 4DUZB 1QR9A 1ZUQA 1K97A 3C3SA 5LP6C 2VQEB 4E4EA 2CH7B 3TGUH 2UXBB 5EIBC 1US6A 1Q5OA 3CRAA 3RYCA 5KHKA 3SYOA 4LF6B 1D2DA 1JCHA 3B2EE 1R6NA 4RWUA 3WB0A 4UCSA 4O4IA 3F5TA 5EK0A 1H2SB 3KCXA 1I0HA 3E2EA 4UUJC 4PDLA 3K5OA 3ABLC 1TUEB 1CPYA 1KBHA 2XOKG 4PD4F 2N74A 1XBLA 1VQKV 1DF4A 3OAAG 3JYCA 2X6AA 5H6RA 1PNMA 1R3KC 2EJ7A 2AZ0A 4GKKO 4LNUB 4NTYA 4QPJA 4DW0A 5JJEB 1MABG 2AZ2A 3CCUV 1XREA 4MSWC 4LH7A 4BIUA 1P7GA 1U97A 4LFCO 4J7ZA 2Q0AA 1W0JG 4YY3B 5CMUA 1B04A 2DYSC 1JMKC 4Z1VA 1BSMA 1K8AW 2OT5A 2RDCA 4L8JA 5H6QA 2BTOA 3QO5A 4YJ3B 4DV5B 3G67A 1MSDA 2JRIA 5IWAO 1EN4A 1ROPA 5LA6A 2WLKA 2EINC 5EIBD 5GTIZ 3HKCB 1V54C 3GVMA 4DW1A 4XDLA 1R73A 4CC5A 1S76D 4DV7B 2W6JG 4G2KA 1AI7A 3N2KB 2JGDA 3J7AU 4ZOLB 4DUYB 1ZAUA 1HW7A 3E8GA 1V55B 4LF5O 2FL4A 1HNZO 3BAAA 3AK1A 4JPRA 4EB6B 4KUMA 1BS3A 1OCOC 5E1AC 2OWOA 2QKCA 2O57A 1SS3A 3B4SA 4H33A 5CB4B 1BGYH 4TWKA 4DRXA 1B06A 1ZL8A 1I94O 4MW3A 3ASOB 2HR3A 3TCUA 4IYHA 2ATKC 1H2NA 1EBOA 3SJAC 1D5NA 1XOUA 4TSFG 3J81N 3W7SA 4OPAA 1H8HG 3B40A 1XL4A 2MK3A 4O2AB 3K79A 2R9RB 2YSUB 5JQGB 3ZHTA 4GYCB 2ZR2A 1Y4MA 2F66C 2NNUA 2UU9B 4GCZA 3OR7C 4DV5O 4J9YB 1PP9H 1AP5A 1G1XB 4HNAB 2BCCH 3ZHUA 4P30A 5KA5A 1E1RG 5JWPA 4X65O 2DN9A 4K0KB 1QU7A 3F7VC 1SQQH 1KP2A 4LFBO 2NLJC 3CMAV 1LUWA 3K3WA 1PKXA 4JAVA 3ZRVA 2AXTZ 5L3GA 2LFRA 4FLXA 3LDCA 1N33O 1NH2B 4MVOA 4R7CA 2RNBA 1MZFA 5IE9A 4X64B 2F43G 4GLXA 2CK3G 2RCVA 4B7KA 5IJ9A 4UCOA 1NTMH 4UVCA 1SQGA 1YDXA 3CC7V 3I56V 3SPIA 2ZE7A 5B1OA 2IH1C 2WLMA 3CJHB 4GKJO 1VARA 1QLEB 1XL6A 1RPOA 2QWNB 2HJFC 3P32A 1BQZA 1IDSA 3R65A 3ZRWB 1H2LA 5LGTA 1YVWA 1WA8B 4LF7O 1IBMB 4QIWF 3OTOO 4F6RB 2B1IA 2EIKB 1DGSA 4DV2B 5EBWC 1M9NA 4X1YB 3SYQA 4RQFA 1HNWO 2IBZH 3H1JH 4JYYA 1QVFU 3DGEA 4Q6GA 2B9ZA 1UPGA 1LR1A 1JFFB 4JI1B 4YJ2A 2JDIG 2EINB 4JV5B 4LWSB 1WPXA 4QE7A 1M1KW 4CZZA 2Q7EA 1AR4A 5LMNO 4GKKB 1P84F 1N32B 4MS2A 5LXTB 3CCSV 4TQFA 5KUKA 5A2QN 5JCOA 2ZIOA 3ZEDA 3LNMB 4IGGA 4FFBA 1JR9A 4XDKA 5CA1B 4O4LB 1N34B 4LF9B 3U0ZA 3L70H 5IYCO 3ASNB 3LUTB 5LHIA 1HNXO 2GV9A 3APQA 3SGIA 4PELA 2K1EA 1FFTB 3BEHA 5BZBA 2DWDC 5B5EZ 3JAKB 4K0KO 2PYLA 2QWPB 1Q43A 4H0LB 3R66A 2UXCO 1Z2GA 2ARHA 4DUZO 4DXWA 2LQTA 2VQFO 5LGNA 2JJ1G 3ZS8C 4ICGA 5IYDO 4OX9B 3EHBB 4WBNA 2Q73A 3WFVA 3ETQA 3D8CA 1MOFA 3RYFA 1DK1A 1ZSPA 3TJTA 3JARA 4OPHA 1G6UA 2GSMB 3JSLA 3ETDA 3MHHC 1BMFG 1IBLO 4I9QA 3IC7A 1N32O 3M7MX 1BL8A 3B8MA 2QEXV 1K34A 3CD6V 3ABMB 1NBMG 3HB3B 3JAWB 1NT2B 4R6ZA 1X4TA 4JI5O 2XT9A 4FM0A 1GN2A 4UCUA 2E5LB 1YJNV 3SPCA 2R72A 1HNWB 3DXRA 5B1BC 2FYUH 2XAJA 4WFFA 3H1LH 3U11A 4I0XA 1WB7A 4PDMA 4JAUA 3SPHA 3KKYA 4I9WA 2EIMB 2CDYA 2GDSA 3K5MA 1I5YA 1OCRC 3ML0A 3HKEB 4RUEA 5K1XA 1Y74B 4KHPO 2FMLA 4TV9B 4U7OA 3W7TA 4LFBB 1SQXH 4OX9O 2JS3A 1M93A 1DLBA 5IJ9B 4H13B 4O2BA 3TK1A 3N2GA 1S3JA 3CJHA 4BW9A 4JZGA 2WSSG 4LNUA 5GONA 1SESA 4X1KB 3AG1B 4DV6O 5IYZB 2HFEC 4DR7B 1FFXA 3BFRA 1YZBA 1FPOA 1GK9A 2UUBO 4F6RA 3RBZA 1YI2V 1IXMA 4UCVA 2ZDIC 1KU9A 4CS2A 1MZEA 4DV3B 3ABUA 2DYSB 2ZD9A 1L0NH 3W7XA 1BCCH 1RM1B 1FYJA 5FNVA 2F93B 2D2CB 1KC8W 2LGWA 4MVSA 4MVUA 4NXMB 4UXNA 1VQ9V 2QTOA 1B6QA 4LWSA 3CMEV 1OCOB 2F4VB 3OTFA 3K59A 3JSNA 3SYAA 4DV0B 2LO1A 1N4CA 3N2KA 2EILB 2WA3A 4P9PA 4FJCC 4JI3O 1NTZH 4LF7B 1IXBA 3ZRXA 1K5SA 2LW1A 2AHZA 1Q81W 1JVMA 2VS0A 2DMXA 1Q7YW 1N0NA 4DV2O 4UCRA 4I55B 2H94A 5FLXN 2M6YA 4DR7O 4JZ2A 2EX3A 2X7RB 1F4MA 4DR1B 2ZIMA 3JALB 2DQ3A 4G28B 3RYIA 1XHZA 1OJHA 3T1YO 2H8PC 3G6EV 1Q90D 3JAMN 4UB6Z 3W7WA 1QLNA 3LNNA 2P5OA 1F51A 4HNAA 2QR4A 4FPPA 1RP3B 1S77D 2DW4A 4DO2A 3JD0A 4NKGB 4D7TA 4AQYB 5EYPB 3UO2A 3FB6C 2HP8A 1JPXA 2XUMA 3VQYA 5EBMC 1AROP 2DQ0A 1K4DC 1Q3EA 1SERA 4DR2B 3P3NA 4ZHQA 3T1HO 2EZOA 2JEUA 4WFEA 1O9HA 2A7WA 4JAAA 3T1CA 3E86A 2ZE6A 2DYRB 3ABLB 4NYKA 1R1BA 1PL4A 2UUAO 3ZMSA 5GTHZ 2HJDA 3H01A 2ZXWC 1QR8A 3OEEG 4FLUA 1TAEA 4IHJB 1WA8A 2BOCC 4RAIA 5LHHA 4JTAB 3WB1A 2CUGA 4N21A 2P4KA 3EXAA 1KD1W 1R3IC 3K08A 2XHBA 3A0RA 3CSXA 2UXDB 5LMNB 3ETGA 5LP6B 1SA0B 2EULA 3EFFK 2EIJB 4X1IA 2CE4A 5BR8B 4U3JB 2ETNA 5IJ0A 1PM9A 2ITDC 1QCEA 4FM1A 1BHAA 2EIMC 3J80N 3KG2A 2JS5A 3G4SV 4LF8B 3BA8A 4KXRA 3OGCC 1YSCA 3CS5A 1XNRB 4I5SA 3W7UA 5FNVB 2ZCEA 4B3MB 5L3BA 1NKDA 4KFMA 4X9QA 5CBHA 1DTOA 1VF7A 4MT8A 3AG3B 1AILA 1QVGU 2CAZC 3VQVA 2H3OA 2WLHA 3LDEA 2JGUA 3ABMC 3FAVB 2JIZG 4HAMA 2YC0A 1XDCA 2JEXA 3JD4A 4AILC 4PHZA 5C8YA 3A8TA 3K0GA 4DV6B 1AI5A 2Q0OC 4YJ3A 1MG1A 2A79B 4JI2O 5LA6B 1K7DA 2KKWA 1CXZB 5F2VO 5L3DA 3X2QB 3G80A 2BOBC 5DECA 1YITV 3LSSA 1QLEC 5J9PC 4TV8B 2WLIB 1MSWD 4HZ3A 2EBOA 4W4KA 2QDOA 3OUFA 2W6IG 2YDEA 3UM7A 5KAFZ 2DJVA 2Q69A 3Q4HA 2AW9A 2YIAA 1Y6XA 1VMGA 2ZT9B 3DSQA 1GN6A 2QKAA 2WPDG 1N0JA 3ZHVA 3JAWA 1TUBA 2OCCB 3ZJZA 3IAYA 2PI4A 1BT8A 4PA4A 3SYPA 3BABA 4DUYO 3IGAC 4DR1O 4GKJB 3SYCA 4DRXB 2DE0X 2XAGA 3ASNC 2X0LA 1ZL8B 3T1YB 4J7KA 4DR5O 1HR0O 1XQ8A 5KX5B 3I55V 3EVKA 2B5UA 3ZRSA 3E83A 2WLLB 2G38A 1MA1A 1E1QG 1H2MA 4I50A 3BY6A 1AVMA 1ZX3A 4O2AA 3WG7B 4KL1A 1N33B 1OCZB 2RJZA 4Q20A 1PV0A 4P2ZA 4UCTA 3L75H 4WFBV 4PA9A 1GMGA 4K35A 3RYCB 2LGQA 4LF5B 1M57C 2GHYA 4AI8A 2L35A 1WP7A 3N2GB 5H5NA 1K4CC 2Q68A 4YXWG 1ORQC 1M90W 3C3TA 1Q86W 3FYIB 4OXSA 3LSUA 4J9ZB 4X20B 1I5XA 2HVKC 4DV0O 5KA6A 1I08A 5LOVB 4CC6A 3JCZA 4FLVA 2W0FC 3CC4V 5LL6Y 1H2KA 4RO2A 4NVPA 2V7QG 4ZI7B 4NXMO 5BR8O 5HFLA 4JF3A 4PJ0Z 5JVDA 1OCRB 2Y0IA 3E8HA 3FYEB 4JYCA 5B1AB 3SJQC 4LC1A 3TETA 2RMKB 4DR6O 4DR5B 1SA0A 4DV4O 1SZTA 3ZHSA 3D36C 1Y76B 3SJCC 1BE3H 4FM2A 4QNHB 3SJBC 3WU2Z 3CCLV 4F4LA 1VQ5V 5B3SB 3A0BZ 4RUFA 4WF9V 5KHHA 3CP1A 5FPRA 4LBEC 3ZMTA 1WLEA 3CCEV 2QE7G 4UV9A 1GH6A 4R8CA 1GRJA 3H1HH 2B1GA 2P90A 3JD1A 3HKBA 2EZPA 2P22C 4IIJB 2QTSA 1GKFA 1OV9A 4CBCA 5BMVB 5DN6G 3STLC 2MW2B 4I55A 3FFQA 3AG7A 1PNLA 5CBGA 4FFBB 2N04A 1R3JC 3MHSC 3QO7A 1K9MW 3APOA 3PN1A 4EB6A 3B77A 1M56B 2GTSA 3VBBA 3H1IH 4QPKA 2E5LO 3CB2A 1S5HC 1FJGO 2YI8A 3CXHF 1PD3A 5EZYB 4LF4O 4X64O 3ICXA 4DV7O 2XAFA 4N23A 5L3EA 1G4YB 4YHHO 1EN5A 4LP8A 4BIZA 4J7JA 4B3MO 2LJ2A 1IBLB 1VF6C 3UT5B 5B66Z 3UQ8A 3HR0A 4PI0A 1NZ6A 4JI1O 4X62B 1NI8A 2IM9A 2HHHO 4K8XA 3T4DA 1HR0B 1M57B 5KMGA 2LFSA 1NH2D 2R9AA
chains in the Genus database with same CATH topology
3L71H 1SQBH 3CX5F 3H1HH 4U3FH 1BGYH 3L74H 1EZVH 1SQVH 2IBZH 3BCCH 3TGUH 1KB9F 3H1JH 1KYOF 1NTKH 1PP9H 1BE3H 1L0NH 1SQPH 2BCCH 3H1IH 3L70H 1BCCH 4PD4F 1L0LH 1NU1H 1NTMH 3CXHF 1PPJH 4D6TH 1SQXH 1SQQH 2FYUH 3L72H 3H1LH 2A06H 1NTZH 1P84F 3L75H 3CWBH 3H1KH 5KLVH 3L73H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 H;  1SQB H;  3CX5 F;  3H1H H;  4U3F H;  1BGY H;  3L74 H;  1EZV H;  1SQV H;  2IBZ H;  3BCC H;  3TGU H;  1KB9 F;  3H1J H;  1KYO F;  1NTK H;  1PP9 H;  1BE3 H;  1L0N H;  1SQP H;  2BCC H;  3H1I H;  3L70 H;  1BCC H;  4PD4 F;  1L0L H;  1NU1 H;  1NTM H;  3CXH F;  1PPJ H;  4D6T H;  1SQX H;  1SQQ H;  2FYU H;  3L72 H;  3H1L H;  2A06 H;  1NTZ H;  1P84 F;  3L75 H;  3CWB H;  3H1K H;  5KLV H;  3L73 H; 
#chains in the Genus database with same CATH topology
 2ZQM A;  1PNK A;  3JAR B;  3GWO A;  2UXX A;  2Q67 A;  5J2U B;  4UV8 A;  2WWW A;  5KX5 A;  4PA7 A;  1XMQ B;  4B3T B;  2WLL A;  3IC9 A;  1WB8 A;  2R9I A;  1M4U A;  5L3C A;  2WA4 A;  3FB8 C;  4X66 B;  4I50 B;  3OE7 G;  3E22 A;  1NVP B;  3L73 H;  2QWR B;  2E76 B;  2UUB B;  3CPW U;  3QTC A;  4I4T B;  4TUY B;  1R3L C;  3BA9 A;  4CH6 A;  4WFG A;  5DED A;  5J2T B;  1FXV A;  4FVM A;  3DXR B;  2UXC B;  2YIB A;  1OZ0 A;  3JAT B;  5A9G A;  2ZIN A;  2QWQ B;  1JQ0 A;  3RT3 C;  1Y66 A;  4LF4 B;  1XHX A;  2QWO B;  5LGU A;  3IFX A;  5KLV H;  4X20 A;  3JAS A;  1MNG A;  3K0D A;  3H9V A;  1FKA O;  5KAI Z;  4GX2 A;  2YS8 A;  3HKE A;  3GB7 C;  4LR3 A;  3CCJ V;  4X1I B;  2XTA A;  3JD2 A;  2KSD A;  4DR3 B;  3CE2 A;  3K03 A;  1SC5 B;  5LHG A;  3CRR A;  3O9O A;  1YHQ V;  1XNQ O;  2UXB O;  4DV4 B;  1QBZ A;  4JAS A;  4X1Y A;  4RQE A;  1XMO B;  5GON B;  3S3W A;  3QNE A;  4BR6 A;  1N36 B;  4CS4 A;  4O4I B;  5H9C A;  3K04 A;  4JV5 O;  5IDJ A;  4AHC A;  4MTG A;  4JI5 B;  2WLN A;  4CH3 A;  4YJ2 B;  4F6E A;  5B1N A;  1Q6I A;  1JOY A;  5LBQ A;  1XMQ O;  4ASU G;  2YIC A;  1BZK A;  1Y76 A;  3F5W C;  2Y4T A;  2HG5 C;  4NR1 A;  5DM6 V;  2JK5 C;  4ZBM A;  2IH3 C;  3HKD A;  4X88 A;  1HNX B;  5CA1 A;  2BTQ B;  4O4L A;  4DYL A;  1ZTE A;  3AK3 A;  3AEI A;  1R6K A;  2LP7 A;  1WP8 A;  1QHT A;  4MW8 A;  4ZKI A;  1VF6 A;  1GTO A;  1GM7 A;  2P4V A;  1F4N A;  1GN3 A;  1YTF D;  1EZJ A;  2ZR3 A;  4PA6 A;  2P06 A;  3JAK A;  3BPZ A;  2X6B A;  1VQP V;  4FK5 C;  4TV8 A;  2WLI A;  1AI6 A;  1CEZ A;  2RQ6 A;  4B7E A;  4MVR A;  3CXC U;  4X66 O;  5H2F Z;  1VF5 B;  2A0L A;  1W0K G;  2Q4P A;  1VP7 A;  1KMI Z;  3CEI A;  2IJI A;  2W0X A;  1QQC A;  1TUB B;  1FXH A;  2V4D A;  2YXH A;  4LFA O;  3K06 A;  3HKC A;  1MMM A;  5EZY A;  3QO8 A;  4JGS A;  2YUA A;  5TIS Z;  3RYH A;  3ZN1 A;  2QM7 A;  4JI7 B;  3B8N A;  1KP3 A;  4QGP A;  2GUZ A;  3D3Q A;  2JVD A;  1UJW B;  3SPJ A;  1YF2 A;  2FTK A;  1EM1 A;  1AR5 A;  3MDS A;  1H2G A;  3AG3 C;  4H44 B;  4K8Z A;  2BE3 A;  3JAL A;  1THZ A;  2IJH A;  5FPO A;  2P7T C;  1VQO V;  2Q8V A;  4GX5 A;  4MTO A;  3VQW A;  2D3O W;  4JI4 O;  2E75 B;  3OT7 A;  1GN4 A;  3L71 H;  5KHJ A;  3T2M A;  3FKS G;  1JX9 A;  1K33 A;  4KP4 A;  2NN4 A;  1Q6H A;  1K3E A;  5KUM A;  5J2U A;  1HDJ A;  4X62 O;  4I0X B;  1YTF B;  4FFK A;  4NXN B;  5CA3 A;  3L72 H;  4TT3 G;  1GAX A;  2QM8 A;  3RVZ A;  4QE9 A;  3ZHQ A;  2QSA A;  5LOV A;  4BIO A;  4QJF B;  3AG2 B;  5C93 A;  2PZS A;  1KYO F;  4YIO A;  2F4V O;  2FKX A;  2KG7 B;  1SQP H;  4TV9 A;  1XI1 A;  2ZDI A;  2Z3Y A;  2YID A;  4WCE V;  3P3P A;  5J2T A;  2Z0A A;  4DR4 B;  4O2B B;  3VOU A;  1ZWI C;  1VQ6 V;  3CCR V;  4J80 A;  4MTX A;  1K5Q A;  3SR2 C;  4X1K A;  1YXB A;  4XDJ A;  3ABT A;  1SQV H;  2P67 A;  4JI0 O;  3GWK C;  1NTK H;  1WPB A;  5IWA B;  1AJN A;  1SKV A;  2WLJ A;  1JA8 A;  4PA3 A;  3OMI B;  4CH5 A;  2PTM A;  1FXK B;  2OCH A;  3OUS A;  3C90 A;  3CWB H;  2OCC C;  2UUC O;  3U10 A;  3OM3 B;  5EBL C;  4JI2 B;  4IT5 A;  2ADP A;  3G6B A;  2ZXW B;  4DR3 O;  2XND G;  1HNZ B;  4DR2 O;  5LP6 A;  4R50 A;  3ZRW A;  2IJJ A;  1NJI W;  5KHI A;  2LW7 A;  1XMO O;  4DV1 B;  4NTW A;  2ZE8 A;  2QKS A;  3CCM V;  1YIJ V;  3FB7 C;  1TVK A;  3DC5 A;  5JH7 A;  2F95 B;  2HEP A;  1HWY A;  3NR7 A;  4J42 A;  4O4H B;  1KKD A;  2P6J A;  4FLY A;  2HVJ C;  5FL7 G;  1ZLZ A;  1RSO A;  4CS3 A;  4UVA A;  2PUS A;  2GTA A;  2ZM6 O;  2YEV B;  4GZR B;  1PL0 A;  5B1B B;  3RFR A;  2JGD B;  5IY5 C;  4ZOL A;  4Z1M G;  3FB5 C;  2ZNJ A;  3OEH G;  3OD4 A;  2F23 A;  1N36 O;  1R6T A;  3E35 A;  5AG2 A;  1I94 B;  1GM9 A;  4H37 A;  1OCZ C;  3ABK C;  3AG4 C;  2ZNI A;  1Y67 A;  3UKM A;  1QNM A;  2HLD G;  4PI2 A;  3ZMZ A;  4IYI A;  4GX0 A;  1B3Q A;  1P49 A;  5B1A C;  3CRC A;  2IJK A;  2N05 A;  4B3S O;  4UVB A;  2XAS A;  2PI5 A;  4A5U B;  1YEW A;  1WN7 A;  2EJR A;  2GUZ B;  1OCC C;  3CRQ A;  3K57 A;  4B3T O;  1WAZ A;  4LF8 O;  2XAH A;  1VQL V;  4D6T H;  4LCU C;  4FZ1 A;  1N8R W;  4PDV A;  2ADQ B;  3BVO A;  1FXK C;  4LFA B;  1NQT A;  2Q6A A;  1COW G;  3UCS C;  2WAM A;  2F1M A;  2EIJ C;  4EFB A;  5LYJ B;  2PY5 A;  3KZI Z;  3VQX A;  3OFN G;  4PV1 B;  4Z2W A;  4NXN O;  4JI8 O;  1W2B U;  1M5I A;  2UUC B;  2ODM A;  4ZHQ B;  3RYF B;  1VEW A;  1IVS A;  3TXS A;  3OMA B;  4O4J A;  4I7Z B;  3ZMV A;  4GX1 A;  1H8E G;  3K9A A;  3P30 A;  3E8F A;  1URF A;  4UB8 Z;  1O9G A;  5ITZ A;  4G27 B;  2IW5 A;  2V1D A;  1KQS U;  1LUV A;  3E8B A;  3F7Y C;  2Q9L A;  4DV1 O;  4ABM A;  1XEQ A;  1NR7 A;  4JTC B;  1Z5W A;  1L0L H;  2YIB D;  1X59 A;  1I7F A;  1JJO A;  2PF4 E;  1PPJ H;  5CN0 A;  2R70 A;  5BXZ A;  3ZBH A;  2OIE A;  3K5L A;  4EEQ A;  2PYJ A;  3OGI B;  4X89 A;  3RVY A;  3CRM A;  3N27 A;  2FB5 A;  1S5J A;  2K9P A;  1T5E A;  5GW7 A;  1U96 A;  4IL6 Z;  1OHH G;  4FIP C;  4L87 A;  4NB5 A;  4LF9 O;  2ITC C;  3THO A;  2DWE C;  4DR4 O;  1KUQ A;  1D5A A;  3S3X A;  3CCV V;  2CGN A;  2A3Q A;  4U3J A;  3ABK B;  3AG4 B;  4WFH A;  3BHP A;  1FXK A;  3ZN0 A;  1G8M A;  3LDD A;  1J5E O;  1BQ0 A;  1FS0 G;  3A2F A;  4FZ0 A;  2X6C A;  3HKD B;  4JYA O;  3DTU B;  2KQX A;  1XNR O;  1S5L Z;  1OCC B;  1IUR A;  4ZI7 A;  3CYO A;  4J11 A;  4YIP A;  3E89 A;  2VQF B;  1JFF A;  4DK0 A;  2AHY A;  1VQ4 V;  2A06 H;  4JTD B;  4B08 A;  3K58 A;  4P9O A;  4OGQ B;  1FFX B;  3L74 H;  3FD9 A;  1AI4 A;  3RWR D;  3SDL A;  5B3S C;  1S0V A;  1W59 A;  1EN6 A;  2VQE O;  2ZM6 B;  4NTX A;  4B3R O;  4DK1 A;  4O4H A;  3M99 B;  1AR1 B;  4LF6 O;  2BSK A;  2NR5 A;  2XAQ A;  1RSO B;  5KHG A;  2Z5U A;  2Q7G A;  2YEV A;  3RYH B;  2OTJ V;  5JJN B;  2Y69 B;  1SF9 A;  1ENV A;  2AGA A;  1P7B A;  5IYB O;  1VIB A;  3Q4H B;  3OTO B;  1JJ2 U;  2ZE5 A;  1FAF A;  1UFI A;  1N34 O;  2VRZ A;  2IU3 A;  4JI4 B;  4JI6 O;  3CX5 F;  1J5E B;  2RN9 A;  4WBN B;  1V55 C;  3ETE A;  1VQM V;  2QM4 A;  4HBN A;  2OYQ A;  4KHP B;  1E79 G;  3ASO C;  5E79 Z;  4XBF A;  1KEC A;  5CBF A;  3HPL C;  3A0H Z;  2Y69 C;  4UFZ A;  5BY1 A;  3CC2 V;  1J95 A;  3UO3 A;  3I5D A;  3ZX6 A;  4HYO A;  2UXN A;  4MVM A;  1SZX A;  5LMU B;  1VQ8 V;  3RGB A;  4EFE A;  2CTR A;  4PDR A;  1IBK O;  2DOS A;  3RYI B;  3D36 A;  4J41 A;  3QVN A;  4E2L A;  2KB1 A;  5CA0 A;  4GUN A;  2KG7 A;  1K92 A;  4JYA B;  2L6L A;  3PJS K;  4B3R B;  4YHH B;  3ZIA G;  2Y4U A;  2IU0 A;  1KKC A;  2CTQ A;  4MTF A;  3K9S A;  2PGG A;  1VQ7 V;  2QA4 V;  1TGO A;  1SRY A;  3NXS A;  2HHH B;  4FLZ A;  3ZHR A;  5ITZ B;  4JI8 B;  1AJP A;  3G71 V;  1V9P A;  1GO3 F;  3AG1 C;  1F23 A;  2VWK A;  1NU1 H;  3LSQ A;  1NS1 A;  1Y74 A;  1K73 W;  5JQG A;  2A9H A;  4TUY A;  3AG2 C;  1YJ9 V;  1IZ3 A;  5L3F A;  3H1K H;  4GT1 A;  2CH7 A;  1RFY A;  2OTL V;  4LFC B;  2ZKO A;  4EKW A;  2GBO A;  4MVZ A;  2Q7H A;  2YXY A;  3T4Z A;  5JVD B;  4J10 A;  3JD3 A;  4X65 B;  3K5N A;  4DR6 B;  3OR6 C;  1Q6U A;  1CP9 A;  5IYZ A;  3JAS B;  1SET A;  4MVQ A;  3KCY A;  4JI3 B;  2VWJ A;  4IHJ A;  2HKO A;  1A32 A;  1VQN V;  4YY3 O;  1HP8 A;  2E74 B;  4BWA A;  1TVK B;  1AP6 A;  5JH7 B;  5JJJ B;  4B3S B;  2OIG A;  1BHB A;  2ILM A;  1AB3 A;  3HKB B;  4JI7 O;  1F7Y A;  4C7U A;  5D5P A;  1XNQ B;  4IIJ A;  2DYR C;  2CTW A;  4WFA V;  4FMT A;  5IT9 N;  5BMV A;  1XIL A;  5IJ0 B;  5LMU O;  1TA8 A;  3SPG A;  2JJ2 G;  5HFM A;  5EC1 C;  2QGN A;  1AJQ A;  2BTQ A;  4D7S A;  1YJW V;  3ZMU A;  4BW5 A;  3TXQ A;  1IX9 A;  3FX7 A;  3O65 A;  5EC2 C;  3D3I A;  4TOI A;  3OMN B;  5K1P A;  1EFR G;  3IJ4 A;  3MD0 A;  2YXL A;  2BSK B;  2YI9 A;  1WJZ A;  3MAQ A;  1M56 C;  1FD9 A;  3RW0 A;  3BRC A;  3T1H B;  1RM1 C;  3FAV A;  5LXT A;  3JCU Z;  3QG5 A;  3M8A A;  2C2A A;  5C8Y B;  4X8A A;  4JYB A;  3UT5 A;  4U3F H;  5IY5 B;  2E3C A;  4ZIB A;  4DV3 O;  1KB9 F;  3CHX A;  5LYJ A;  1S72 V;  3WG7 C;  4AQY O;  5KMG B;  1FJG B;  2EIK C;  3OW2 U;  3STZ C;  5CB4 A;  1DF5 A;  1IBK B;  1XUQ A;  4O4J B;  3L9D A;  2CGO A;  1LNQ A;  1V54 B;  4CH4 A;  3BCC H;  3RN4 A;  4BAY A;  1L1F A;  2Y48 A;  3QF7 A;  4W4L A;  2UU9 O;  4TQD A;  1NVP D;  5EYP A;  1RPR A;  1WNS A;  1Q8I A;  3E22 B;  2UUA B;  1SQF A;  5CA0 B;  4I4T A;  1GM8 A;  5D5Q A;  3WB2 A;  2UXD O;  4FLW A;  1NR1 A;  3CCQ V;  4U7N A;  1SQB H;  1L8D A;  2CTP A;  4FLT A;  2M7W A;  1Z5V A;  1P4R A;  3ZCC A;  1EZV H;  4LH6 A;  3JAT A;  1IBM O;  4K3A A;  4JI6 B;  1YCI A;  2Q5Z A;  1H38 A;  2EIL C;  2QJ1 A;  2Y0P A;  3DC6 A;  1Q82 W;  5JCO C;  3X2Q C;  4JI0 B;  3AK2 A;  3B09 A;  4DUZ B;  1QR9 A;  1ZUQ A;  1K97 A;  3C3S A;  5LP6 C;  2VQE B;  4E4E A;  2CH7 B;  3TGU H;  2UXB B;  5EIB C;  1US6 A;  1Q5O A;  3CRA A;  3RYC A;  5KHK A;  3SYO A;  4LF6 B;  1D2D A;  1JCH A;  3B2E E;  1R6N A;  4RWU A;  3WB0 A;  4UCS A;  4O4I A;  3F5T A;  5EK0 A;  1H2S B;  3KCX A;  1I0H A;  3E2E A;  4UUJ C;  4PDL A;  3K5O A;  3ABL C;  1TUE B;  1CPY A;  1KBH A;  2XOK G;  4PD4 F;  2N74 A;  1XBL A;  1VQK V;  1DF4 A;  3OAA G;  3JYC A;  2X6A A;  5H6R A;  1PNM A;  1R3K C;  2EJ7 A;  2AZ0 A;  4GKK O;  4LNU B;  4NTY A;  4QPJ A;  4DW0 A;  5JJE B;  1MAB G;  2AZ2 A;  3CCU V;  1XRE A;  4MSW C;  4LH7 A;  4BIU A;  1P7G A;  1U97 A;  4LFC O;  4J7Z A;  2Q0A A;  1W0J G;  4YY3 B;  5CMU A;  1B04 A;  2DYS C;  1JMK C;  4Z1V A;  1BSM A;  1K8A W;  2OT5 A;  2RDC A;  4L8J A;  5H6Q A;  2BTO A;  3QO5 A;  4YJ3 B;  4DV5 B;  3G67 A;  1MSD A;  2JRI A;  5IWA O;  1EN4 A;  1ROP A;  5LA6 A;  2WLK A;  2EIN C;  5EIB D;  5GTI Z;  3HKC B;  1V54 C;  3GVM A;  4DW1 A;  4XDL A;  1R73 A;  4CC5 A;  1S76 D;  4DV7 B;  2W6J G;  4G2K A;  1AI7 A;  3N2K B;  2JGD A;  3J7A U;  4ZOL B;  4DUY B;  1ZAU A;  1HW7 A;  3E8G A;  1V55 B;  4LF5 O;  2FL4 A;  1HNZ O;  3BAA A;  3AK1 A;  4JPR A;  4EB6 B;  4KUM A;  1BS3 A;  1OCO C;  5E1A C;  2OWO A;  2QKC A;  2O57 A;  1SS3 A;  3B4S A;  4H33 A;  5CB4 B;  1BGY H;  4TWK A;  4DRX A;  1B06 A;  1ZL8 A;  1I94 O;  4MW3 A;  3ASO B;  2HR3 A;  3TCU A;  4IYH A;  2ATK C;  1H2N A;  1EBO A;  3SJA C;  1D5N A;  1XOU A;  4TSF G;  3J81 N;  3W7S A;  4OPA A;  1H8H G;  3B40 A;  1XL4 A;  2MK3 A;  4O2A B;  3K79 A;  2R9R B;  2YSU B;  5JQG B;  3ZHT A;  4GYC B;  2ZR2 A;  1Y4M A;  2F66 C;  2NNU A;  2UU9 B;  4GCZ A;  3OR7 C;  4DV5 O;  4J9Y B;  1PP9 H;  1AP5 A;  1G1X B;  4HNA B;  2BCC H;  3ZHU A;  4P30 A;  5KA5 A;  1E1R G;  5JWP A;  4X65 O;  2DN9 A;  4K0K B;  1QU7 A;  3F7V C;  1SQQ H;  1KP2 A;  4LFB O;  2NLJ C;  3CMA V;  1LUW A;  3K3W A;  1PKX A;  4JAV A;  3ZRV A;  2AXT Z;  5L3G A;  2LFR A;  4FLX A;  3LDC A;  1N33 O;  1NH2 B;  4MVO A;  4R7C A;  2RNB A;  1MZF A;  5IE9 A;  4X64 B;  2F43 G;  4GLX A;  2CK3 G;  2RCV A;  4B7K A;  5IJ9 A;  4UCO A;  1NTM H;  4UVC A;  1SQG A;  1YDX A;  3CC7 V;  3I56 V;  3SPI A;  2ZE7 A;  5B1O A;  2IH1 C;  2WLM A;  3CJH B;  4GKJ O;  1VAR A;  1QLE B;  1XL6 A;  1RPO A;  2QWN B;  2HJF C;  3P32 A;  1BQZ A;  1IDS A;  3R65 A;  3ZRW B;  1H2L A;  5LGT A;  1YVW A;  1WA8 B;  4LF7 O;  1IBM B;  4QIW F;  3OTO O;  4F6R B;  2B1I A;  2EIK B;  1DGS A;  4DV2 B;  5EBW C;  1M9N A;  4X1Y B;  3SYQ A;  4RQF A;  1HNW O;  2IBZ H;  3H1J H;  4JYY A;  1QVF U;  3DGE A;  4Q6G A;  2B9Z A;  1UPG A;  1LR1 A;  1JFF B;  4JI1 B;  4YJ2 A;  2JDI G;  2EIN B;  4JV5 B;  4LWS B;  1WPX A;  4QE7 A;  1M1K W;  4CZZ A;  2Q7E A;  1AR4 A;  5LMN O;  4GKK B;  1P84 F;  1N32 B;  4MS2 A;  5LXT B;  3CCS V;  4TQF A;  5KUK A;  5A2Q N;  5JCO A;  2ZIO A;  3ZED A;  3LNM B;  4IGG A;  4FFB A;  1JR9 A;  4XDK A;  5CA1 B;  4O4L B;  1N34 B;  4LF9 B;  3U0Z A;  3L70 H;  5IYC O;  3ASN B;  3LUT B;  5LHI A;  1HNX O;  2GV9 A;  3APQ A;  3SGI A;  4PEL A;  2K1E A;  1FFT B;  3BEH A;  5BZB A;  2DWD C;  5B5E Z;  3JAK B;  4K0K O;  2PYL A;  2QWP B;  1Q43 A;  4H0L B;  3R66 A;  2UXC O;  1Z2G A;  2ARH A;  4DUZ O;  4DXW A;  2LQT A;  2VQF O;  5LGN A;  2JJ1 G;  3ZS8 C;  4ICG A;  5IYD O;  4OX9 B;  3EHB B;  4WBN A;  2Q73 A;  3WFV A;  3ETQ A;  3D8C A;  1MOF A;  3RYF A;  1DK1 A;  1ZSP A;  3TJT A;  3JAR A;  4OPH A;  1G6U A;  2GSM B;  3JSL A;  3ETD A;  3MHH C;  1BMF G;  1IBL O;  4I9Q A;  3IC7 A;  1N32 O;  3M7M X;  1BL8 A;  3B8M A;  2QEX V;  1K34 A;  3CD6 V;  3ABM B;  1NBM G;  3HB3 B;  3JAW B;  1NT2 B;  4R6Z A;  1X4T A;  4JI5 O;  2XT9 A;  4FM0 A;  1GN2 A;  4UCU A;  2E5L B;  1YJN V;  3SPC A;  2R72 A;  1HNW B;  3DXR A;  5B1B C;  2FYU H;  2XAJ A;  4WFF A;  3H1L H;  3U11 A;  4I0X A;  1WB7 A;  4PDM A;  4JAU A;  3SPH A;  3KKY A;  4I9W A;  2EIM B;  2CDY A;  2GDS A;  3K5M A;  1I5Y A;  1OCR C;  3ML0 A;  3HKE B;  4RUE A;  5K1X A;  1Y74 B;  4KHP O;  2FML A;  4TV9 B;  4U7O A;  3W7T A;  4LFB B;  1SQX H;  4OX9 O;  2JS3 A;  1M93 A;  1DLB A;  5IJ9 B;  4H13 B;  4O2B A;  3TK1 A;  3N2G A;  1S3J A;  3CJH A;  4BW9 A;  4JZG A;  2WSS G;  4LNU A;  5GON A;  1SES A;  4X1K B;  3AG1 B;  4DV6 O;  5IYZ B;  2HFE C;  4DR7 B;  1FFX A;  3BFR A;  1YZB A;  1FPO A;  1GK9 A;  2UUB O;  4F6R A;  3RBZ A;  1YI2 V;  1IXM A;  4UCV A;  2ZDI C;  1KU9 A;  4CS2 A;  1MZE A;  4DV3 B;  3ABU A;  2DYS B;  2ZD9 A;  1L0N H;  3W7X A;  1BCC H;  1RM1 B;  1FYJ A;  5FNV A;  2F93 B;  2D2C B;  1KC8 W;  2LGW A;  4MVS A;  4MVU A;  4NXM B;  4UXN A;  1VQ9 V;  2QTO A;  1B6Q A;  4LWS A;  3CME V;  1OCO B;  2F4V B;  3OTF A;  3K59 A;  3JSN A;  3SYA A;  4DV0 B;  2LO1 A;  1N4C A;  3N2K A;  2EIL B;  2WA3 A;  4P9P A;  4FJC C;  4JI3 O;  1NTZ H;  4LF7 B;  1IXB A;  3ZRX A;  1K5S A;  2LW1 A;  2AHZ A;  1Q81 W;  1JVM A;  2VS0 A;  2DMX A;  1Q7Y W;  1N0N A;  4DV2 O;  4UCR A;  4I55 B;  2H94 A;  5FLX N;  2M6Y A;  4DR7 O;  4JZ2 A;  2EX3 A;  2X7R B;  1F4M A;  4DR1 B;  2ZIM A;  3JAL B;  2DQ3 A;  4G28 B;  3RYI A;  1XHZ A;  1OJH A;  3T1Y O;  2H8P C;  3G6E V;  1Q90 D;  3JAM N;  4UB6 Z;  3W7W A;  1QLN A;  3LNN A;  2P5O A;  1F51 A;  4HNA A;  2QR4 A;  4FPP A;  1RP3 B;  1S77 D;  2DW4 A;  4DO2 A;  3JD0 A;  4NKG B;  4D7T A;  4AQY B;  5EYP B;  3UO2 A;  3FB6 C;  2HP8 A;  1JPX A;  2XUM A;  3VQY A;  5EBM C;  1ARO P;  2DQ0 A;  1K4D C;  1Q3E A;  1SER A;  4DR2 B;  3P3N A;  4ZHQ A;  3T1H O;  2EZO A;  2JEU A;  4WFE A;  1O9H A;  2A7W A;  4JAA A;  3T1C A;  3E86 A;  2ZE6 A;  2DYR B;  3ABL B;  4NYK A;  1R1B A;  1PL4 A;  2UUA O;  3ZMS A;  5GTH Z;  2HJD A;  3H01 A;  2ZXW C;  1QR8 A;  3OEE G;  4FLU A;  1TAE A;  4IHJ B;  1WA8 A;  2BOC C;  4RAI A;  5LHH A;  4JTA B;  3WB1 A;  2CUG A;  4N21 A;  2P4K A;  3EXA A;  1KD1 W;  1R3I C;  3K08 A;  2XHB A;  3A0R A;  3CSX A;  2UXD B;  5LMN B;  3ETG A;  5LP6 B;  1SA0 B;  2EUL A;  3EFF K;  2EIJ B;  4X1I A;  2CE4 A;  5BR8 B;  4U3J B;  2ETN A;  5IJ0 A;  1PM9 A;  2ITD C;  1QCE A;  4FM1 A;  1BHA A;  2EIM C;  3J80 N;  3KG2 A;  2JS5 A;  3G4S V;  4LF8 B;  3BA8 A;  4KXR A;  3OGC C;  1YSC A;  3CS5 A;  1XNR B;  4I5S A;  3W7U A;  5FNV B;  2ZCE A;  4B3M B;  5L3B A;  1NKD A;  4KFM A;  4X9Q A;  5CBH A;  1DTO A;  1VF7 A;  4MT8 A;  3AG3 B;  1AIL A;  1QVG U;  2CAZ C;  3VQV A;  2H3O A;  2WLH A;  3LDE A;  2JGU A;  3ABM C;  3FAV B;  2JIZ G;  4HAM A;  2YC0 A;  1XDC A;  2JEX A;  3JD4 A;  4AIL C;  4PHZ A;  5C8Y A;  3A8T A;  3K0G A;  4DV6 B;  1AI5 A;  2Q0O C;  4YJ3 A;  1MG1 A;  2A79 B;  4JI2 O;  5LA6 B;  1K7D A;  2KKW A;  1CXZ B;  5F2V O;  5L3D A;  3X2Q B;  3G80 A;  2BOB C;  5DEC A;  1YIT V;  3LSS A;  1QLE C;  5J9P C;  4TV8 B;  2WLI B;  1MSW D;  4HZ3 A;  2EBO A;  4W4K A;  2QDO A;  3OUF A;  2W6I G;  2YDE A;  3UM7 A;  5KAF Z;  2DJV A;  2Q69 A;  3Q4H A;  2AW9 A;  2YIA A;  1Y6X A;  1VMG A;  2ZT9 B;  3DSQ A;  1GN6 A;  2QKA A;  2WPD G;  1N0J A;  3ZHV A;  3JAW A;  1TUB A;  2OCC B;  3ZJZ A;  3IAY A;  2PI4 A;  1BT8 A;  4PA4 A;  3SYP A;  3BAB A;  4DUY O;  3IGA C;  4DR1 O;  4GKJ B;  3SYC A;  4DRX B;  2DE0 X;  2XAG A;  3ASN C;  2X0L A;  1ZL8 B;  3T1Y B;  4J7K A;  4DR5 O;  1HR0 O;  1XQ8 A;  5KX5 B;  3I55 V;  3EVK A;  2B5U A;  3ZRS A;  3E83 A;  2WLL B;  2G38 A;  1MA1 A;  1E1Q G;  1H2M A;  4I50 A;  3BY6 A;  1AVM A;  1ZX3 A;  4O2A A;  3WG7 B;  4KL1 A;  1N33 B;  1OCZ B;  2RJZ A;  4Q20 A;  1PV0 A;  4P2Z A;  4UCT A;  3L75 H;  4WFB V;  4PA9 A;  1GMG A;  4K35 A;  3RYC B;  2LGQ A;  4LF5 B;  1M57 C;  2GHY A;  4AI8 A;  2L35 A;  1WP7 A;  3N2G B;  5H5N A;  1K4C C;  2Q68 A;  4YXW G;  1ORQ C;  1M90 W;  3C3T A;  1Q86 W;  3FYI B;  4OXS A;  3LSU A;  4J9Z B;  4X20 B;  1I5X A;  2HVK C;  4DV0 O;  5KA6 A;  1I08 A;  5LOV B;  4CC6 A;  3JCZ A;  4FLV A;  2W0F C;  3CC4 V;  5LL6 Y;  1H2K A;  4RO2 A;  4NVP A;  2V7Q G;  4ZI7 B;  4NXM O;  5BR8 O;  5HFL A;  4JF3 A;  4PJ0 Z;  5JVD A;  1OCR B;  2Y0I A;  3E8H A;  3FYE B;  4JYC A;  5B1A B;  3SJQ C;  4LC1 A;  3TET A;  2RMK B;  4DR6 O;  4DR5 B;  1SA0 A;  4DV4 O;  1SZT A;  3ZHS A;  3D36 C;  1Y76 B;  3SJC C;  1BE3 H;  4FM2 A;  4QNH B;  3SJB C;  3WU2 Z;  3CCL V;  4F4L A;  1VQ5 V;  5B3S B;  3A0B Z;  4RUF A;  4WF9 V;  5KHH A;  3CP1 A;  5FPR A;  4LBE C;  3ZMT A;  1WLE A;  3CCE V;  2QE7 G;  4UV9 A;  1GH6 A;  4R8C A;  1GRJ A;  3H1H H;  2B1G A;  2P90 A;  3JD1 A;  3HKB A;  2EZP A;  2P22 C;  4IIJ B;  2QTS A;  1GKF A;  1OV9 A;  4CBC A;  5BMV B;  5DN6 G;  3STL C;  2MW2 B;  4I55 A;  3FFQ A;  3AG7 A;  1PNL A;  5CBG A;  4FFB B;  2N04 A;  1R3J C;  3MHS C;  3QO7 A;  1K9M W;  3APO A;  3PN1 A;  4EB6 A;  3B77 A;  1M56 B;  2GTS A;  3VBB A;  3H1I H;  4QPK A;  2E5L O;  3CB2 A;  1S5H C;  1FJG O;  2YI8 A;  3CXH F;  1PD3 A;  5EZY B;  4LF4 O;  4X64 O;  3ICX A;  4DV7 O;  2XAF A;  4N23 A;  5L3E A;  1G4Y B;  4YHH O;  1EN5 A;  4LP8 A;  4BIZ A;  4J7J A;  4B3M O;  2LJ2 A;  1IBL B;  1VF6 C;  3UT5 B;  5B66 Z;  3UQ8 A;  3HR0 A;  4PI0 A;  1NZ6 A;  4JI1 O;  4X62 B;  1NI8 A;  2IM9 A;  2HHH O;  4K8X A;  3T4D A;  1HR0 B;  1M57 B;  5KMG A;  2LFS A;  1NH2 D;  2R9A A; 
#chains in the Genus database with same CATH homology
 3L71 H;  1SQB H;  3CX5 F;  3H1H H;  4U3F H;  1BGY H;  3L74 H;  1EZV H;  1SQV H;  2IBZ H;  3BCC H;  3TGU H;  1KB9 F;  3H1J H;  1KYO F;  1NTK H;  1PP9 H;  1BE3 H;  1L0N H;  1SQP H;  2BCC H;  3H1I H;  3L70 H;  1BCC H;  4PD4 F;  1L0L H;  1NU1 H;  1NTM H;  3CXH F;  1PPJ H;  4D6T H;  1SQX H;  1SQQ H;  2FYU H;  3L72 H;  3H1L H;  2A06 H;  1NTZ H;  1P84 F;  3L75 H;  3CWB H;  3H1K H;  5KLV H;  3L73 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...