2IBZH

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2ibzH00
3L71H 3L75H 1L0NH 3CX5F 4U3FH 1PPJH 3CXHF 1SQBH 3L70H 2IBZH 3H1IH 3L72H 1NTZH 3TGUH 3H1LH 3H1KH 1KB9F 1NTMH 1NU1H 5KLVH 2FYUH 1NTKH 2BCCH 1SQXH 1SQQH 1L0LH 1SQVH 3CWBH 3BCCH 1P84F 1EZVH 3L74H 1BE3H 2A06H 1BGYH 3H1JH 1SQPH 1KYOF 4D6TH 1PP9H 3H1HH 4PD4F 1BCCH 3L73H
chains in the Genus database with same CATH superfamily
3L75H 4NXMO 3DSQA 4AQYO 1M5IA 3TK1A 5KAIZ 2WLHA 1LUVA 4MVSA 2AHYA 2ZKOA 3K06A 4CH5A 3N2KB 2ATKC 4ZIBA 3ASOB 4FLWA 1R6NA 4DR4B 4UUJC 2AZ0A 1S76D 2GSMB 2MK3A 1P7BA 5KA6A 4GUNA 3TXQA 4JI3O 1GN6A 1YHQV 4CH3A 5K1PA 3EHBB 1FD9A 2HHHB 1Q7YW 3ZHQA 4K3AA 2ZE5A 3IC9A 4TUYA 2ZIOA 4IIJA 4GT1A 1P84F 2DQ0A 2CK3G 2HLDG 2RJZA 1V55C 2P4KA 3ZRWB 2V4DA 3K59A 3W7SA 1US6A 3G80A 3BAAA 4MVRA 4JTDB 1XL6A 1GM9A 1WB8A 5J2UA 1IURA 1H2MA 1HNXB 5B1AB 1GO3F 4RQEA 3LNMB 2HVKC 5ITZA 2RDCA 4B7EA 3HKEB 3KCXA 1MNGA 2ZM6B 4DV1O 2WAMA 2X7RB 3B09A 5LBQA 2VS0A 3K0GA 4I0XB 3OD4A 1JPXA 4GZRB 2ADPA 1TGOA 4WCEV 4MTGA 1GKFA 2JS3A 1PNLA 2GV9A 1ZSPA 3OUSA 4EFEA 3E2EA 4DR2B 1P7GA 4KXRA 4PV1B 5IJ0A 4LWSA 2L6LA 4EB6A 2VWJA 3G4SV 1IDSA 5CN0A 4JV5O 1NH2B 3JD4A 4GX5A 1BQ0A 2DQ3A 1WPXA 4LFBO 4DR7B 4DR1B 1VP7A 4PI2A 3B2EE 4O4HA 1ROPA 5C8YB 3CC4V 3JARA 4I55A 4DV5B 1BS3A 3VOUA 3W7XA 1M1KW 1JCHA 4FMTA 4FVMA 4CH4A 5J2TA 3SPJA 2QJ1A 4FLVA 5LA6B 1MABG 3EFFK 4B08A 3DXRA 1K34A 4CC6A 4LF4O 4DRXB 3RT3C 2UUCB 3STLC 4UB6Z 4W4KA 3FAVA 3QNEA 2UXCO 2X6AA 3H01A 5B1BC 2BTQB 4HNAB 4LFAB 2P22C 1KYOF 2IW5A 4DV7B 4WBNB 3JAWB 4U7OA 3LNNA 3WB2A 1D2DA 2IU0A 3CCSV 4G27B 3R65A 1S3JA 2EJRA 1N0JA 1OV9A 4LF6B 2B1GA 1FJGB 3P3NA 3K3WA 4FM2A 4U3JA 4JI7O 1K92A 2YUAA 2QM8A 4BW5A 1KP3A 1M57B 4MVOA 1E79G 3JAWA 2ZDIC 3GWOA 5JCOA 3CRQA 3J80N 1V54C 3RYCB 1HNXO 5FL7G 4X62B 1VQKV 5CA1A 4PELA 3ZHTA 5L3DA 2OIGA 5B1BB 3UT5A 1OHHG 3A8TA 3B4SA 4MSWC 1XQ8A 3ETGA 4FM1A 1BMFG 1OCCC 3EXAA 2CTQA 1SA0B 1EN5A 3LDDA 2CAZC 3JATA 3ZJZA 2WPDG 3AG1B 3FKSG 1SA0A 5JJJB 4OX9B 3K79A 3VBBA 2E74B 1Y67A 4B3TB 1H8EG 2IJJA 2IU3A 2JGDA 3CD6V 2Y4UA 4PA7A 1KD1W 3W7UA 5KHGA 4LF8O 4X8AA 1QNMA 1Q6UA 1GN2A 4O4IB 1WLEA 4UCTA 1Q82W 4OPAA 2EZOA 5CMUA 2DYRC 2DMXA 1JVMA 2Z3YA 3HKEA 1K3EA 4R50A 4AILC 3ABMC 2M6YA 3AK1A 3RYHA 1AVMA 1LNQA 3RW0A 1IZ3A 2ETNA 1H38A 3RN4A 3N27A 4DV0B 1IBKO 3R66A 4XDLA 1JOYA 1QCEA 1SQGA 2WLNA 3E35A 3L70H 4JI2B 3CCRV 1TVKB 2ITCC 2UU9B 1NI8A 2PZSA 4TV8A 4OPHA 1SZTA 3E22A 5LHHA 5JH7B 1XILA 4TUYB 1K97A 5GW7A 3JAKA 1KC8W 3CCEV 1PP9H 2PTMA 4K0KO 3MD0A 1N8RW 1WP7A 2JRIA 1XMOO 3AK3A 2GBOA 2HP8A 2PI5A 1XNQB 1F7YA 1TUBB 3ASNB 2QWNB 5BMVB 3DGEA 1DF5A 1FFXA 5DECA 4DK1A 4F4LA 5KAFZ 3RYFB 4NKGB 3ZCCA 4LF6O 3OR6C 4YJ3A 5LL6Y 1K4DC 1UPGA 4DR2O 4LFBB 1DF4A 3SYCA 3VQYA 1RFYA 4JZ2A 1VQOV 3JATB 4PA9A 3WB1A 5LP6B 4HBNA 1NTKH 4GKKB 1FYJA 3O9OA 1PNMA 2HEPA 4ZHQB 1PNKA 5JQGB 2UUBO 3UCSC 1OCCB 3JARB 4I55B 5JVDB 2KG7B 1BT8A 4F6RA 4D6TH 3ZN0A 4MW3A 4NTWA 3UT5B 4RO2A 1G6UA 1NH2D 5IDJA 5IYCO 1D5AA 3BVOA 1Q8IA 3CP1A 1XL4A 1ENVA 1VARA 1QQCA 1FKAO 2QWPB 2QKSA 1V54B 3QO5A 2YIBD 3Q4HA 3AG2B 2XOKG 3IFXA 3OW2U 2RNBA 2Q73A 1M57C 5LXTA 3CJHB 2ZIMA 3HKBB 1GAXA 4B3MB 2KQXA 2LJ2A 4KL1A 1KECA 3HKDB 2CTRA 2QWOB 4O4IA 1QR8A 3HKCB 2LO1A 4JI4B 3ASNC 3X2QC 3CCJV 3CWBH 1Y76B 2XASA 5IY5B 2NR5A 2PYLA 1H2LA 3T1HB 5KUKA 3FAVB 1GH6A 5B3SC 1J5EO 2ZE6A 1AI5A 4JI0O 1Q5OA 4RAIA 1FXKC 5F2VO 2HHHO 2Y4TA 2XTAA 3SDLA 4JI5B 2B1IA 4X62O 1SF9A 3RGBA 2JGDB 3OEHG 4FZ0A 3SYAA 4B3RB 3WG7B 3SJQC 1R3JC 3FX7A 3A2FA 5KA5A 4K8XA 2QKAA 2YSUB 4TV8B 1VQ6V 4AHCA 4O4JA 1PV0A 4DK0A 1NBMG 4GKJO 2BCCH 5CB4A 4BIUA 1I94O 4K35A 3FYIB 2OTJV 1TVKA 3DTUB 4TWKA 3PN1A 2CTPA 2YC0A 2KSDA 3AK2A 1SKVA 5EIBC 3WU2Z 3APQA 2UUAB 5EK0A 4W4LA 1ZL8A 1JJOA 3CCLV 4TQFA 2EZPA 2IJIA 4P9PA 4DR3B 1SQQH 1COWG 3AEIA 2JDIG 3M7MX 1ZLZA 5K1XA 4LF5O 1SC5B 3T1HO 1OZ0A 2L35A 3ZMTA 4JI8O 3RYFA 3E89A 1N32B 3K5NA 3CMAV 3T4DA 4Z1MG 4YJ3B 3ZBHA 3FFQA 4U7NA 2QEXV 1L0LH 1VEWA 5KMGA 4DW1A 4YXWG 3U11A 5LA6A 4WFFA 2GHYA 3NR7A 1D5NA 2DJVA 4DR7O 3E86A 2D3OW 4DUYB 1IXBA 2Q69A 1Y74B 4PD4F 3D3QA 2DWEC 2QM7A 3K5OA 4DV3O 1THZA 2EBOA 4D7SA 2E5LO 3ZN1A 2ZQMA 1H8HG 4JYCA 1AILA 3OMAB 5LOVB 4L87A 2ILMA 2ZINA 1F4MA 1EZJA 2UU9O 1VF6C 3HKDA 2UXCB 2UUAO 2QTOA 1B3QA 2PI4A 2Q0AA 4X64O 2WLMA 5LXTB 1GK9A 2WSSG 3G6EV 2A9HA 2ZR2A 2Q9LA 4I0XA 4X1KB 1UJWB 2MW2B 3THOA 1K8AW 4FJCC 4LF7O 2AGAA 1HR0B 1BCCH 5KHHA 4EEQA 4Z1VA 1TAEA 3ETDA 2JK5C 1N32O 3JD0A 4LH6A 3CXHF 3BA8A 2YIAA 4B7KA 4FZ1A 1KUQA 5IWAO 2XHBA 1GN3A 3LSUA 1YJ9V 1EFRG 1T5EA 2P5OA 2WLJA 2QSAA 5KHKA 2YXLA 3JALB 3JSNA 5DEDA 1RSOB 4LFCO 2R9AA 2LQTA 4NTYA 1BZKA 5L3CA 2FKXA 4GLXA 2QDOA 5EZYA 1AP5A 3G71V 1WA8A 4TT3G 2Q0OC 3ASOC 4DV6O 3ML0A 3ZMSA 1NVPB 4AI8A 1VQPV 3OTFA 4GKJB 1YIJV 1QBZA 4DV1B 2ZT9B 3K03A 1PL4A 2Y0PA 1TA8A 5CBGA 2Q7GA 4CS2A 2UUCO 5H2FZ 3C90A 1SRYA 2CH7B 2B5UA 1AJPA 2ZXWB 2PY5A 3OEEG 4LF8B 2YI9A 1NR1A 1R1BA 5C93A 1K7DA 1N4CA 2ZD9A 4QE9A 3LSSA 4P9OA 4X1YB 1AI6A 4E4EA 2IBZH 4IGGA 3H1LH 3T1YO 5IYBO 2NNUA 1FJGO 4FK5C 2PUSA 1H2SB 2YEVA 1FAFA 2IH3C 4BIZA 1M56B 2A0LA 4PA6A 2F4VO 3G6BA 4H44B 2P06A 4WFAV 2W6JG 3SYOA 4I50B 1WNSA 1ZTEA 1AJQA 4PA4A 4LF9O 4JI3B 5J2UB 2BSKA 3VQVA 4NXNO 5LOVA 4G28B 3H1IH 1HNWB 2Y0IA 4G2KA 3OM3B 4MS2A 5DN6G 2RN9A 1FXKA 4OGQB 1ZUQA 2OIEA 5EZYB 1K73W 4XDJA 2EIJB 2CGOA 2WLIB 1JA8A 2Q67A 3RWRD 2UXNA 3LSQA 4DV2B 3ETEA 4WFBV 1VQ5V 3VQWA 2FYUH 4K0KB 5B1OA 4X1IA 1QVGU 4UCOA 2XAFA 2Z0AA 2ZNIA 3E8BA 2EILC 4EFBA 1NKDA 5FPRA 3Q4HB 1GRJA 1QU7A 1V9PA 2CDYA 1O9GA 2DYRB 3FB6C 5HFLA 5LMUO 4ZKIA 5EBMC 3F5WC 4MTFA 1DK1A 1RM1B 3D8CA 4UCRA 3E8HA 5J2TB 3X2QB 3MHSC 4F6EA 3JCZA 4F6RB 4JTCB 4FLXA 3OAAG 4UCUA 3CHXA 4X1KA 2QWQB 4Q20A 2D2CB 4KHPB 1FXVA 1HNZB 3IC7A 4MVUA 2HJDA 4UCSA 1YCIA 1OCOB 3SPGA 3IAYA 3OGCC 5H9CA 1JQ0A 4O2BA 1HWYA 3L74H 2KKWA 3IJ4A 4JASA 4N23A 4HZ3A 5KX5A 3RYHB 3UM7A 3K5LA 1FXHA 1I7FA 4NYKA 2NN4A 3ZMVA 3G67A 1XMQB 1WAZA 4HNAA 1J95A 3CXCU 3DXRB 3H1KH 1Y66A 4UB8Z 4I4TB 2BOCC 2CTWA 3PJSK 2HVJC 4LP8A 5LYJA 4X20B 1URFA 3ZRVA 2F4VB 4LFAO 3ABTA 3CRMA 2RCVA 4DV7O 4X65B 5LHGA 4I5SA 1S5LZ 4UVCA 1K9MW 2YEVB 5KX5B 3K5MA 3FB5C 1VQLV 1NVPD 1CEZA 1Q3EA 3E8GA 1FXKB 2Q8VA 4DR6O 5IWAB 4HYOA 1SQVH 3A0BZ 1Q43A 4QJFB 1N34O 5LHIA 3CS5A 3RYIB 3TETA 1YF2A 5EC1C 4YJ2A 3K08A 4DR6B 1HNZO 1PD3A 1IXMA 4JTAB 2P6JA 4ZOLA 5IE9A 2JEUA 3I56V 5IT9N 2Y48A 3KCYA 3RFRA 4NR1A 2E76B 1Z5WA 4LNUA 1X4TA 1AP6A 3JYCA 4O4LA 4NXNB 3SJBC 1I08A 4JYAB 5CA1B 1WA8B 1Q90D 3BEHA 1MMMA 3E8FA 5LMUB 2BTQA 2ZE7A 3F7YC 3FB7C 3SJAC 1VQ8V 4JYAO 2QWRB 3CRRA 2XAJA 1ZX3A 3J81N 2IJHA 1NQTA 3BABA 3DC6A 2UXBB 4ZI7B 1EN6A 5E1AC 3JSLA 2E75B 5FPOA 4J7ZA 2M7WA 1G4YB 3SYQA 3JAKB 5LGUA 3OFNG 1KKDA 1XEQA 1Z2GA 3CSXA 3QF7A 4R6ZA 1R6TA 1CPYA 2F43G 4RWUA 3JD3A 1N36O 4TV9A 3ZHSA 3N2KA 3MDSA 4H0LB 2O57A 4L8JA 3TXSA 4YIPA 2CH7A 4ABMA 2A79B 5JH7A 4TQDA 4JF3A 4IL6Z 1VQ4V 2JGUA 5B1AC 4X66B 3EVKA 1OCRC 2JEXA 4WF9V 3CC2V 1BGYH 4PDVA 1SQPH 2GTSA 2LFRA 2X6CA 5CB4B 4IHJA 1XHXA 5AG2A 4DR3O 1PM9A 1A32A 1V55B 2AXTZ 2G38A 5FLXN 2A3QA 2F66C 2ZM6O 2GUZA 1ZAUA 1S5HC 5H6QA 1S5JA 1P49A 1WP8A 1OCRB 4X1IB 4PJ0Z 1VF5B 5HFMA 5BMVA 4YIOA 5E79Z 1DTOA 2WLKA 1VF6A 1R6KA 5KHJA 4WBNA 3QO7A 5H5NA 1Y4MA 4IIJB 1YI2V 3MHHC 4X65O 2YDEA 4EKWA 1B06A 3JAMN 4YHHB 3OMIB 2X0LA 3RBZA 4LF5B 3CCMV 2Q68A 2HJFC 1IBLB 4LFCB 3K58A 3D36C 2QKCA 2P7TC 4O4HB 2X6BA 5C8YA 1GN4A 1Y6XA 3F7VC 2OCHA 4LWSB 1NTZH 1FFTB 1SESA 3E22B 4WFGA 4J42A 2K9PA 2DW4A 3UO3A 1X59A 1XUQA 3HKBA 5GONB 4TOIA 5CA0B 4B3SO 2GTAA 3CX5F 1VF7A 5LGNA 1EN4A 5CA0A 1DGSA 1KU9A 2EIMC 4J80A 4LF7B 5D5QA 4KP4A 3AG4B 2PYJA 1JMKC 4Z2WA 3SR2C 4EB6B 4GX2A 2N74A 4MTXA 4DR5O 1BE3H 4U3JB 1Q6IA 1OCZC 4MTOA 1H2GA 4QPJA 1GM8A 3M99B 3D3IA 4YY3O 1WPBA 5KUMA 1WJZA 5A9GA 2DOSA 4FFBB 5KHIA 2W0XA 5BR8O 4LBEC 1BQZA 4CS3A 2UXDB 3CRCA 1YZBA 4YY3B 1O9HA 3H1JH 4O4JB 1KQSU 1TUBA 2FTKA 4ZI7A 1GM7A 2UXXA 4DUYO 1XHZA 3UO2A 2EJ7A 1SQBH 1EM1A 3UKMA 5EYPB 2QGNA 2LFSA 1IBMO 4QPKA 3TCUA 2QE7G 3LDCA 4PHZA 4RUEA 3D36A 3OE7G 4H13B 1XNRO 1M56C 4GX1A 3OR7C 3GVMA 4D7TA 3RYCA 3FD9A 1ORQC 5FNVB 1JJ2U 2JS5A 3JD2A 5IY5C 2LW1A 1IBMB 2EINB 1BHAA 4WFEA 2VQEB 4J9ZB 1W0KG 3ZMZA 3CE2A 3A0RA 4IHJB 4RUFA 4YJ2B 3ZRSA 2XAHA 3ICXA 5H6RA 3OTOO 1MSWD 1NU1H 1XDCA 3GWKC 2XNDG 2YIDA 4JI8B 5GTHZ 4FLYA 4B3TO 3T1CA 4ZOLB 4NVPA 1KMIZ 4DV6B 3T1YB 1JFFB 2AW9A 2WWWA 1AI4A 4CZZA 3ZIAG 1L8DA 4R8CA 3I5DA 5B66Z 3L73H 5LGTA 3E83A 1QLEC 4DO2A 4ZBMA 1P4RA 2EIKC 5B1NA 4BW9A 3QO8A 4LCUC 5TISZ 2ZNJA 1B04A 3FYEB 1Y74A 1YJWV 5CBHA 1EZVH 4FLUA 3LDEA 2OCCC 4LC1A 3ZHUA 3QTCA 3ZHVA 1E1RG 1HP8A 3WFVA 4YHHO 1L1FA 4LF4B 5JVDA 2P4VA 4J11A 4O2AA 4DV4B 3I55V 1E1QG 1KB9F 3T2MA 2YXYA 4H33A 3MAQA 4JV5B 1XNRB 2EILB 2OCCB 5EYPA 4JI2O 3W7WA 1K4CC 4J7KA 3ZEDA 4LF9B 1F51A 2VQFB 2BTOA 3HKCA 4UV8A 5A2QN 2YIBA 1YDXA 3CCQV 1QLEB 3ZX6A 1MA1A 3K9SA 5BR8B 4DRXA 2Q5ZA 3QVNA 4UFZA 4B3MO 2F1MA 3SPCA 1Z5VA 2VRZA 2A7WA 3CC7V 1XNQO 1S77D 3CCVV 2JVDA 3M8AA 1BSMA 5LMNO 3FB8C 4JI4O 4LR3A 2JJ2G 1U97A 2DE0X 3CMEV 2R70A 5IYZB 1R3IC 3P32A 3ABUA 2V7QG 3S3WA 4FM0A 1M4UA 2DWDC 3O65A 2IH1C 4MW8A 1YTFB 3T4ZA 5B5EZ 2JIZG 4A5UB 4PDMA 3CEIA 4AQYB 1RPRA 4X89A 2LW7A 1QHTA 2LGQA 4JI5O 2K1EA 5IYDO 4JI6B 3U0ZA 2UUBB 1G1XB 5JQGA 2YXHA 4P30A 5CA3A 5ITZB 2XUMA 1K5SA 3KKYA 3BCCH 3P3PA 2ZXWC 4GX0A 4C7UA 3B8MA 3W7TA 2ADQB 3BRCA 3JASA 3B40A 5JCOC 4I50A 3APOA 4DV2O 4FFKA 2HG5C 1NTMH 4MVZA 1YXBA 5IJ0B 5L3FA 2DYSC 1NR7A 1TUEB 1RP3B 1AR5A 2EIKB 3DC5A 4BIOA 1LUWA 4QNHB 3AG4C 1HW7A 2EIMB 2R9IA 2N05A 1S0VA 2P67A 2R72A 4QGPA 4MT8A 4DR1O 2ARHA 1AROP 1VQNV 2CUGA 3ZS8C 3VQXA 3WG7C 3JALA 3BFRA 1R73A 3BHPA 2WLLA 4MVQA 2VWKA 4LH7A 4X88A 4GCZA 2EINC 1VIBA 1R3KC 1W0JG 3RYIA 2VQFO 1OJHA 1MOFA 4J10A 2FL4A 4UVBA 2IM9A 4UCVA 4X1YA 4DV0O 1CXZB 1SETA 2R9RB 3KG2A 2W0FC 2WA4A 4DV3B 4JGSA 5L3BA 2E5LB 1GMGA 4X66O 1I94B 5IYZA 3SGIA 3WB0A 1XMQO 5JJNB 2VQEO 5GTIZ 4FFBA 3AG3B 1QVFU 1M90W 5EC2C 3OTOB 1QR9A 4OXSA 3C3SA 4CS4A 5BY1A 2OTLV 4O2AB 2XT9A 4K8ZA 1DLBA 4X9QA 4J9YB 1BL8A 4R7CA 1AI7A 2H3OA 2F93B 1JR9A 4DXWA 4BR6A 4OX9O 4JAUA 1K33A 2RMKB 1WN7A 4JI7B 4NTXA 4FLZA 4I9WA 5EIBD 1ZWIC 4I7ZB 4HAMA 1Q86W 2NLJC 1F4NA 1SS3A 3AG1C 1YVWA 1SQXH 2Q7EA 1S72V 1CP9A 4NB5A 1VQ9V 3AG2C 5CBFA 5LMNB 2UXBO 4XBFA 1F23A 5BXZA 3CB2A 1AB3A 2F23A 2H8PC 3SJCC 1FPOA 1FS0G 3H1HH 3ABLC 1UFIA 4FLTA 2E3CA 1PPJH 1IX9A 3L72H 3RVZA 2JJ1G 3S3XA 2EULA 1W59A 1XOUA 2Q6AA 1SERA 1I5YA 1PL0A 1AJNA 1N33O 4QE7A 1I0HA 3K04A 1MZFA 3OGIB 2WA3A 4KHPO 3BPZA 3U10A 4CH6A 1RSOA 4KFMA 4DYLA 2PF4E 1B6QA 3JD1A 4UV9A 4B3SB 3BY6A 1YEWA 4QIWF 2BOBC 2OWOA 4CC5A 4X64B 1H2KA 4XDKA 2Y69B 3ABKC 3STZC 1QLNA 1M93A 1EBOA 3ABLB 4PDLA 3NXSA 1AR1B 4DR4O 3TGUH 3UQ8A 2WLIA 1YSCA 4FPPA 1NJIW 4ICGA 3OT7A 4Q6GA 2FB5A 4JAVA 1N36B 2QM4A 2B9ZA 4IYHA 4JYBA 1MZEA 4J41A 1BHBA 3KZIZ 3HB3B 4JI6O 1JFFA 4KUMA 4U3FH 3ZHRA 3BA9A 4DUZO 2ZE8A 2QA4V 1KKCA 4O4LB 2EIJC 1Q81W 4O2BB 2CGNA 1KBHA 1JX9A 3N2GA 1OCOC 1NZ6A 3CJHA 3P30A 1R3LC 1N34B 2AHZA 5IJ9A 2Y69C 3ABKB 1N33B 1HNWO 3AG3C 3ABMB 4DUZB 2W6IG 2YS8A 4I9QA 3QG5A 5IJ9B 2OT5A 1W2BU 3ETQA 5EBLC 2P90A 5EBWC 3GB7C 2XAQA 1IBKB 1GTOA 2Q4PA 1MG1A 1SZXA 1WB7A 2V1DA 5JWPA 3CYOA 2HFEC 2H94A 1I5XA 4MVMA 3K57A 3N2GB 4JAAA 2FMLA 3AG7A 1VQ7V 2LP7A 1VQMV 2ODMA 4BAYA 4I4TA 1KP2A 5LP6A 3ZRXA 1NT2B 5FNVA 5KLVH 3LUTB 1NS1A 3TJTA 3K9AA 3B77A 1XI1A 1Q6HA 3ZRWA 4DR5B 2LGWA 1XBLA 2HKOA 2KB1A 3JASB 4JI1B 5J9PC 2OYQA 4DV5O 4DW0A 2EX3A 2Z5UA 3IGAC 5BZBA 2F95B 3F5TA 5KMGB 3J7AU 1PKXA 2XAGA 1XREA 3C3TA 1G8MA 4PI0A 2UXDO 3HR0A 4FIPC 1ZL8B 4PA3A 4JZGA 3B8NA 4UVAA 5JJEB 4N21A 4GKKO 1MSDA 2ZR3A 4JPRA 1L0NH 2YICA 1YTFD 2QR4A 3ZMUA 2PGGA 1H2NA 3HPLC 2WLLB 5D5PA 2DN9A 1VMGA 1YITV 4JYYA 2GUZB 4J7JA 2BE3A 2YI8A 4WFHA 4ZHQA 1RPOA 5LYJB 3A0HZ 4PDRA 1XMOB 3JCUZ 4NXMB 2KG7A 3OUFA 1K5QA 5B3SB 1HR0O 4RQFA 2AZ2A 2A06H 2IJKA 4B3RO 1YJNV 4JI1O 1HDJA 3K0DA 1FFXB 4X20A 3SPIA 3H9VA 3OMNB 1IVSA 1LR1A 1SQFA 2CE4A 3L71H 4GYCB 3L9DA 3CRAA 1OCZB 4H37A 1J5EB 4CBCA 4TV9B 3RVYA 2BSKB 5L3EA 1AR4A 2ZDIA 1M9NA 1U96A 4JI0B 1N0NA 2HR3A 4TSFG 3CCUV 3SYPA 1IBLO 4ASUG 2GDSA 4IT5A 4LNUB 2DYSB 2C2AA 2RQ6A 5DM6V 5L3GA 1Y76A 2N04A 4DV4O 3CPWU 4E2LA 4UXNA 2ZCEA 1RM1C 4BWAA 3SPHA 4IYIA 5LP6C 2Q7HA 2QTSA 2ITDC 4P2ZA 5GONA
chains in the Genus database with same CATH topology
3L71H 3L75H 1L0NH 3CX5F 4U3FH 1PPJH 3CXHF 1SQBH 3L70H 2IBZH 3H1IH 3L72H 1NTZH 3TGUH 3H1LH 3H1KH 1KB9F 1NTMH 1NU1H 5KLVH 2FYUH 1NTKH 2BCCH 1SQXH 1SQQH 1L0LH 1SQVH 3CWBH 3BCCH 1P84F 1EZVH 3L74H 1BE3H 2A06H 1BGYH 3H1JH 1SQPH 1KYOF 4D6TH 1PP9H 3H1HH 4PD4F 1BCCH 3L73H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 H;  3L75 H;  1L0N H;  3CX5 F;  4U3F H;  1PPJ H;  3CXH F;  1SQB H;  3L70 H;  2IBZ H;  3H1I H;  3L72 H;  1NTZ H;  3TGU H;  3H1L H;  3H1K H;  1KB9 F;  1NTM H;  1NU1 H;  5KLV H;  2FYU H;  1NTK H;  2BCC H;  1SQX H;  1SQQ H;  1L0L H;  1SQV H;  3CWB H;  3BCC H;  1P84 F;  1EZV H;  3L74 H;  1BE3 H;  2A06 H;  1BGY H;  3H1J H;  1SQP H;  1KYO F;  4D6T H;  1PP9 H;  3H1H H;  4PD4 F;  1BCC H;  3L73 H; 
#chains in the Genus database with same CATH topology
 3L75 H;  4NXM O;  3DSQ A;  4AQY O;  1M5I A;  3TK1 A;  5KAI Z;  2WLH A;  1LUV A;  4MVS A;  2AHY A;  2ZKO A;  3K06 A;  4CH5 A;  3N2K B;  2ATK C;  4ZIB A;  3ASO B;  4FLW A;  1R6N A;  4DR4 B;  4UUJ C;  2AZ0 A;  1S76 D;  2GSM B;  2MK3 A;  1P7B A;  5KA6 A;  4GUN A;  3TXQ A;  4JI3 O;  1GN6 A;  1YHQ V;  4CH3 A;  5K1P A;  3EHB B;  1FD9 A;  2HHH B;  1Q7Y W;  3ZHQ A;  4K3A A;  2ZE5 A;  3IC9 A;  4TUY A;  2ZIO A;  4IIJ A;  4GT1 A;  1P84 F;  2DQ0 A;  2CK3 G;  2HLD G;  2RJZ A;  1V55 C;  2P4K A;  3ZRW B;  2V4D A;  3K59 A;  3W7S A;  1US6 A;  3G80 A;  3BAA A;  4MVR A;  4JTD B;  1XL6 A;  1GM9 A;  1WB8 A;  5J2U A;  1IUR A;  1H2M A;  1HNX B;  5B1A B;  1GO3 F;  4RQE A;  3LNM B;  2HVK C;  5ITZ A;  2RDC A;  4B7E A;  3HKE B;  3KCX A;  1MNG A;  2ZM6 B;  4DV1 O;  2WAM A;  2X7R B;  3B09 A;  5LBQ A;  2VS0 A;  3K0G A;  4I0X B;  3OD4 A;  1JPX A;  4GZR B;  2ADP A;  1TGO A;  4WCE V;  4MTG A;  1GKF A;  2JS3 A;  1PNL A;  2GV9 A;  1ZSP A;  3OUS A;  4EFE A;  3E2E A;  4DR2 B;  1P7G A;  4KXR A;  4PV1 B;  5IJ0 A;  4LWS A;  2L6L A;  4EB6 A;  2VWJ A;  3G4S V;  1IDS A;  5CN0 A;  4JV5 O;  1NH2 B;  3JD4 A;  4GX5 A;  1BQ0 A;  2DQ3 A;  1WPX A;  4LFB O;  4DR7 B;  4DR1 B;  1VP7 A;  4PI2 A;  3B2E E;  4O4H A;  1ROP A;  5C8Y B;  3CC4 V;  3JAR A;  4I55 A;  4DV5 B;  1BS3 A;  3VOU A;  3W7X A;  1M1K W;  1JCH A;  4FMT A;  4FVM A;  4CH4 A;  5J2T A;  3SPJ A;  2QJ1 A;  4FLV A;  5LA6 B;  1MAB G;  3EFF K;  4B08 A;  3DXR A;  1K34 A;  4CC6 A;  4LF4 O;  4DRX B;  3RT3 C;  2UUC B;  3STL C;  4UB6 Z;  4W4K A;  3FAV A;  3QNE A;  2UXC O;  2X6A A;  3H01 A;  5B1B C;  2BTQ B;  4HNA B;  4LFA B;  2P22 C;  1KYO F;  2IW5 A;  4DV7 B;  4WBN B;  3JAW B;  4U7O A;  3LNN A;  3WB2 A;  1D2D A;  2IU0 A;  3CCS V;  4G27 B;  3R65 A;  1S3J A;  2EJR A;  1N0J A;  1OV9 A;  4LF6 B;  2B1G A;  1FJG B;  3P3N A;  3K3W A;  4FM2 A;  4U3J A;  4JI7 O;  1K92 A;  2YUA A;  2QM8 A;  4BW5 A;  1KP3 A;  1M57 B;  4MVO A;  1E79 G;  3JAW A;  2ZDI C;  3GWO A;  5JCO A;  3CRQ A;  3J80 N;  1V54 C;  3RYC B;  1HNX O;  5FL7 G;  4X62 B;  1VQK V;  5CA1 A;  4PEL A;  3ZHT A;  5L3D A;  2OIG A;  5B1B B;  3UT5 A;  1OHH G;  3A8T A;  3B4S A;  4MSW C;  1XQ8 A;  3ETG A;  4FM1 A;  1BMF G;  1OCC C;  3EXA A;  2CTQ A;  1SA0 B;  1EN5 A;  3LDD A;  2CAZ C;  3JAT A;  3ZJZ A;  2WPD G;  3AG1 B;  3FKS G;  1SA0 A;  5JJJ B;  4OX9 B;  3K79 A;  3VBB A;  2E74 B;  1Y67 A;  4B3T B;  1H8E G;  2IJJ A;  2IU3 A;  2JGD A;  3CD6 V;  2Y4U A;  4PA7 A;  1KD1 W;  3W7U A;  5KHG A;  4LF8 O;  4X8A A;  1QNM A;  1Q6U A;  1GN2 A;  4O4I B;  1WLE A;  4UCT A;  1Q82 W;  4OPA A;  2EZO A;  5CMU A;  2DYR C;  2DMX A;  1JVM A;  2Z3Y A;  3HKE A;  1K3E A;  4R50 A;  4AIL C;  3ABM C;  2M6Y A;  3AK1 A;  3RYH A;  1AVM A;  1LNQ A;  3RW0 A;  1IZ3 A;  2ETN A;  1H38 A;  3RN4 A;  3N27 A;  4DV0 B;  1IBK O;  3R66 A;  4XDL A;  1JOY A;  1QCE A;  1SQG A;  2WLN A;  3E35 A;  3L70 H;  4JI2 B;  3CCR V;  1TVK B;  2ITC C;  2UU9 B;  1NI8 A;  2PZS A;  4TV8 A;  4OPH A;  1SZT A;  3E22 A;  5LHH A;  5JH7 B;  1XIL A;  4TUY B;  1K97 A;  5GW7 A;  3JAK A;  1KC8 W;  3CCE V;  1PP9 H;  2PTM A;  4K0K O;  3MD0 A;  1N8R W;  1WP7 A;  2JRI A;  1XMO O;  3AK3 A;  2GBO A;  2HP8 A;  2PI5 A;  1XNQ B;  1F7Y A;  1TUB B;  3ASN B;  2QWN B;  5BMV B;  3DGE A;  1DF5 A;  1FFX A;  5DEC A;  4DK1 A;  4F4L A;  5KAF Z;  3RYF B;  4NKG B;  3ZCC A;  4LF6 O;  3OR6 C;  4YJ3 A;  5LL6 Y;  1K4D C;  1UPG A;  4DR2 O;  4LFB B;  1DF4 A;  3SYC A;  3VQY A;  1RFY A;  4JZ2 A;  1VQO V;  3JAT B;  4PA9 A;  3WB1 A;  5LP6 B;  4HBN A;  1NTK H;  4GKK B;  1FYJ A;  3O9O A;  1PNM A;  2HEP A;  4ZHQ B;  1PNK A;  5JQG B;  2UUB O;  3UCS C;  1OCC B;  3JAR B;  4I55 B;  5JVD B;  2KG7 B;  1BT8 A;  4F6R A;  4D6T H;  3ZN0 A;  4MW3 A;  4NTW A;  3UT5 B;  4RO2 A;  1G6U A;  1NH2 D;  5IDJ A;  5IYC O;  1D5A A;  3BVO A;  1Q8I A;  3CP1 A;  1XL4 A;  1ENV A;  1VAR A;  1QQC A;  1FKA O;  2QWP B;  2QKS A;  1V54 B;  3QO5 A;  2YIB D;  3Q4H A;  3AG2 B;  2XOK G;  3IFX A;  3OW2 U;  2RNB A;  2Q73 A;  1M57 C;  5LXT A;  3CJH B;  2ZIM A;  3HKB B;  1GAX A;  4B3M B;  2KQX A;  2LJ2 A;  4KL1 A;  1KEC A;  3HKD B;  2CTR A;  2QWO B;  4O4I A;  1QR8 A;  3HKC B;  2LO1 A;  4JI4 B;  3ASN C;  3X2Q C;  3CCJ V;  3CWB H;  1Y76 B;  2XAS A;  5IY5 B;  2NR5 A;  2PYL A;  1H2L A;  3T1H B;  5KUK A;  3FAV B;  1GH6 A;  5B3S C;  1J5E O;  2ZE6 A;  1AI5 A;  4JI0 O;  1Q5O A;  4RAI A;  1FXK C;  5F2V O;  2HHH O;  2Y4T A;  2XTA A;  3SDL A;  4JI5 B;  2B1I A;  4X62 O;  1SF9 A;  3RGB A;  2JGD B;  3OEH G;  4FZ0 A;  3SYA A;  4B3R B;  3WG7 B;  3SJQ C;  1R3J C;  3FX7 A;  3A2F A;  5KA5 A;  4K8X A;  2QKA A;  2YSU B;  4TV8 B;  1VQ6 V;  4AHC A;  4O4J A;  1PV0 A;  4DK0 A;  1NBM G;  4GKJ O;  2BCC H;  5CB4 A;  4BIU A;  1I94 O;  4K35 A;  3FYI B;  2OTJ V;  1TVK A;  3DTU B;  4TWK A;  3PN1 A;  2CTP A;  2YC0 A;  2KSD A;  3AK2 A;  1SKV A;  5EIB C;  3WU2 Z;  3APQ A;  2UUA B;  5EK0 A;  4W4L A;  1ZL8 A;  1JJO A;  3CCL V;  4TQF A;  2EZP A;  2IJI A;  4P9P A;  4DR3 B;  1SQQ H;  1COW G;  3AEI A;  2JDI G;  3M7M X;  1ZLZ A;  5K1X A;  4LF5 O;  1SC5 B;  3T1H O;  1OZ0 A;  2L35 A;  3ZMT A;  4JI8 O;  3RYF A;  3E89 A;  1N32 B;  3K5N A;  3CMA V;  3T4D A;  4Z1M G;  4YJ3 B;  3ZBH A;  3FFQ A;  4U7N A;  2QEX V;  1L0L H;  1VEW A;  5KMG A;  4DW1 A;  4YXW G;  3U11 A;  5LA6 A;  4WFF A;  2GHY A;  3NR7 A;  1D5N A;  2DJV A;  4DR7 O;  3E86 A;  2D3O W;  4DUY B;  1IXB A;  2Q69 A;  1Y74 B;  4PD4 F;  3D3Q A;  2DWE C;  2QM7 A;  3K5O A;  4DV3 O;  1THZ A;  2EBO A;  4D7S A;  2E5L O;  3ZN1 A;  2ZQM A;  1H8H G;  4JYC A;  1AIL A;  3OMA B;  5LOV B;  4L87 A;  2ILM A;  2ZIN A;  1F4M A;  1EZJ A;  2UU9 O;  1VF6 C;  3HKD A;  2UXC B;  2UUA O;  2QTO A;  1B3Q A;  2PI4 A;  2Q0A A;  4X64 O;  2WLM A;  5LXT B;  1GK9 A;  2WSS G;  3G6E V;  2A9H A;  2ZR2 A;  2Q9L A;  4I0X A;  4X1K B;  1UJW B;  2MW2 B;  3THO A;  1K8A W;  4FJC C;  4LF7 O;  2AGA A;  1HR0 B;  1BCC H;  5KHH A;  4EEQ A;  4Z1V A;  1TAE A;  3ETD A;  2JK5 C;  1N32 O;  3JD0 A;  4LH6 A;  3CXH F;  3BA8 A;  2YIA A;  4B7K A;  4FZ1 A;  1KUQ A;  5IWA O;  2XHB A;  1GN3 A;  3LSU A;  1YJ9 V;  1EFR G;  1T5E A;  2P5O A;  2WLJ A;  2QSA A;  5KHK A;  2YXL A;  3JAL B;  3JSN A;  5DED A;  1RSO B;  4LFC O;  2R9A A;  2LQT A;  4NTY A;  1BZK A;  5L3C A;  2FKX A;  4GLX A;  2QDO A;  5EZY A;  1AP5 A;  3G71 V;  1WA8 A;  4TT3 G;  2Q0O C;  3ASO C;  4DV6 O;  3ML0 A;  3ZMS A;  1NVP B;  4AI8 A;  1VQP V;  3OTF A;  4GKJ B;  1YIJ V;  1QBZ A;  4DV1 B;  2ZT9 B;  3K03 A;  1PL4 A;  2Y0P A;  1TA8 A;  5CBG A;  2Q7G A;  4CS2 A;  2UUC O;  5H2F Z;  3C90 A;  1SRY A;  2CH7 B;  2B5U A;  1AJP A;  2ZXW B;  2PY5 A;  3OEE G;  4LF8 B;  2YI9 A;  1NR1 A;  1R1B A;  5C93 A;  1K7D A;  1N4C A;  2ZD9 A;  4QE9 A;  3LSS A;  4P9O A;  4X1Y B;  1AI6 A;  4E4E A;  2IBZ H;  4IGG A;  3H1L H;  3T1Y O;  5IYB O;  2NNU A;  1FJG O;  4FK5 C;  2PUS A;  1H2S B;  2YEV A;  1FAF A;  2IH3 C;  4BIZ A;  1M56 B;  2A0L A;  4PA6 A;  2F4V O;  3G6B A;  4H44 B;  2P06 A;  4WFA V;  2W6J G;  3SYO A;  4I50 B;  1WNS A;  1ZTE A;  1AJQ A;  4PA4 A;  4LF9 O;  4JI3 B;  5J2U B;  2BSK A;  3VQV A;  4NXN O;  5LOV A;  4G28 B;  3H1I H;  1HNW B;  2Y0I A;  4G2K A;  3OM3 B;  4MS2 A;  5DN6 G;  2RN9 A;  1FXK A;  4OGQ B;  1ZUQ A;  2OIE A;  5EZY B;  1K73 W;  4XDJ A;  2EIJ B;  2CGO A;  2WLI B;  1JA8 A;  2Q67 A;  3RWR D;  2UXN A;  3LSQ A;  4DV2 B;  3ETE A;  4WFB V;  1VQ5 V;  3VQW A;  2FYU H;  4K0K B;  5B1O A;  4X1I A;  1QVG U;  4UCO A;  2XAF A;  2Z0A A;  2ZNI A;  3E8B A;  2EIL C;  4EFB A;  1NKD A;  5FPR A;  3Q4H B;  1GRJ A;  1QU7 A;  1V9P A;  2CDY A;  1O9G A;  2DYR B;  3FB6 C;  5HFL A;  5LMU O;  4ZKI A;  5EBM C;  3F5W C;  4MTF A;  1DK1 A;  1RM1 B;  3D8C A;  4UCR A;  3E8H A;  5J2T B;  3X2Q B;  3MHS C;  4F6E A;  3JCZ A;  4F6R B;  4JTC B;  4FLX A;  3OAA G;  4UCU A;  3CHX A;  4X1K A;  2QWQ B;  4Q20 A;  2D2C B;  4KHP B;  1FXV A;  1HNZ B;  3IC7 A;  4MVU A;  2HJD A;  4UCS A;  1YCI A;  1OCO B;  3SPG A;  3IAY A;  3OGC C;  5H9C A;  1JQ0 A;  4O2B A;  1HWY A;  3L74 H;  2KKW A;  3IJ4 A;  4JAS A;  4N23 A;  4HZ3 A;  5KX5 A;  3RYH B;  3UM7 A;  3K5L A;  1FXH A;  1I7F A;  4NYK A;  2NN4 A;  3ZMV A;  3G67 A;  1XMQ B;  1WAZ A;  4HNA A;  1J95 A;  3CXC U;  3DXR B;  3H1K H;  1Y66 A;  4UB8 Z;  4I4T B;  2BOC C;  2CTW A;  3PJS K;  2HVJ C;  4LP8 A;  5LYJ A;  4X20 B;  1URF A;  3ZRV A;  2F4V B;  4LFA O;  3ABT A;  3CRM A;  2RCV A;  4DV7 O;  4X65 B;  5LHG A;  4I5S A;  1S5L Z;  4UVC A;  1K9M W;  2YEV B;  5KX5 B;  3K5M A;  3FB5 C;  1VQL V;  1NVP D;  1CEZ A;  1Q3E A;  3E8G A;  1FXK B;  2Q8V A;  4DR6 O;  5IWA B;  4HYO A;  1SQV H;  3A0B Z;  1Q43 A;  4QJF B;  1N34 O;  5LHI A;  3CS5 A;  3RYI B;  3TET A;  1YF2 A;  5EC1 C;  4YJ2 A;  3K08 A;  4DR6 B;  1HNZ O;  1PD3 A;  1IXM A;  4JTA B;  2P6J A;  4ZOL A;  5IE9 A;  2JEU A;  3I56 V;  5IT9 N;  2Y48 A;  3KCY A;  3RFR A;  4NR1 A;  2E76 B;  1Z5W A;  4LNU A;  1X4T A;  1AP6 A;  3JYC A;  4O4L A;  4NXN B;  3SJB C;  1I08 A;  4JYA B;  5CA1 B;  1WA8 B;  1Q90 D;  3BEH A;  1MMM A;  3E8F A;  5LMU B;  2BTQ A;  2ZE7 A;  3F7Y C;  3FB7 C;  3SJA C;  1VQ8 V;  4JYA O;  2QWR B;  3CRR A;  2XAJ A;  1ZX3 A;  3J81 N;  2IJH A;  1NQT A;  3BAB A;  3DC6 A;  2UXB B;  4ZI7 B;  1EN6 A;  5E1A C;  3JSL A;  2E75 B;  5FPO A;  4J7Z A;  2M7W A;  1G4Y B;  3SYQ A;  3JAK B;  5LGU A;  3OFN G;  1KKD A;  1XEQ A;  1Z2G A;  3CSX A;  3QF7 A;  4R6Z A;  1R6T A;  1CPY A;  2F43 G;  4RWU A;  3JD3 A;  1N36 O;  4TV9 A;  3ZHS A;  3N2K A;  3MDS A;  4H0L B;  2O57 A;  4L8J A;  3TXS A;  4YIP A;  2CH7 A;  4ABM A;  2A79 B;  5JH7 A;  4TQD A;  4JF3 A;  4IL6 Z;  1VQ4 V;  2JGU A;  5B1A C;  4X66 B;  3EVK A;  1OCR C;  2JEX A;  4WF9 V;  3CC2 V;  1BGY H;  4PDV A;  1SQP H;  2GTS A;  2LFR A;  2X6C A;  5CB4 B;  4IHJ A;  1XHX A;  5AG2 A;  4DR3 O;  1PM9 A;  1A32 A;  1V55 B;  2AXT Z;  2G38 A;  5FLX N;  2A3Q A;  2F66 C;  2ZM6 O;  2GUZ A;  1ZAU A;  1S5H C;  5H6Q A;  1S5J A;  1P49 A;  1WP8 A;  1OCR B;  4X1I B;  4PJ0 Z;  1VF5 B;  5HFM A;  5BMV A;  4YIO A;  5E79 Z;  1DTO A;  2WLK A;  1VF6 A;  1R6K A;  5KHJ A;  4WBN A;  3QO7 A;  5H5N A;  1Y4M A;  4IIJ B;  1YI2 V;  3MHH C;  4X65 O;  2YDE A;  4EKW A;  1B06 A;  3JAM N;  4YHH B;  3OMI B;  2X0L A;  3RBZ A;  4LF5 B;  3CCM V;  2Q68 A;  2HJF C;  1IBL B;  4LFC B;  3K58 A;  3D36 C;  2QKC A;  2P7T C;  4O4H B;  2X6B A;  5C8Y A;  1GN4 A;  1Y6X A;  3F7V C;  2OCH A;  4LWS B;  1NTZ H;  1FFT B;  1SES A;  3E22 B;  4WFG A;  4J42 A;  2K9P A;  2DW4 A;  3UO3 A;  1X59 A;  1XUQ A;  3HKB A;  5GON B;  4TOI A;  5CA0 B;  4B3S O;  2GTA A;  3CX5 F;  1VF7 A;  5LGN A;  1EN4 A;  5CA0 A;  1DGS A;  1KU9 A;  2EIM C;  4J80 A;  4LF7 B;  5D5Q A;  4KP4 A;  3AG4 B;  2PYJ A;  1JMK C;  4Z2W A;  3SR2 C;  4EB6 B;  4GX2 A;  2N74 A;  4MTX A;  4DR5 O;  1BE3 H;  4U3J B;  1Q6I A;  1OCZ C;  4MTO A;  1H2G A;  4QPJ A;  1GM8 A;  3M99 B;  3D3I A;  4YY3 O;  1WPB A;  5KUM A;  1WJZ A;  5A9G A;  2DOS A;  4FFB B;  5KHI A;  2W0X A;  5BR8 O;  4LBE C;  1BQZ A;  4CS3 A;  2UXD B;  3CRC A;  1YZB A;  4YY3 B;  1O9H A;  3H1J H;  4O4J B;  1KQS U;  1TUB A;  2FTK A;  4ZI7 A;  1GM7 A;  2UXX A;  4DUY O;  1XHZ A;  3UO2 A;  2EJ7 A;  1SQB H;  1EM1 A;  3UKM A;  5EYP B;  2QGN A;  2LFS A;  1IBM O;  4QPK A;  3TCU A;  2QE7 G;  3LDC A;  4PHZ A;  4RUE A;  3D36 A;  3OE7 G;  4H13 B;  1XNR O;  1M56 C;  4GX1 A;  3OR7 C;  3GVM A;  4D7T A;  3RYC A;  3FD9 A;  1ORQ C;  5FNV B;  1JJ2 U;  2JS5 A;  3JD2 A;  5IY5 C;  2LW1 A;  1IBM B;  2EIN B;  1BHA A;  4WFE A;  2VQE B;  4J9Z B;  1W0K G;  3ZMZ A;  3CE2 A;  3A0R A;  4IHJ B;  4RUF A;  4YJ2 B;  3ZRS A;  2XAH A;  3ICX A;  5H6R A;  3OTO O;  1MSW D;  1NU1 H;  1XDC A;  3GWK C;  2XND G;  2YID A;  4JI8 B;  5GTH Z;  4FLY A;  4B3T O;  3T1C A;  4ZOL B;  4NVP A;  1KMI Z;  4DV6 B;  3T1Y B;  1JFF B;  2AW9 A;  2WWW A;  1AI4 A;  4CZZ A;  3ZIA G;  1L8D A;  4R8C A;  3I5D A;  5B66 Z;  3L73 H;  5LGT A;  3E83 A;  1QLE C;  4DO2 A;  4ZBM A;  1P4R A;  2EIK C;  5B1N A;  4BW9 A;  3QO8 A;  4LCU C;  5TIS Z;  2ZNJ A;  1B04 A;  3FYE B;  1Y74 A;  1YJW V;  5CBH A;  1EZV H;  4FLU A;  3LDE A;  2OCC C;  4LC1 A;  3ZHU A;  3QTC A;  3ZHV A;  1E1R G;  1HP8 A;  3WFV A;  4YHH O;  1L1F A;  4LF4 B;  5JVD A;  2P4V A;  4J11 A;  4O2A A;  4DV4 B;  3I55 V;  1E1Q G;  1KB9 F;  3T2M A;  2YXY A;  4H33 A;  3MAQ A;  4JV5 B;  1XNR B;  2EIL B;  2OCC B;  5EYP A;  4JI2 O;  3W7W A;  1K4C C;  4J7K A;  3ZED A;  4LF9 B;  1F51 A;  2VQF B;  2BTO A;  3HKC A;  4UV8 A;  5A2Q N;  2YIB A;  1YDX A;  3CCQ V;  1QLE B;  3ZX6 A;  1MA1 A;  3K9S A;  5BR8 B;  4DRX A;  2Q5Z A;  3QVN A;  4UFZ A;  4B3M O;  2F1M A;  3SPC A;  1Z5V A;  2VRZ A;  2A7W A;  3CC7 V;  1XNQ O;  1S77 D;  3CCV V;  2JVD A;  3M8A A;  1BSM A;  5LMN O;  3FB8 C;  4JI4 O;  4LR3 A;  2JJ2 G;  1U97 A;  2DE0 X;  3CME V;  2R70 A;  5IYZ B;  1R3I C;  3P32 A;  3ABU A;  2V7Q G;  3S3W A;  4FM0 A;  1M4U A;  2DWD C;  3O65 A;  2IH1 C;  4MW8 A;  1YTF B;  3T4Z A;  5B5E Z;  2JIZ G;  4A5U B;  4PDM A;  3CEI A;  4AQY B;  1RPR A;  4X89 A;  2LW7 A;  1QHT A;  2LGQ A;  4JI5 O;  2K1E A;  5IYD O;  4JI6 B;  3U0Z A;  2UUB B;  1G1X B;  5JQG A;  2YXH A;  4P30 A;  5CA3 A;  5ITZ B;  2XUM A;  1K5S A;  3KKY A;  3BCC H;  3P3P A;  2ZXW C;  4GX0 A;  4C7U A;  3B8M A;  3W7T A;  2ADQ B;  3BRC A;  3JAS A;  3B40 A;  5JCO C;  4I50 A;  3APO A;  4DV2 O;  4FFK A;  2HG5 C;  1NTM H;  4MVZ A;  1YXB A;  5IJ0 B;  5L3F A;  2DYS C;  1NR7 A;  1TUE B;  1RP3 B;  1AR5 A;  2EIK B;  3DC5 A;  4BIO A;  1LUW A;  4QNH B;  3AG4 C;  1HW7 A;  2EIM B;  2R9I A;  2N05 A;  1S0V A;  2P67 A;  2R72 A;  4QGP A;  4MT8 A;  4DR1 O;  2ARH A;  1ARO P;  1VQN V;  2CUG A;  3ZS8 C;  3VQX A;  3WG7 C;  3JAL A;  3BFR A;  1R73 A;  3BHP A;  2WLL A;  4MVQ A;  2VWK A;  4LH7 A;  4X88 A;  4GCZ A;  2EIN C;  1VIB A;  1R3K C;  1W0J G;  3RYI A;  2VQF O;  1OJH A;  1MOF A;  4J10 A;  2FL4 A;  4UVB A;  2IM9 A;  4UCV A;  4X1Y A;  4DV0 O;  1CXZ B;  1SET A;  2R9R B;  3KG2 A;  2W0F C;  2WA4 A;  4DV3 B;  4JGS A;  5L3B A;  2E5L B;  1GMG A;  4X66 O;  1I94 B;  5IYZ A;  3SGI A;  3WB0 A;  1XMQ O;  5JJN B;  2VQE O;  5GTI Z;  4FFB A;  3AG3 B;  1QVF U;  1M90 W;  5EC2 C;  3OTO B;  1QR9 A;  4OXS A;  3C3S A;  4CS4 A;  5BY1 A;  2OTL V;  4O2A B;  2XT9 A;  4K8Z A;  1DLB A;  4X9Q A;  4J9Y B;  1BL8 A;  4R7C A;  1AI7 A;  2H3O A;  2F93 B;  1JR9 A;  4DXW A;  4BR6 A;  4OX9 O;  4JAU A;  1K33 A;  2RMK B;  1WN7 A;  4JI7 B;  4NTX A;  4FLZ A;  4I9W A;  5EIB D;  1ZWI C;  4I7Z B;  4HAM A;  1Q86 W;  2NLJ C;  1F4N A;  1SS3 A;  3AG1 C;  1YVW A;  1SQX H;  2Q7E A;  1S72 V;  1CP9 A;  4NB5 A;  1VQ9 V;  3AG2 C;  5CBF A;  5LMN B;  2UXB O;  4XBF A;  1F23 A;  5BXZ A;  3CB2 A;  1AB3 A;  2F23 A;  2H8P C;  3SJC C;  1FPO A;  1FS0 G;  3H1H H;  3ABL C;  1UFI A;  4FLT A;  2E3C A;  1PPJ H;  1IX9 A;  3L72 H;  3RVZ A;  2JJ1 G;  3S3X A;  2EUL A;  1W59 A;  1XOU A;  2Q6A A;  1SER A;  1I5Y A;  1PL0 A;  1AJN A;  1N33 O;  4QE7 A;  1I0H A;  3K04 A;  1MZF A;  3OGI B;  2WA3 A;  4KHP O;  3BPZ A;  3U10 A;  4CH6 A;  1RSO A;  4KFM A;  4DYL A;  2PF4 E;  1B6Q A;  3JD1 A;  4UV9 A;  4B3S B;  3BY6 A;  1YEW A;  4QIW F;  2BOB C;  2OWO A;  4CC5 A;  4X64 B;  1H2K A;  4XDK A;  2Y69 B;  3ABK C;  3STZ C;  1QLN A;  1M93 A;  1EBO A;  3ABL B;  4PDL A;  3NXS A;  1AR1 B;  4DR4 O;  3TGU H;  3UQ8 A;  2WLI A;  1YSC A;  4FPP A;  1NJI W;  4ICG A;  3OT7 A;  4Q6G A;  2FB5 A;  4JAV A;  1N36 B;  2QM4 A;  2B9Z A;  4IYH A;  4JYB A;  1MZE A;  4J41 A;  1BHB A;  3KZI Z;  3HB3 B;  4JI6 O;  1JFF A;  4KUM A;  4U3F H;  3ZHR A;  3BA9 A;  4DUZ O;  2ZE8 A;  2QA4 V;  1KKC A;  4O4L B;  2EIJ C;  1Q81 W;  4O2B B;  2CGN A;  1KBH A;  1JX9 A;  3N2G A;  1OCO C;  1NZ6 A;  3CJH A;  3P30 A;  1R3L C;  1N34 B;  2AHZ A;  5IJ9 A;  2Y69 C;  3ABK B;  1N33 B;  1HNW O;  3AG3 C;  3ABM B;  4DUZ B;  2W6I G;  2YS8 A;  4I9Q A;  3QG5 A;  5IJ9 B;  2OT5 A;  1W2B U;  3ETQ A;  5EBL C;  2P90 A;  5EBW C;  3GB7 C;  2XAQ A;  1IBK B;  1GTO A;  2Q4P A;  1MG1 A;  1SZX A;  1WB7 A;  2V1D A;  5JWP A;  3CYO A;  2HFE C;  2H94 A;  1I5X A;  4MVM A;  3K57 A;  3N2G B;  4JAA A;  2FML A;  3AG7 A;  1VQ7 V;  2LP7 A;  1VQM V;  2ODM A;  4BAY A;  4I4T A;  1KP2 A;  5LP6 A;  3ZRX A;  1NT2 B;  5FNV A;  5KLV H;  3LUT B;  1NS1 A;  3TJT A;  3K9A A;  3B77 A;  1XI1 A;  1Q6H A;  3ZRW A;  4DR5 B;  2LGW A;  1XBL A;  2HKO A;  2KB1 A;  3JAS B;  4JI1 B;  5J9P C;  2OYQ A;  4DV5 O;  4DW0 A;  2EX3 A;  2Z5U A;  3IGA C;  5BZB A;  2F95 B;  3F5T A;  5KMG B;  3J7A U;  1PKX A;  2XAG A;  1XRE A;  3C3T A;  1G8M A;  4PI0 A;  2UXD O;  3HR0 A;  4FIP C;  1ZL8 B;  4PA3 A;  4JZG A;  3B8N A;  4UVA A;  5JJE B;  4N21 A;  4GKK O;  1MSD A;  2ZR3 A;  4JPR A;  1L0N H;  2YIC A;  1YTF D;  2QR4 A;  3ZMU A;  2PGG A;  1H2N A;  3HPL C;  2WLL B;  5D5P A;  2DN9 A;  1VMG A;  1YIT V;  4JYY A;  2GUZ B;  4J7J A;  2BE3 A;  2YI8 A;  4WFH A;  4ZHQ A;  1RPO A;  5LYJ B;  3A0H Z;  4PDR A;  1XMO B;  3JCU Z;  4NXM B;  2KG7 A;  3OUF A;  1K5Q A;  5B3S B;  1HR0 O;  4RQF A;  2AZ2 A;  2A06 H;  2IJK A;  4B3R O;  1YJN V;  4JI1 O;  1HDJ A;  3K0D A;  1FFX B;  4X20 A;  3SPI A;  3H9V A;  3OMN B;  1IVS A;  1LR1 A;  1SQF A;  2CE4 A;  3L71 H;  4GYC B;  3L9D A;  3CRA A;  1OCZ B;  4H37 A;  1J5E B;  4CBC A;  4TV9 B;  3RVY A;  2BSK B;  5L3E A;  1AR4 A;  2ZDI A;  1M9N A;  1U96 A;  4JI0 B;  1N0N A;  2HR3 A;  4TSF G;  3CCU V;  3SYP A;  1IBL O;  4ASU G;  2GDS A;  4IT5 A;  4LNU B;  2DYS B;  2C2A A;  2RQ6 A;  5DM6 V;  5L3G A;  1Y76 A;  2N04 A;  4DV4 O;  3CPW U;  4E2L A;  4UXN A;  2ZCE A;  1RM1 C;  4BWA A;  3SPH A;  4IYI A;  5LP6 C;  2Q7H A;  2QTS A;  2ITD C;  4P2Z A;  5GON A; 
#chains in the Genus database with same CATH homology
 3L71 H;  3L75 H;  1L0N H;  3CX5 F;  4U3F H;  1PPJ H;  3CXH F;  1SQB H;  3L70 H;  2IBZ H;  3H1I H;  3L72 H;  1NTZ H;  3TGU H;  3H1L H;  3H1K H;  1KB9 F;  1NTM H;  1NU1 H;  5KLV H;  2FYU H;  1NTK H;  2BCC H;  1SQX H;  1SQQ H;  1L0L H;  1SQV H;  3CWB H;  3BCC H;  1P84 F;  1EZV H;  3L74 H;  1BE3 H;  2A06 H;  1BGY H;  3H1J H;  1SQP H;  1KYO F;  4D6T H;  1PP9 H;  3H1H H;  4PD4 F;  1BCC H;  3L73 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...