2IC1A

Crystal structure of human cysteine dioxygenase in complex with substrate cysteine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
185
structure length
185
Chain Sequence
VLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Insight into the Mechanism of Human Cysteine Dioxygenase: KEY ROLES OF THE THIOETHER-BONDED TYROSINE-CYSTEINE COFACTOR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 53
structure length 185
sequence length 185
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ic1A00
4QM9A 1LR5A 2F4PA 1EYBA 3RPQA 1HW5A 1ZREA 4IERA 3U10A 5I8YA 2XL9A 1QXJA 3S7EA 4ONUA 3EHKA 5FLJA 3H9AA 5I91A 1J3RA 5FQ0B 2PHLA 1O3SA 1ZZ7A 4YRDA 2Z69A 5CVRA 3QOPA 5LRRA 1X82A 2PQQA 5I0SA 3UKVA 4F8AA 4D7SA 4I2OA 4XF4A 4TLFA 2XLAA 2IC1A 5KHJA 4EWAA 5BV6A 5I8TA 3RYRA 5I0TA 1FXZA 4I09A 3ES1A 3UKNA 2OZ6A 5AVPA 1ZZ6A 1CX4A 5J48A 4I02A 4CYDA 5JSOA 4LLOA 4MGKE 4A2UA 3RDIA 2WC2A 1YFXA 2D40A 1NE6A 2EA7A 5BPXA 4XFIA 2IXIA 4Q29A 3D0JA 3HIFA 3RNSA 2BGCA 2B5HA 1XE7A 2ATFA 2PTMA 2GC2A 4HZFA 4AXOA 3MPBA 3PLQA 3N4MA 3I7DA 4HN0A 5KHHA 5I0RA 4IEYA 2MNGA 2Q30A 3E6DA 4XF0A 1NXMA 4IEUA 1UIJA 3B02A 3H8UA 1OI6A 2Q4SA 3O14A 3NKTA 1Q3EA 4LTAA 1PM7A 4UXAA 1J59A 1UW8A 3PVBB 1X8MA 5KHIA 3KCCA 4Q0PA 3ZDSA 5FDBA 2OZJA 1RGSA 2ETEA 3LWCA 3SCGA 1CAWB 4P9GA 5JCTA 3L2HA 3SXWA 5FLIA 3LAGA 4MV2A 4WVZA 4D7TA 4K8FA 1DGWA 3CO2A 2H6CA 4KWLA 2CAUA 2PA7A 3FFQA 5K8SA 4FAHA 5CU1A 3KGLA 1Y9QA 1RUOA 3VHRA 3KMHA 4PIXA 4OLLA 4E2SA 1FI2A 3E6BA 3EO6A 3HT1A 3NVCA 3C3VA 3WW2A 1IPJA 1ZZ8A 4QXKA 2BNNA 2V09A 3GBFA 3IDBB 3WW3A 2GU9A 3LA7A 2I45A 2K9ZA 1ZRDA 5FLHA 1O5UA 2MHFA 4Q0QA 2Q0AA 2GC1A 3FHIB 1ZRRA 1LKNA 3E5QA 1O7FA 3E5UA 1OMIA 4I0AA 3WW1A 4MZUA 1CAVA 2XGXA 2D93A 4JVAA 5F1RA 3OCPA 1ZRFA 4YARA 3OF1A 3SMHA 2GH2A 4JTOA 4XEZA 1UD1A 1DGRA 2XKOA 4EWEA 3USSA 4Q0UA 2PAKA 4KU7A 4XFFA 2GAUA 1Q5OA 4QX5A 5LRSA 4XF9A 1J3QA 2XKPA 4F7ZA 1UCXA 1RTVA 4AQ6A 3CF6E 2D5FA 3FX3A 4LUMA 1J3PA 2QJVA 4UBGA 2QNKA 1LRHA 2ET7A 4J1XA 4XETA 4QMAA 4Z07A 1DZTA 2K0GA 3UKTA 4DINB 4O9EA 2QCSB 2ZCWA 2OPKA 3IIAA 2XLGA 5E16A 1YWKA 3TNQA 4FBFA 4AVCA 5JR7B 4X6RB 2Q1ZB 3NJZA 4ZU7A 5I93A 1VP6A 2IXLA 2PAEA 2ET1A 1J58A 2O8QA 2Z2SB 4E2QA 2EAAA 4KWJA 3U11A 2IXCA 2IXKA 1NE4A 3OTFA 3EBRA 1RC6A 3H3ZA 3D82A 2Y0OA 1RL3A 3LOIA 2P17A 4HBNA 4MUVA 5J3UA 4Q0SA 1SQ4A 2ZKLA 2VPVA 3ROUA 1YFYA 1XRUA 4YNIA 3FWEA 4AVBA 5I8SA 3U0ZA 3CEWA 4META 4XF3A 4QGLA 2BEOA 2O1QA 1YFUA 3SCHA 5E1RA 4R52A 2D5HA 3I54A 1Y3TA 2QVSB 2HKXA 1CAUB 4MX3A 4WBBA 3MYXA 3RYPA 3H1MA 1SFNA 4UBHA 3KSCA 3JZVA 3HQXA 1X8EA 1YUDA 3BB6A 3NL1A 3ES4A 1U12A 5JAXA 2N7GA 2KXLA 2XLFA 4WZCA 4EWDA 2BYVE 3OD0A 5C8WA 4EROA 1VR3A 1YHFA 2QDRA 3RZZA 2GC3A 4PJYA 1UPIA 5LEJA 2H6BA 3BPZA 2OYZA 1I5ZA 3BCWA 4AQ2A 1CAVB 3DV8A 1CAXA 3LA2A 1CAXB 4IEVA 4RD7A 4HVRA 2WFPA 2XHKA 2B8MA 4QM8A 3PNAA 3IBMA 5FPXA 5FPZA 4EV0A 1ZZ9A 1WLTA 2B9UA 5HI0A 4KU8A 4XFBA 4IEQA 5JSPA 4HSJA 4R8HA 4HMZA 4LA3A 2IXJA 5T3NA 4OFGA 4HSLA 4XFCA 1ZRCA 1I6XA 3S7IA 2PFWA 4IESA 4ZU4A 3ST7A 3R6SA 5FCCA 1SEFA 4LUKA 3NSTA 1O5LA 1VJ2A 4KL1A 4LEJA 1UIKA 3FZ3A 2CGPA 3SCFA 1FT9A 3MZHA 1WGPA 3E5XA 4IEPA 1CAUA 1H1MA 2FMYA 4IETA 2PYTA 1NZCA 3KGZA 4FT8A 2IXHA 3H1YA 3RYKA 1DZRA 3LA3A 4HVQA 2UY8A 1JUHA 4NVPA 3CLPA 3G7DA 5BY5A 4BHPA 3DL3A 3CJXA 1QXRA 3H1WA 3I59B 3M3IA 4XF1A 4Q0VA 4N9IA 1OFNA 2CV6A 1H1IA 3NW4A 2EVXA 4J1WA 5KHGA 3LZZA 3FJSA 4L11A 4BIFA 4IEOA 1V70A 4E2GA 4IEXA 4QGNA 4LULA 2OA2A 1O3TA 4XFAA 4N9HA 5JSRA 4AVAA 4HLTA 4I0BA 3WW4A 4L2NA 3D0SA 2E9QA 4XFHA 4MGZE 3CL1A 3BALA 3TNPB 3BU7A 3M70A 4LA2A 1O3QA 4ORFA 4I3PA 5I0UA 2UYAA 4H7LA 4MH0E 1G6NA 1L3JA 2VQAA 1RUNA 1PMIA 2FQPA 3DKWA 3IDCB 1OD5A 4HN1A 5BUVA 4B29A 5EZWA 2C0ZA 2PAMA 4JV4A 4Z82A 3ELNA 5KBFA 3H7YA 5C6CA 4ZU5A 1ZZCA 1ZX5A 1O4TA 2XL7A 3S0MA 1TQ5A 3DN7A 3H3UA 2H0VA 4BH9A 4BYYA 5CADA 4QGMA 3FE5A 3SHRA 3E6CC 3MDPA 2HJIA 4GULA 5BXXA 4MGIE 2UYBA 1IPKA 1NYWA 1ZZBA 3EJKA 1XE8A 3H7JA 1X7NA 4YYOA 5LEKA 3ACLA 5D1IA 1WA4A 4IEZA 1EPZA 4XFGA 1LB2A 1Q43A 1J1LA 3QACA 3GYDA 3I59A 4FAGA 1GQHA 1O3RA 4PIZA 2CAVA 2GZWA 2PHDA 1QWRA 4HVOA 3ETQA 1YLLA 3HT2A 5KHKA 5FQ0A 4I01A 1YFWA 4MGYE 5EFUA 4KWKA 2UY9A 3IWZA 1ZVFA 2MPFA 1CAWA 1EP0A 5J7MA 3H50A 3EQEA 2DCTA 1ZNPA 3E97A 4IEWA 4YSFA 3OGJA 1EY2A 4JTNA 4O9GA 2GC0A 4X6QB 2VECA 1CGPA 1QY4A 1GQGA 2BNMA 2BNOA 4PIYA
chains in the Genus database with same CATH superfamily
4KBBA 2MEV2 2F4PA 3LIHA 1XNTA 2VZSA 1KS4A 4Q2FA 2ZGKA 5FZIA 3U10A 1CZTA 3GGLA 5I8YA 3BUCA 1QXJA 3CJIC 3POYA 3POJA 1H6XA 2P6CA 3EHKA 3MF6A 1V6IA 3LFIA 5CISA 4DO0A 2RJKA 2XXZA 4CE8A 1WD3A 3LB9A 4CP1A 5BNPB 4HKOA 2WA3A 1SBFA 4PDWC 5CVRA 4NIAA 3QOPA 4N53A 2PQQA 1UMHA 3T4VA 1W8WA 1D4M1 2R6QA 3AYDA 1QJU1 3VBFB 4YW2A 3KQ4B 4D7SA 5C3RA 1EV12 2ZEXA 1DQ5A 1CQ9A 4OZOA 1C4RA 3K51A 2DFBA 2XUEA 3V65A 5T50A 4ASLA 4EN8B 2YFUA 3WP4A 4D8MA 2NP0A 3GM8A 5BV6A 4AK3A 1GWMA 3VDDC 1C3HA 1SZBA 4HOOA 4C8DA 1J83A 5AVPA 3JCIA 2WDBA 2D6LX 1W3XA 1U5YA 3NAPA 5A80A 1GNYA 3WCRA 4B4RA 4QQ2A 5TSWA 4FPKA 5BNOA 3MF9A 1YJKA 2A6VA 2R073 1AXZA 1IZ3A 1PVC3 1UWWA 2WC2A 1MZ6A 1WWYA 1YFXA 2EA7A 5DG1A 4B4PA 1BLZA 1BKZA 1W90A 1YJLA 5BPXA 3AP9A 5CFCB 5A3TA 3HIFA 3K4ZA 5CZKA 2BGCA 3WX5A 1RUE1 1UU4A 3AYAA 4XURA 3HQUA 1AX2A 3KF5A 1XE7A 1FMD1 2I74A 2JXAA 3I3EA 1LODA 3MPBA 4QB6A 2ARAA 4HKLA 3VHPA 2W1SA 1G9AA 1M06G 3I7DA 2VCCA 1H4GA 2WYFA 4XF0A 2P37A 2V5YA 3KT1A 4P9IA 5FV3A 4AGVA 4N90A 4IEUA 1FOD2 2Y0IA 5LW9A 4DB5A 1QJX3 1OI6A 2DDUA 2RDSA 3ZXGA 3CBNA 4BQ1A 2JIGA 4QX0A 4M0NA 4PHZA 4OHXA 4BK5A 2ZEWA 3N9PA 3APBA 1OUXA 3PURA 4LOSA 4U2AA 1KFUL 5C3PA 1O8SA 2A1XA 4ZXKA 1TVGA 3KCCA 2FZ1A 2RE9A 3S30A 4YZ2A 2K46A 3AMPA 1W6MA 3ZDSA 3DXUA 5FDBA 1W8NA 3OB8A 3ZFFB 2ETEA 5L9RA 1VAKA 2DWRA 1CAWB 3SCGA 4QX7A 1VB2A 1B09A 1AR91 4QT6A 3LAGA 4FOYA 4HANA 1HDKA 1EUUA 4Y3OA 3P5BA 3N7JA 5SV8A 2H6CA 2FMDA 1RUI3 1JMUB 1CN1A 4AOCA 1W8OA 2JKXA 2X10A 3BODA 3GALA 2FDHA 1FNZA 5F5AA 5EHDA 3VZOA 5FZ9A 2B9VA 2G9ZA 4FQZA 1GQPA 4CXWA 1FPN3 2B42B 3LSDA 4XIKA 4QU1A 5GJ6A 3VBOC 4DFSA 1JZ7A 4RA0A 5FK7A 5K8SA 5FXWA 1N1TA 5CU1A 1X33A 1XPWA 4E27A 3ZMNA 2JDYA 4O7XA 2A6XA 3I2GA 1RUH1 2BVVA 5FYYA 4D69A 1WLDA 4PIXA 5JOZA 4FCAA 4LBQD 4LO5B 3HT1A 4DY3A 4JKKA 3H8RA 1RUF1 2B39A 2QQMA 2QQOA 2ZGSA 5FYUA 3WW2A 3WG1A 3WDYA 2A73B 1UNBA 4QXCA 1CD3G 3M7AA 1B35C 2VMDA 4R4XA 4ZS2A 3ZXKA 5FMOS 2BNNA 2JJ6A 1CONA 5DZFA 4FTSA 4M4RA 1WA6X 3UGGA 4LBMA 2WNUB 3V56A 2BWAA 5D8AB 1LOGA 2EIBA 2KR2A 1ZRDA 2RMU2 4ATFA 2QQKA 3B7MA 4JGYB 1XXNA 3BYWA 4Y20B 1ZBA1 4BE3A 4DEVA 3NJYA 1AR93 2WZR1 1ZRCA 2CDOA 2D97A 4KGGA 2XG3A 3E5QA 3ZVXA 2JKBA 1F8VA 4XDOA 3RQ0A 2KA3A 3WW1A 1EAH1 5FZOA 1UZZA 1HJFA 2JWPA 3PUHA 1DF0A 1RUF3 5C5UA 1ZRFA 2DV9A 4XZUG 4XMIA 4Q4Y2 4CEYB 2IFWA 2RS53 4KWUA 2XWBB 4OMDA 4Q4Y1 3LE0A 3LPGA 3E1F1 1DQ6A 2JG8A 4YG3A 1GFF2 1UD1A 4XIOA 3OUHA 5FZ7A 3AP5A 2ZX0A 4EWEA 1XNDA 3T08A 3RZMA 1DBNA 2ADEA 4KU7A 4PT6A 5ABJA 2X29A 3HNMA 5IT6A 4F3JA 4YZ4A 1YIFA 4AEKA 4ET7A 4DUWA 1PK6C 5HBAA 3OBRA 4XQWA 5LRSA 1L7RA 1QH7A 1WUVA 1YNAA 1MQTA 3QBQA 4KI5M 5C8CA 4COWA 5JOXA 3V0BA 1CJPA 3M3OA 1VALA 4XE9A 4UW4A 2GALA 1JYNA 2BOIA 2D5FA 5FZOB 1W6OB 4BK4A 3DECA 1W39A 2O14A 4KMQA 5ACA1 3H42B 2R071 1VRH3 2AACA 4DOUA 3ZYIB 2CY6A 4QMAA 1DZTA 1NCRB 1PM4A 2CU5A 2ZGNA 2J42A 4PQ9A 4FTBA 1SDDB 1PVXA 4HXCA 4COYA 2FHRA 2PN5A 3AMQA 1YWKA 3TNQA 1OUSA 1EV13 4AHYA 5FBZA 3ZSLA 3DPRB 2VCAA 3PVOA 4R4ZA 3SNMA 3OBAA 1MR5A 2VZPA 4QB1A 2YPJA 2JDAA 4WM7A 5EWSA 4BQXA 3W5NA 3VKFC 1AL0G 2W2IA 3DYMA 3U11A 1H2MA 2IXCA 1NE4A 5I8TA 2XQXA 3EBRA 4CCEA 1RC6A 2TEPA 4AHXA 2OUHA 5FK8A 2XBO1 2Y0OA 4YGBA 1RL3A 5JXHA 2VO5A 1JXNA 3U37A 4R9AA 3ZSKA 5AFEA 3VD4A 5FREA 1VAVA 1WW7A 5JDBA 2ZKLA 3ROUA 1YFYA 1DQ0A 1XNAA 2WQ8A 2YYOA 3K2OA 1V9U2 3AX4A 1GV9A 3T2OA 4AVBA 4RFT0 1BQPA 4U36A 2JDKA 4FPFA 5LK5A 5F2SA 4WVMB 2WZPP 2YPDA 2OKXA 2RDQA 4LIVA 1SLLA 4FPCA 4FPLA 3UT0A 2D5HA 4OHZA 4CCNA 4CDXB 4BM8A 3I54A 1FX5A 3H8XA 2VZRA 2JG9A 2WBKA 4IV1B 5A32B 2BZDA 5C8CB 3B94A 1TMF1 2AEZA 3NAPC 1AYN2 4MOAA 2J1SA 5DQ0A 3WHUA 2W95A 4URAA 5FY7A 3MYXA 5FY9A 1Y4WA 1HRI1 1RUI1 1SFNA 1VRH2 2PLV2 1SBEA 1MS1A 4I3GA 1SFPA 1XU1A 2B45X 1VRBA 2Z4FA 3GF6A 1AR92 4Y1VA 5A1LA 3HQXA 3HPNA 1C8M2 1U5ZA 2ZAAA 4Y4RA 5D8AC 1RUE2 2BOJA 3QCWA 2GMPA 1Z7S1 4ES8A 3W58A 4NAMA 3TOJA 1PO23 1R081 3ES4A 4RHV3 3ZFEA 2YV8A 2BYVE 3INAA 2VZUA 3OD0A 1VR3A 1YHFA 1CPNA 1LECA 1ZBA3 1AL21 2WZ8A 1AR83 1IPSA 3VBUC 1UPIA 5IHRA 1PK6B 5GLVA 5A1AA 1EUTA 2WFF1 3HNBM 4TYSA 3U1XA 3KHCA 3EYPA 4UYBA 2QZ3A 4LT5A 1RB8G 1CAVB 1MS5A 4PCRA 1JHNA 4IEVA 2RVAA 4RD7A 2VVFA 1HQNA 1XNCA 3ACHA 5FPXA 3MICA 4CU7A 2B46X 5A3MA 4GJZA 1UU6A 4L9BA 2JDNA 3T0AA 2ADDA 5FYMA 5CEHA 5AFBA 5KXBA 4UT5A 5BNPC 4KU8A 1GLHA 4QQLA 5APAA 2L9LA 5LA2A 4XFBA 3LEGA 3AJYA 4BQYA 5KC5A 4Q4V2 5FY0A 5BNNB 4E8DA 4Y5SA 5G05L 4AFDA 4OFGA 1OKOA 1F35A 4HSLA 4XFCA 4XW3A 4LITA 5DDJ3 2PFWA 3S7IA 4W65A 1R092 3AJZA 1PO13 2D6OX 4ITCA 4GMP1 1MVEA 4W6XA 3KV5A 4E4SA 3NSTA 1SPPB 4LEJA 5IWFA 4CCOA 2WAAA 3OGVA 4XAEA 2VU9A 4RR3A 3SCFA 3TEXA 1VBD2 4GWJA 3VKLA 4HK9A 4BMEA 1C8M1 4AFMA 4DUXA 1I5PA 4FFFA 5T5PA 3NKGA 5A3WA 1SLBA 1HRV2 2RM23 3JUUA 1HB2A 2YGMA 1NUKA 1S2EA 1UOFA 4A45A 5CBLA 3L2YA 4BXFA 5FWJA 1H8TB 1UX6A 1Y9GA 1XYOA 4CSWA 5KR7A 3ZFGC 2ZHLA 1JUIA 2B7YA 5K7PA 2W52A 3BOPA 4XUQA 1TMF3 1UY2A 4BWOA 4G9SB 3RZLA 4XUNA 1LU1A 4YWAA 3WQ7A 1DZRA 2XQRA 1ZYBA 4O61A 1JUHA 1GSLA 1Q8VA 1FATA 3PDQA 4AVTA 3CLPA 1GP5A 3DL3A 2GNDA 3AYEA 1UU5A 3OGGA 3N9OA 1UYZA 5JPNB 1AR62 3H1WA 3MFAA 1RUC3 3LD8A 1MS9A 4A6SA 4CCCA 1DDLA 4N9IA 4AEDB 1OOPB 2CV6A 2WRAA 4MG2A 4IV1C 1H1IA 3NW4A 1BMV2 1S0FA 4J1WA 1HV0A 1PMHX 3WV6A 1AR82 2WR9A 3GZTB 5JIUA 4MXWA 2ID4A 1QJX1 4E2GA 4Q4X2 5JZGB 4LULA 3AKPA 1ULFA 1O3TA 1QJU3 1IS4A 1FOD3 4XILA 2R30A 3JU9A 4XFAA 5CFCA 3AL6A 1JTZX 5DPNA 2JEMA 2BP6A 3AZZA 1JOPA 1KS5A 4HLTA 3B9IA 4I0BA 2W46A 2EXJA 3TBDA 2QQVA 1C57A 3WW4A 4CPBA 4L2NA 2RJLA 3GZUC 2ZEYA 4N43C 5CFDB 2BU9A 2WNUA 3BALA 3M3EA 1O3QA 1FNYA 4NWWA 4TLGA 3I49A 2DVGA 3FN9A 4WM7C 3KHBA 2LALA 2UYAA 3ZYRA 4MH0E 1G6NA 3K77A 2ZBJA 4Y5Z0 5LA1A 1JYXA 1Y9MA 1Z78A 2J1TA 3FC0A 4CP2A 1OH3A 1IS5A 1CVNA 1ULGA 2WLQA 3M3QA 1WMXA 3I3DA 1GMMA 1OD5A 4Y22A 3ZSJA 2HWF1 2AREA 5LA0A 3X29B 3ZKUA 1X36A 1SMVA 2R072 3OUJA 3C2UA 2WT1A 5LA9A 3RZJA 2PAMA 3VBHB 4JV4A 2P3IA 5KBFA 3O0WA 5LY2A 4ZKTB 1ZZCA 1F9KA 5L9BA 3S0MA 4NE9A 1TQ5A 3DN7A 4BYYA 3Q8CA 3I2FA 4YG0A 2E63A 1DP0A 3O0XA 3TN91 4BMBA 3VBRA 2AC1A 4RR3B 2TUNA 3ZFEB 2RMU1 2A6ZA 4GULA 2ILMA 4MGIE 2UYBA 2BTVC 1IPKA 1EAH3 2W68A 1LGCA 5EYXA 3I2OA 4YFWA 4E4ZA 4PBPA 5IAXA 1X7NA 2RM21 3VV1A 5DZEA 2FDGA 4MHRA 5A3OA 1APNA 4OMCA 1S55A 4UFLA 4HL0A 5LEKA 1NCQB 2ZZQA 1WA4A 5D1IA 2G4IA 1F31A 1O4ZA 4XFGA 3PVEA 4FAGA 1IKQA 2GNBA 4EZHA 1SFYA 1GZCA 1V0AA 4PIZA 1O3RA 2HWD1 2GZWA 2PHDA 4YVWA 5HCHA 2VCBA 3GXUA 2C9AA 1HLCA 5K0UA 1LOFA 1YIPA 3HT2A 4A6OA 5KHKA 1RUC1 5EPAA 3H3LA 5LBFA 3CU7A 1FYUA 3IAPA 1COV1 4X8NA 4KWKA 4DRVA 1LOAA 4DRRA 2I2SA 4LQRA 4WVWA 3R4UA 4CDUC 2D6NA 1RUH3 2DVBA 5FZ4A 3DPRA 3T2TA 2EICA 3H50A 4IE0A 1TME3 4NUBA 4Q26A 3E97A 4DUVA 2SLIA 3I4IA 1EY2A 5FZKA 4EJRA 4O9GA 2GC0A 2YBSA 4FPEA 4Q27A 4BIOA 4BQ2A 3CNAA 3WD5A 1VPHA 1ASJ2 2BNOA 1VBE1 3N3HA 3S5AA 1DU3D 2RV9A 1ENQA 1HRV3 1LR5A 1N1VA 1UL9A 2RM22 1K5MB 3JD72 1OA2A 1HW5A 1H8TC 4XZPA 3NMBA 1ZREA 2VW2A 4JGZB 3PL0A 2VC9A 2O0OA 2CL2A 1RUD2 4IERA 2VULA 4LORA 5AVAA 4PDWB 1W2NA 4AEJA 3HBKA 3ZXFA 2ZKNA 1J3RA 3NNMA 3MV01 4AI8A 5FQ0B 1O3SA 4YRDA 2Z69A 3HBZA 4I0WB 5LRRA 1X82A 4N53B 1W8FA 2KD7A 3FMGA 2GNTA 3WNPA 3JQWA 4XXAA 4I2OA 3BTXA 4LR4A 4Q4X1 4FFGA 1H2NA 1BVVA 1S2KA 4Y1UA 2NYYA 2NZ9A 3GNEA 3Q9OA 1VLNA 4LMFA 2HWF2 4DXRA 4FXKB 2CSGA 1REEA 5LY1A 4A7ZA 2J1RA 3R4SA 3A0KA 3OY8A 2KM2A 5J96B 1IG0A 1OOPA 1JYVA 3IM0A 3LKJA 5EV7A 2UWAA 4I02A 1TNFA 4XQ4A 1G9BA 5JSOA 4LLOA 5FP7A 4GH4A 4MGKE 3FLTA 1N3QA 1WCDJ 5A3UA 3VD5A 4LHKA 3NNGA 3Q8BA 1CIWA 4XFIA 2IXIA 3VDAA 1Y43B 4CP9B 2LROA 4OI0A 4ZONA 3RNSA 2Y8KA 5IK5A 3AK0A 1AZDA 5D2AA 3VBFC 3OPZA 2PTMA 3W20A 3UL2A 3L9JT 4OCTA 1GICA 1RUG1 3WF2A 2OQ6A 4L97A 4AXOA 1RMU1 2J1EA 1WW5A 4TWTA 3VGIA 3IMNA 1VBB2 3N4MA 1PO21 3M8LA 2QE3A 1ENSA 5KHHA 5IVCA 4IEYA 4QDRA 1DGRN 4DIQA 1NXMA 4NHKA 1W2AX 4QXHA 1UIJA 2D3PA 2RDNA 1RXGA 4LTAA 1PM7A 2D6KA 3J8F3 2ZX1A 3H8OA 2Q8DA 1OA3A 4YLZA 1RUI2 3PVBB 4LE3A 4D6SA 4WM8B 5L19A 3O1RA 2VMFA 1W6NA 5DAXA 1RGSA 5L7OB 2VAUA 4B7KA 1YQ2A 2RJ2A 3NRUA 1I9RA 4H3WA 1H6YA 2PHFA 1R093 2WS93 2OS2A 1TG7A 2EALA 4YVSC 1C5HA 5FLIA 5A7PA 2W87A 5DDJ2 4GA9A 4HPKA 4D7TA 1DGWA 3SH5A 4Z92B 1Q8SA 1E5HA 4KQ7A 2A7AA 1VBA2 4F83A 4ZZ8A 2DCKA 2X53S 3J8F1 3ZXJA 5A32A 3MW3A 3PIJA 4PLMA 4QKDA 2ORXA 4XXPA 3NNLA 1Y9QA 1DYOA 3VHRA 1MS4A 1DG6A 2GDFA 5FZGA 3VHOA 3Q8EA 3VDCA 3EO6A 4UAPA 5IATA 3NVCA 1ODMA 2BRTA 1SLAA 4H2AA 3LEIA 1QJZA 3C3VA 5CFCC 3JD71 3AKTA 3PJQA 5DAVA 1S0IA 5FZAA 3VZLA 3ZFGB 4UW6A 5BNNC 3WUCA 2VOTA 2VUCA 1UY3A 3ZMOA 3GBFA 4RHV2 1YQ6A 4PLNA 5HXMA 5DAQA 2P3YA 1ND3A 1ACCA 2WQ4A 3IDBB 3LA7A 3WW3A 4AQTA 4S2DA 3EB7A 3KVBA 1GOFA 1PGW2 4CEWC 1W0OA 3C7FA 2MHFA 4A4AA 3RG0A 4GB32 4QX8A 1OF3A 4Q4Y3 2GC1A 1LEDA 1FV3A 1BXHA 4CCJA 5A1FA 1ZRRA 1VE0A 4R9CA 1K5MC 1K5JA 1O7FA 2QBXA 1OMIA 4I0AA 4COZA 2R062 1CAVA 2ZGQA 2XGXA 3CZJA 4XHBA 4AFBA 3UYJA 5FUNA 4LHLA 5FPAA 1V6KA 1Q8QA 2IUWA 3KS7A 3AKQA 5FYIA 3GCWA 4JDOA 1JYCA 5GALA 2JX9A 3SMHA 2GH2A 3VD7A 1UYYA 2Y26A 4XTMA 4W4ZA 1W0PA 4E9KA 3HVDA 4XUOA 2DBIA 4WM8A 4OVEA 3USUB 1H2KA 1WD4A 5DMYA 3PU8A 4RGGA 4A3ZA 4QPIC 3RMXA 4IGQA 1AR71 1H9WA 3WF0A 1YCIA 4NIIA 1ND2A 4AL9A 1NA1C 2JDUA 4XUPA 2Y34A 3BI3A 4IV3C 2DVDA 3CHXA 1Q5OA 4XFFA 5A33A 3ETPA 2XVKA 2JENA 4QX5A 4XF9A 5DABA 5HCBA 3WY6A 5FO8B 3UNPA 4F7ZA 4W8JA 5IVVA 1FV2A 1UCXA 2CTVA 4YM0A 1FPN2 2CNAA 3WF1A 5AC93 5A7QA 1HQWA 4LBOA 1NXD1 2P3KA 4LUMA 2QJVA 3VDDB 4UBGA 1M4WA 1LRHA 2NPIA 1CJDA 2YB7A 3TRSB 4Z07A 3ABZA 3FLPA 3UKTA 2VGDA 3VBHC 4DINB 4O9EA 2WSVA 4LBKA 3IPVB 3MLKA 1YQCA 3D4KA 1MZ5A 2VQ0A 1WCKA 4GALA 5FYSA 4FPGA 1BEV1 4AGRA 2WZR2 4P9XA 4TXWA 3FBYA 1W3VA 4X6RB 1YO8A 1US3A 1N47A 1SBDA 3U4XA 4XCAA 1QKQA 4ZU7A 3N9MA 1BCXA 1RMU3 4CU8A 3FUOA 5I93A 5JXJA 2VBPA 1HB4A 2IXLA 2GMEA 2Z2SB 4KBZA 3BVCA 1KJLA 3I2HA 5GZGA 5JOYA 4QPWA 2JD9A 4OHWA 4LK6A 1GYKA 3W5MA 4QKNA 4QHBA 1VBE2 1J59A 4JDNA 3H3ZA 4BQWA 3I2IA 5FMOL 3ZYHA 4P9LA 4AVVA 3AP4A 3QH6A 3V0BB 1MEC1 1SACA 5E6HA 5T55A 1VBB3 3O1PA 2YMZA 4CDWA 4CDQA 4HBNA 5J3UA 4FSJA 1SQ4A 3WVJA 1I1EA 2HWB1 4IE7A 5FZ3A 4COVA 1RVF1 4AHWA 4DY5A 1W8TA 2XWJB 1CZVA 1U5IA 5I8SA 4WV8A 1S0CA 5C9AB 4JDMA 1Q56A 1BYHA 3U4SA 3JXSA 5A3PA 4META 1JN2P 4QGLA 4XF3A 2BEOA 3WNXA 3UGHA 5H9RA 1AYM1 5C5TA 1S0DA 5KXEA 5FYZA 1R1ZA 2QUOA 2VTXJ 2ZGRA 1Y3TA 4Q8KA 5FBJA 2LM3A 1LJ7A 4CCDA 4XPVA 4WZFA 3HD8B 3KCXA 1E57A 1RUF2 5FP9A 3DEMA 5JMCA 4MX3A 5DAPA 1QJX2 4BISA 4NWVA 3KCYA 1QXPA 2VG9A 2Y6KA 5JXGA 1SG3A 1GOGA 4MGSA 1NCRC 4UBHA 4EN0A 4B1LA 1UX7A 5FMDA 3KSCA 1GR3A 3K4DA 2X05A 1ND2B 2V72A 3ZR5A 5CG8A 1AXKA 1CR7A 2DCYA 1X8EA 4XC9A 5FZ0A 2JB8A 3NL1A 4QQPA 2FDIA 4HFSA 4ISRA 1O6UA 4XQDA 3ZN6B 1H0BA 4E4DX 2ZJCA 4B3NA 4OZXA 1UAIA 2D44A 2WAOA 1XB9A 4EWDA 3VUOA 1MVQA 4FI9A 3TYJA 2XHNA 2Y6HA 1UXZA 1QOTA 4YW4A 2GC3A 3TN93 4PJYA 2CHHA 1WW6A 2HYKA 2H6BA 1CIYA 2ORZA 3BPZA 3POGA 4CA9A 3C7OA 3VBOA 3BGAA 4AQ2A 3DV8A 1CAXA 1HB1A 3LA2A 4LKEA 4XBLA 3MIEA 5FKCA 2WFPA 4CTEA 2B8MA 3ACIA 1LHNA 1AR61 1BHGA 3A4UA 3IBMA 1UF2C 1DLLA 5GLWA 3THDA 4CEWA 1ZZ9A 4QX3A 1SLIA 1WLTA 3PMSA 1A3KA 1LOEA 4MSVA 2B9UA 1JU3A 5F3IA 3U14A 1JU4A 5JPMB 4QQOA 4IEQA 4AG4A 2VBDA 1FOD1 4HMZA 5CKMA 4NHMA 4LA3A 4LBNA 1IQDC 5A7NA 5A6XA 1I6XA 4BOWA 4ZU4A 4QPGC 5I0DA 5FCCA 3ZFFA 4V2VA 2UWBA 3V0AA 2UURA 3AB0A 5C9AA 3C7EA 4LUKA 2PHXA 4NIHA 1R1A1 4YPJA 2EIEA 1JZ3A 1XBFA 3N9QA 3UK9A 3VBUB 2CGPA 3Q8FA 1MACA 2VZOA 2RR13 4HPKB 2WUHA 5FTTC 3WOGA 3SQOA 5CG9A 4QDSA 2R061 1W6QA 3N36A 2V73A 4CDWB 5C33A 1QMJA 3BU0A 2VTFA 1QQP3 2X09A 2MEV3 3BTZA 3DYPA 1PIV3 4K7JA 4AFAA 3MZHA 2EXIA 3E5XA 3I3BA 4Y33A 2BGOA 4L8QA 4P9JA 3TWIA 1CAUA 1H1MA 3GZAA 1U5XA 4N7IA 5T5OA 1ZM1A 3MLLA 4JHZA 2JIJA 5C4WC 2R32A 4IETA 5FXXA 4IE4A 1WLCA 5L7OC 1R64A 3FHAA 5A7OA 3H1YA 4JGYC 2HEYF 1XNBA 2JDHA 4JHTA 2XJUA 3V0AB 2UY8A 3R05A 1IKPA 1R091 2BERA 1OH4A 4NVPA 5A3LA 3KD4A 3PTRB 4MHUA 3HAGA 3KLSA 1PVC2 2ZGPA 3U07A 4XF1A 1GZTA 3ZN4A 5A70A 3WSOA 4E4HA 1D0HA 3OD4A 2EXKA 4DXZA 3DGTA 3CDZB 3WR0A 5FZBA 1BBT1 2VQUA 2AH2A 3RVHA 4BIFA 4IEOA 3ALQA 3CJIB 5B4NA 5JR2A 1B35B 3CIHA 2A70A 2TBVA 5K0UC 1OPMA 5FMCA 1GZ9A 2FCTA 2OA2A 1QHDA 2ZMNA 3VKOA 1POV0 2XJRA 4CP9A 2AEYA 1COV3 1ND2C 5CIRA 2E7AA 2VQTA 3K48A 3GCXA 1SDWA 3C7HA 5FJKA 5HV4A 5DUUA 2E9QA 5F5CA 1K3IA 1PK6A 2ZA9A 4UOJA 1E5RA 2HWE2 1ND3B 5DXDA 1V6NA 2XJPA 3DXTA 4RN5A 3TAYA 4AI3A 1IGOA 1U0AA 1AX1A 1XYPA 2WNVA 3NQHA 4H7LA 5F39A 3THCA 2VQAA 3B5LB 1WKYA 5A7WA 3AP6A 4S2GA 2A71A 1YRZA 1BZWA 3EXUA 4JRLA 1URXA 4Y22B 3AL5A 1OLMA 3LPFA 4HN1A 1GOHA 2F4LA 1RINA 1OLQA 1AL22 1NQDA 3MPPG 5EZWA 4CDWC 1LHWA 3WDWA 2FCUA 2P1BA 4FFHA 3K3OA 1POV1 1D4M2 3U78A 1ZX5A 2JECA 3RSJA 3B00A 4BH9A 1QDOA 1OVPA 2H0VA 2WO3A 2Y6FA 3AMMA 2BFUL 5GKAC 3SLIA 4D7YA 1W9FA 3MI8A 3AVSA 4IXLA 2ERFA 2AENA 2PELA 3E6CC 5FYHA 4P9YA 3ZPYA 1YQ8A 3KWVA 1CWPA 5DN2A 3ZXDA 2YBPA 3H7JA 2P6HA 3WNMA 1AVBA 2DURA 2MEV1 4GH4B 1UN1A 3IMMA 5FYCA 1OA4A 5KWRA 4YZ1A 1UOJA 3VD9A 2AYHA 4Y4YA 1A6CA 4QDQA 1Q43A 4CDQB 3QACA 3GYDA 3I59A 2GP5A 1XNKA 1HRI3 1XC6A 1NCRA 1LCLA 2CAVA 3IB3A 3VKMA 4HONA 4NIGA 3ETQA 4BU2A 1WLWA 1UMIA 3J7MA 5FQ0A 3MV11 4I01A 1HIXA 5F2WA 4M00A 1JH5A 3AZYA 3J7HA 4NMIA 3WP3A 1ZBE3 1KJRA 2UY9A 3NJVA 4XBQA 1W9TA 1IOAA 1NG0A 1ODNA 2G9GA 2W5FA 1EPWA 3BIWE 3ZFEC 3N7MA 2Q1MA 4Y1YA 2IZWA 4WM7B 5F3CA 2ZXQA 3ZIXA 2HWD2 3EQEA 3HJRA 3LFMA 1ZNPA 4O65A 4OI2A 5EP9A 2GH8A 3VBUA 4LOTA 4IE6A 1DQ4A 4CCMA 3N7LA 2BNMA 4AF9A 2ZX3A 3POEA 4NR1A 2Y6JA 4QKFA 4PIYA 4QM9A 1Q8PA 3K46A 3MIGA 5IJRA 4AR2A 2C4XA 2HWC3 5F32A 1PIV1 2LS6A 2XL9A 2IWGB 3S7EA 3A0NA 4ONUA 3J26N 1YEWA 1C1LA 1GBGA 5FLJA 1NX9A 5I91A 1UOBA 3BTYA 1LHVA 4AI1A 4FP2A 4CCKA 5EJZB 5JZGA 3AZWA 5K4LA 1ULEA 3VDBA 4D94A 1S1AA 5GZCA 2WLPA 5CNAA 3SH3A 3UKVA 3ZDVA 4BDVB 4J6GA 5IUQA 4YZ5A 1UKGA 3OBZA 4XF4A 4TLFA 5C9AC 2XLAA 1F15A 1ZA7A 2IC1A 4UFMA 2WINB 1QDCA 3R0RA 5IVJA 2WSUA 5KC6A 1HXS1 1IS3A 2ZX2A 3T30A 3LEKA 1K5MA 3U75A 2ZOEB 1LHOA 1OQEA 2BWCA 1D4M3 3Q8AA 4I09A 4YGEA 3ES1A 3UKNA 1W8ZA 3VZMA 1CX4A 1KEXA 3J7NA 3NWKA 2G9FA 4CYDA 2YC0A 1JYIA 4Q4W2 4A2UA 1RUG3 2D6MA 3P6BA 5BNOC 2R041 2D3RA 2XJQA 2ZGTA 4GD4A 3SISA 5FYVA 2D40A 1NE6A 1Z0HA 2DVFA 2XBO3 3PUAA 5M0TA 2HWC1 4LKDA 3GJBA 5C4WA 3D0JA 2DBNA 4LO7A 3J4UH 3AFGA 2ZHKA 3KF3A 5B2GB 5J1XA 2B5HA 2DUOA 4FPHA 2ATFA 2VCMA 1C28A 3PJYA 3FFZA 2VZ1A 4PBOA 3PLQA 1MQTB 2DCJA 2WWSA 3N35A 1MEC2 4HN0A 4IV3A 5A6YA 4IE5A 2ZACA 2MNGA 3E6DA 4P00B 2JICA 3WHTA 4K9SA 2DUPA 1YQ5A 2W92A 3ZYJB 2BBAA 3M4FA 2WO2A 4JZRA 5J09A 3B02A 3H8UA 4XTPA 2Q4SA 1D0GA 2ARBA 3JB4C 5GLZA 3TB0A 2W94A 1LENA 1A8MA 3HNYM 3RWNA 5EIYB 2FDKA 3GBGA 1JS9A 2W1WA 1DCSA 4FOWA 2PMWB 1R083 1OD3A 3LSEA 4QPIA 3LWCA 2E53A 1LGNA 4P9GA 3I3MA 3VBFA 1OKQA 1QJY3 5FKBA 3L2HA 1W04A 3HMYA 3SXWA 4ARXA 4MV2A 4UW5A 4K8FA 4LKSA 3S5QA 1V6JA 3CO2A 4JKMA 5FMBA 5IK4A 1ENRA 1VB4A 1VBC2 4Q5OA 4YGCA 5EJ1B 4PI0A 2CAUA 3QD6A 3HR9A 4L92A 5C71A 3MUY1 3PUIA 3KGLA 1RUOA 3ZXLA 3B3QE 4QX2A 1SLCA 1S0GA 5KXDA 4OLLA 4GB31 2SBAA 2VOWA 1MS3A 1PZ8A 1QJY1 1S2BA 2VNGA 3BOWA 2EIDA 2RS32 2QQUA 5FZLA 4D0QA 2AGSA 4ZXEA 5BNOB 1IPJA 3WXPA 5BNNA 1LGBA 4QX1A 1E5SA 4S2HA 3K3NA 3ZYBA 3ZYFA 2WFF2 4XHXA 4AGGA 4NO4A 3VZNA 5F9TA 2A3XA 4K21A 4Q4V1 4M0HA 5F5IA 4GMP3 4NRMA 3VBRB 3ZYPA 2I45A 2K9ZA 2HWE1 2P3JA 4Z8BA 5FLHA 3HN3A 1O5UA 4Q0QA 1OLRA 2Q0AA 4JKLA 5DDJ1 2GN3A 1RUG2 4AVSA 2R043 1R082 3AXEA 4AWDA 3T1LA 1A8DA 3AXDA 3IN9A 5FO9B 2VZQA 4MZUA 4QKBA 3DYOA 2D93A 2QQLA 1XQNA 1YI9A 3J8F2 4JVAA 3OY8B 4S2FA 3OCPA 5F1RA 5K9YA 2WT2A 1PGL1 4YARA 5GZFA 4CEYA 1NQJA 4ARYA 1W9YA 3OF1A 3B93A 3R4DB 5BNQA 2W0XA 3AKRA 1S0EA 1OPOA 4RS5C 4JTOA 4CXYA 5FJHA 3NO8A 2E7QA 1FMD2 1DGRA 1BBT3 1EV11 2E7TA 1HN0A 2VD7A 1KFXL 4RGKA 3USUA 5AC92 1W28A 4Z2AA 3MW4A 3USSA 1QOOA 5A7SA 5CFDC 3ZPOA 2D43A 4GZ9A 2NQYA 2PHWA 2XMLA 5FZCA 3ACFA 2VM9A 4HK8A 5C70A 1LULA 5J36A 2RS12 1W2OA 4BQ3A 4Y1ZA 1Z7S3 1AXYA 1AF9A 1FMD3 4GQ7A 1J3QA 3HN1A 4LKFA 1JYTA 5FXZA 1K42A 3FHQA 5FWEA 4WVVA 1QEXA 3V64A 3AZXA 1O59A 2VUJA 3CF6E 1KITA 4H55A 2RS31 4JX0A 1QOSA 2VMEA 3VBSC 1PVC1 2WIIB 3KQRA 4D6RA 4IGOA 3ZO0B 3ZSEA 5JOWA 2ET7A 1D2QA 2HWD3 1RHI3 4XETA 2Y6LA 4C1XA 1QNWA 2R49A 4AAXA 4AI0A 2K0GA 4OUSA 2W39A 1O91A 5BNPA 4W50A 2ZCWA 1W6NB 2FCVA 2OPKA 1TNRA 1ZBE2 2XLGA 3IIAA 4XCBA 5ABJC 2BQPA 3AFKA 3RZGA 3KT7A 5JR7B 1VBC1 2C6SA 3WINE 2YC4A 4FXGB 1R1A2 2UU8A 2BPA2 3NJZA 3PMEA 1LHUA 5FFOC 1PNGA 2RMU3 1VP6A 2PAEA 3OUIA 4M3CE 4SLIA 3SEEA 5CAZA 1X9PA 2GNMA 1RJ8A 2W1QA 4KWJA 3PU3A 3OTFA 3POBA 4UF0A 3WDXA 1AYN1 4Q1PA 5EQUA 3WF4A 4AZZA 4C0BA 2YU1A 2HBUA 3AZVA 5FZMA 4AI2A 3D82A 1F2NA 5H9SA 3AMHA 4CU6A 4K1ZA 1QU0A 3MGUA 3T3YA 3T2PA 2FD8A 4JGZA 1GUIA 1OLME 3LOIA 2P17A 4NRPA 4Q0SA 2E26A 2VPVA 4YM2A 1T6BX 4QHZA 1Z7S2 1XRUA 4YG6A 1TME2 1PGSA 1MZEA 5LB6A 4LE4A 4RL7A 4P5HA 3WG2A 3POIA 2XJTA 3ZSMA 3I97A 1AYM2 1OT5A 3ENRA 3K75B 3SCHA 5E1RA 3ASIA 5JI7A 5SV5A 5A6ZA 4MO3M 3P1IA 4BPZA 4PQQA 1OFSA 4QD2A 3ZR6A 3KVAA 2E6VA 2ENRA 2Y64A 2QVSB 3P3NA 3RJ2X 4M3CF 3I2JA 2HKXA 2RDRA 1SCSA 2ES3A 2VR4A 4FP3A 1CAUB 1W6QB 5J37A 4WBBA 3LDRA 1XSRA 4CDQC 3RYPA 5HCFA 3H0OA 2DFCA 4GKYA 3NV1A 3BKZA 4XJAA 3SKVA 4YFZA 4GWNA 3MW2A 3JZVA 3MIFA 3A23A 1SHWB 2VZTA 2RS51 2WL1A 3BB6A 3GDBA 4EYUA 3ZX7A 4CXXA 2F17A 1COV2 3ZKYA 2VMCA 4LLFA 3IAQA 4YW3A 2XR4A 4AQSA 1U12A 4INDA 2N7GA 4WZCA 3IIIA 5FY1A 3LF7A 3FL7A 1HV1A 3RZZA 1ULOA 2DF7A 2XVLA 5LEJA 3MBWA 5L73A 5HXVA 2W9XA 4NHYA 2OYZA 1I5ZA 1LOBA 1ASJ1 3BCWA 3UETA 1S0JA 3N7KA 2A3YA 1CAXB 1RUJ3 2NM1A 3OEBA 3RGBA 5JMOA 1JYWA 2JDMA 4NHXA 1TE1B 5FPZA 1W99A 4EV0A 4XMAA 5IVBA 1Y7BA 4FPYA 3WQ1A 4CUAA 2VE1A 5HI0A 3ITQA 2ZGOA 4G4FA 4JQRA 4BQ4A 1BEV3 1BMV1 5JSPA 1QH6A 4R8HA 4AFCA 1UY4A 4K3UA 3W21A 1TZOA 2XONA 4Q1RA 2IXJA 4TN7A 4KNCA 4GWMA 2OIIA 2VNRA 4IESA 1V6OA 3ST7A 2D6PA 4LHNA 3LQCA 5EJ3A 2TNFA 3R6SA 1C1FA 1RJ7A 4CUGA 2V4VA 3AKSA 1JHJA 1GP6A 2PHRA 3I8TA 3PUSA 3O0VA 5T5JA 4MVTA 3UV9A 1O5LA 2VW0A 2X8KA 1PX4A 2RHPA 2JD4A 1PIV2 1UIKA 3PUQA 1IQAA 3FZ3A 4FOQA 1IG3A 5IYYA 4HG6B 3QH7A 1SLTA 5GLUA 3AC0A 3OSDA 4V2WA 2DU1A 2NN8A 2C5DA 1V6MA 3D5OA 4A44A 1K45A 2Q5TA 4J25A 3LDKA 2AZ5A 2BV4A 1UYXA 1RUD3 4XJUA 1QGLA 2Y6GA 4DXTA 2HLEA 2DTWA 1FPN1 1LEMA 2WWUA 3OPTA 4QB2A 4UFHA 2D7FA 3NV4A 2PYTA 1NZCA 4B4QA 1WCSA 2VL4A 4FT8A 3IDEA 1WMEA 3ZFFC 5LK7B 1TME1 1OQDA 5LBEA 3THPA 2VW1A 5FZEA 3I2KA 2A75A 1HQLA 2Z42A 4CDUA 3NJXA 1NA1B 2ZPXA 2I07B 4B7EA 1RUH2 3G7DA 4M3CB 5T52A 1AR72 2Z5WA 4H7MA 3B69A 3CMGA 3I59B 2VXRA 1OF4A 3M3IA 3OPWA 3OGSA 4K6BA 3RI9A 4Z1VA 5HPOA 1A78A 1OFNA 1ONAA 2JE8A 5FP8A 2YG0A 4Y1XA 2BFUS 1QQP2 2PQSA 5JUVA 2VNVA 3VD3A 2X5IA 3GBWA 4L11A 3THTA 4MXWB 2A6WA 3TEWA 1UZWA 2JDPA 1F4HA 1L7LA 1LNSA 1NY72 1O8PA 2WS91 3BTAA 5D8AA 4OULA 2K2SA 4C0HA 1REFA 5C4WB 2OQ7A 4AVCA 5JSRA 5IFPA 4K40A 1HKDA 2JB4A 1UOGA 2XB6C 2AUYA 4UFKA 2Q1FA 1C5IA 4P14A 1ST8A 4XFHA 4MGZE 4K20A 2WNOA 3CL1A 1PGW1 2YFZA 4FQ4A 4LA2A 2IFRA 4NRQA 2BW8A 3TNPB 1P8JA 2WNUC 4I3PA 5FAXA 3VBRC 4OUEA 1ZRIA 2QQIA 4XUTA 1L3JA 1NCQA 1QJU2 2HBTA 2A3WA 1OXCA 1PMIA 1W06A 4P02B 1RUNA 4DZGA 3CKHA 1W9SA 2OPWA 1NAEA 1DFQA 3MHZA 4A41A 5BUVA 4CU9A 5T5LA 5LASA 1JZ6A 3UJOA 4B29A 1KDKA 2C0ZA 1AUYA 1VIWB 1RHI1 2WNEA 2JG8B 4Q4W3 2ZHNA 4DS0A 5LZ6A 3VBHA 3ELNA 2GSYA 1AYM3 5ISLA 4ZU5A 4IQPA 1HXS3 1O4TA 4KG0A 1UYPA 3WNOA 1AHSA 1DQ2A 5E88A 5F8PA 1E5IA 3B9CA 1STMA 3VLBB 1PO22 3ZM8A 3FE5A 4FVVA 4I30A 3ZOIA 2FDFA 3MDPA 1J1TA 4UWDA 1US2A 5E89A 1ZZBA 3EJKA 4UFJA 2ARCA 2VH9A 1XE8A 3O1SA 4JCKA 1VAMA 5FZ6A 1W9WA 1XOYA 2PLV3 5ERLA 3ILNA 2CWSA 2ZS6B 4AI9A 4OHVA 4COUA 4Q8LA 1F4AA 4NHLA 4IEZA 1HN1A 5H9QA 1LB2A 1VBA1 1NLRA 4BQ5A 1J1LA 4E8CA 3MO4A 1A34A 5E8AA 1GQHA 4P08A 3JBG1 2D3SA 2JG8C 3WCSA 4DPNA 4LBLA 3JQXA 4WM8C 1PGL2 4HVOA 1AJOA 4FO9A 4QHOA 1KGYA 4IUGA 2YGLA 4ES9A 1LOFC 1W8UA 2Y33A 1OVSA 4MGYE 3ILRA 3GJAA 2C24A 4YW5A 1ZVFA 1POV3 1UZ0A 2HH9A 2PHUA 4AE2A 2YXSA 2MPFA 2GN7A 1EP0A 3WG4A 2D98A 3JBG2 5LBCA 1RHI2 3VL9A 3WNLA 2DCTA 3DPRC 3ZXEA 4YSFA 4RFRB 4AW7A 5JWPA 4NN0A 4YGDA 2WA4A 4JTNA 4Q4V3 1GKBA 3D3AA 4X6QB 3WUDA 4LO4B 3WDTA 3IKWA 1FT9A 5ANNA 1TMF2 1REDA 3D8CA 2ZGLA 4OI4A 1EYBA 3RPQA 3ATGA 4K1YA 4R9BA 4OI1A 3WQ0A 4CP0A 2VMHA 1OC1A 3RFRA 3NAPB 1VBB1 3NNFA 4YM3A 2RR12 1UZVA 3T4HB 3PVNA 1QIQA 4N8MA 2RS13 2XJSA 3H9AA 3WNKA 4BA6A 4C1WA 1LOCA 5FPBA 5CB7A 1LTEA 4OHYA 3KV9A 4GAZA 2PHLA 1ZZ7A 1N3PA 2XVGA 3UESA 1UO9A 1VBD3 4LHSA 3A22A 4F8AA 5I0SA 1VMHA 4L0PA 4PF1A 2WZR3 1UY0A 4N43B 4TSVA 2XPJA 1HJGA 1NY71 2LTNA 1F5JA 4MGQA 5A7WB 5CA6A 3WZ1A 1PNFA 4QPGB 4PF5A 5KHJA 5FOBB 4IV3B 3DCQA 2OW4A 3C8XA 3LOBA 5B4XA 3DF0A 5LATA 1GNHA 1QQP1 4EWAA 2Q8EA 2Q8OA 1UY1A 1OQ1A 5FP4A 5H9PA 1H30A 5I0TA 3RYRA 2R063 1FXZA 2EIGA 2OZ6A 1ZZ6A 5J48A 1RUJ2 1NOVA 3O7OA 3FBMA 2R042 4JQTA 3WG3A 2J22A 2LW8A 3FLRA 4L99A 1MS0A 5IVYA 3RDIA 4GB33 3N9LA 1PZ7A 3VZJA 3CZUA 5DZGA 3TEZA 1AR73 4RS5A 4LBQA 2C26A 2ZX4A 1FAYA 3MEPA 1D4VB 1PMJX 4Q29A 2WFF3 4A7YA 1KDMA 3T0BA 3IZOA 2WYSA 1G9DA 3ZN5A 1BK1A 1GZWA 4CUBA 4TZDA 2GC2A 1ZBA2 2VZ3A 4TTGA 4HZFA 4NJ4A 2YBKA 5FOJB 4XYXA 4ZZ5A 1WBLA 3KB5A 2BJSA 1L7QA 2P4EA 5I0RA 1F5FA 2Q30A 2YHJA 4UF0B 1XU2A 4B8EA 3EMRA 2P2KA 1RUE3 4NAOA 1DQ1A 1RVF2 2RS52 1BVP1 1JOJA 4LO6B 3O14A 3O1VA 3NKTA 3POWA 5JIAA 5F7UA 1Q3EA 4UXAA 2XH6A 3P3PA 5FPVA 1UW8A 3CQOA 1DIWA 5CKQA 3VZKA 1X8MA 5KHIA 5FO7B 4ZY9A 4Q0PA 2ZABA 3OYWA 4G3YC 5CKNA 1CESA 4XDQA 2OZJA 4PLOA 2R16A 2R1BA 4UW3A 5DUXA 3RMYA 5K0UB 5JVVA 2OXBA 2VOKA 3I3QA 5JCTA 4MXVA 4JGYA 2QQNA 2XJVA 4Y20A 4CDUB 3VKNA 2O8OA 4HETA 4WVZA 1GZWB 2E51A 5IAVA 4CDXC 4EQVA 4DEQA 2ZHMA 4IW3A 4N43A 4NPRA 2GP3A 4Y24A 1BEV2 2ZMKA 4GWIA 4KWLA 4NOTA 1QJEA 2PA7A 2LUWA 4X8PA 3ILFA 4UFIA 2G1MA 2JE9A 1V9U3 1W6PA 4QPYA 2WJSA 3FFQA 4FFIA 4FAHA 1VMJA 4PI2A 3AVRA 4JRAA 3HOBA 4GXLA 3KMHA 1HB3A 2RG4A 4E2SA 5FZDA 5C3OA 1FI2A 3E6BA 1G7YA 2NLRA 3O5SA 4YM1A 5LWBA 2ZZJA 1YI7A 2VY0A 3TN92 3OEAA 4OQ9A 4XABA 1RIRA 2DU0A 5G04L 4EE2A 2ARXA 4N53C 1ZZ8A 4QXKA 4W6YA 4QPGA 5KXCA 1R1A3 2V09A 4GJYA 4RQPC 2EXHA 2GU9A 2LRPA 1BJQA 1G86A 2HYXA 2OT7A 2QKDA 4P5YA 4XJ8A 5C3QA 1WMDA 1PO12 1UKRA 3FHIB 3O12A 1OURA 2Q8CA 4CPBD 4MLOA 4C91A 1LKNA 1UZYA 3VDDA 4EN6B 1ZBE1 3E5UA 4Z2WA 3BPSA 5FXVA 4DQAA 2NMNA 3J7LA 3M2MA 2WT0A 1ALYA 5FRAA 1NZIA 4GH4C 4BJ0A 2J1UA 3M3CA 4IV1A 3BIEA 1WBFA 4QWNA 5C7GA 5IK8A 2DVAA 1YC61 1XYNA 1DYPA 4XEZA 5F6LB 4YVWC 2XKOA 1LESA 4XVHA 5CFDA 1ULPA 5IFTA 4Q0UA 2PAKA 3S57A 1ND3C 4HKWA 1VBD1 4JAAA 1N1SA 5F5QA 5FZHA 2JDZA 3KZ4C 2QTWB 2IVIB 2VUDA 1KQRA 2GAUA 1NT0A 3GHMA 2VMGA 4CUCA 2RS11 2QQWA 2YROA 5LCWL 2BGPA 3SITA 1RUJ1 2BDRA 2XKPA 4DXSA 3OGRA 3ZXAC 1G9CA 2E32A 1JI6A 4DMIA 1C8M3 2WZEA 2ZEZA 4CCLA 1DLCA 1RTVA 5JI9A 4AQ6A 3WQBA 3G6JB 1QNYA 3FX3A 4OYUA 1DYKA 1J3PA 2QNKA 2F6BA 4YW1A 2OUJA 3WDUA 1H4HA 1WMFA 3ACGA 4J1XA 3RRDA 3ZN6A 5D21A 4LBQB 4ASKA 3LIGA 5BYNA 2QCSB 4WVMA 2YY1A 1IS6A 4C90A 3PIGA 2P5BA 3RJRA 5E16A 5FYTA 4YVSB 3VBSB 4NIDA 4FBFA 4A3XA 3LGRA 1POQA 4YW7A 4ZS3A 2CGNA 2Q1ZB 3T1MA 4FPJA 1YXWA 1MZFA 1QJFA 1RYYA 2VMIA 2ZGMA 2ET1A 1J58A 2V5DA 3MFCA 4MADA 4RQPB 4AEDC 2O8QA 4QAWA 4E2QA 3HQRA 2EAAA 3T2QA 2XDVA 2IXKA 1PHMA 1RVF3 2VTXA 1D2SA 2W1UA 4ZHNA 2JG9C 2R1DA 1O4YA 2CGOA 2DTYA 5HCAA 3C7GA 2WO1A 2QQJA 2QQPA 2E31A 4XJ9A 1H2LA 1MEC3 2PLV1 3MIHA 4NPLA 5LBBA 3POSA 1S4CA 2X5IB 4QXBA 3VB9A 4MUVA 1WW4A 5FZ8A 3LEMA 2VXJA 1D7PM 1VBE3 4YNIA 4BLIA 1CZSA 3FWEA 5ABJB 2ZTNA 1XJAA 2VUAA 4SBVA 3T09A 5AC91 2JE7A 1T2XA 1H8VA 3CEWA 3U0ZA 3AYCA 4XJZA 5L9VA 3IDAA 3OJBA 1CPMA 4OQ8A 1RMU2 1WCQA 1JBCA 2O1QA 1YFUA 4FTEA 3F95A 4R52A 1BBT2 1X50A 3ORJA 2QDNA 1RXFA 5DG2A 3KV6A 1MQTC 1W05A 1YYNA 1V9U1 4LPLA 1H1AA 3UJQA 3K4AA 4D6QA 2YDEA 5IK7A 4OUMA 1X9TA 2YZ4A 4GKXA 3N9NA 4P9WA 3B01A 3M1HA 2P34A 5JXIA 3RZHA 3H1MA 2X5IC 2HEWF 1GU3A 1W6MB 3VL8A 1AJKA 1OSGA 2XUMA 5F3GA 3NV2A 4BZ4A 1YUDA 2ZGUA 1V6LA 2B4KA 1GWKA 4RGAA 4EN9B 2E33A 1XSQA 2H0BA 4QPIB 3ZYGA 1JZ2A 3O1OA 1V00A 1NA1A 1Q8OA 1XE0A 2J1AA 1J84A 5FYBA 1SPPA 2QZ2A 3ZLIA 4YVSA 3OG2A 4LJHA 5FUPA 3VBSA 1W8HA 2BVBA 2XLFA 2KXLA 5EYYA 3S6PA 2EF6A 4AAPA 5FR3A 5JAXA 5J98B 5C8WA 3SKJE 4EROA 5A6QA 2QDRA 4AEMA 2PXJA 3BN6A 1MS8A 2WWJA 2VVEA 1NCQC 2RS33 4FOVA 5IVEA 3IT8A 3WLUA 4AYUA 5FPUA 2ZAHA 2AR6A 1G9FA 2VOVA 3LDBA 1H8TA 1RUC2 2R0HA 4HVRA 2XHKA 4BCUA 4QM8A 4JC1A 5FPLA 3PNAA 1DGLA 3JD73 4R9DA 1JODA 5GM0A 3JBG3 2J1VA 4ATEA 1H9PA 1GWLA 1GANA 2C9KA 4IDZA 5ACA2 2BUKA 2HWF3 1VBA3 4XAAA 2FZ2A 1VBC3 4HSJA 1KD7A 2UWCA 3WT3A 2A6YA 3ZFGA 3A21A 5T3NA 2EAKA 4IL7A 2WNVB 4RQPA 3IPVA 3QLQA 2WN3A 4XACA 2WS92 1SEFA 1QJY2 4ASMB 1HRI2 1VRH1 2CDPA 1VJ2A 2YU2A 5GZEA 4KL1A 5T54A 4AEDA 1RUD1 1W6PB 3AP7A 4BLJA 2FDJA 4LO8A 2HWC2 3PTYA 1PX3A 3F2ZA 1OOPC 4CZSA 1NKGA 1ENXA 4NROA 1UXXX 2WABA 3TEYA 2JG9B 1WGPA 4MYEA 2C1FA 4IEPA 4Q4W1 4CEYC 4KH9A 3JB8A 1OBNA 1OHFA 1AR63 1NLSA 2FMYA 3FUQA 1EAH2 3MLJA 4A7KA 2DUQA 4EN7B 3GZEA 4RS5B 3VN4A 5FY4A 4B1MA 3KGZA 2Z79A 1HXS2 2IVJA 2HWB3 1DZQA 2IXHA 3AMNA 3D6EA 3PHMA 1WCUA 5FIXA 4BXSV 3RYKA 3W59A 3A7QA 2HWB2 1PZ9A 3LA3A 4HVQA 1JOBA 5JLVA 3MUZ1 2WKKA 5BY5A 2DCZA 2WQZC 4M3CA 4M01A 2XBO2 4BHPA 3WDVA 3NV3A 3CJXA 1QXRA 1N3OA 1UQXA 4Q0VA 3HWJA 4XDPA 4Y5TA 2Y60A 1JZ4A 2CYFA 1SCRA 3RWKX 4CVUA 4YW6A 5ANQA 2EVXA 5KHGA 3LZZA 4HT1T 4Y26A 4AHZA 1PO11 1W2UA 2ZMLA 3FJSA 1JZ8A 2J7MA 2HWE3 3CJIA 5IVFA 1V70A 1AR81 4XJWA 4IEXA 1JW6A 2W91A 4QGNA 4FPOB 5CYYA 5FZFA 1JZ5A 5GZDA 5L7OA 5A3NA 3SEPA 4N9HA 3OYWB 4PDWA 1W0NA 4AVAA 3LCPA 5JZGC 1KXGA 2G19A 5GLTA 4BB3A 3D0SA 3W9AA 3KM5A 5FY8A 4EZ4A 3BU7A 3M70A 4MGTA 2DYCA 2WNVC 4LXLA 4ORFA 4LK7A 3OOXA 5I0UA 4H14A 5DUVA 5A33B 2YUEA 4GIQA 4GMP0 4CEWB 1DGWX 1AX0A 2Y38A 2QFEA 2FQPA 4Q4X3 1CX1A 2V4AA 3ME2A 3I2DA 3DKWA 1AL23 3IDCB 3WNNA 2VJXA 4RYDA 1MPXA 1BK0A 3AM2A 3RZKA 4JGZC 4V1PA 4N7UA 3ON7A 4K8RB 2CWMA 3O1MA 1T6GC 4YZ3A 4Z82A 2FBEA 4QU2A 3H7YA 5F6KA 3RS6A 5C6CA 2VZVA 3O1TA 3J9SA 1GP4A 2XL7A 4ISQA 2VVDA 4UI9L 1NLQA 1G8WA 2W08A 1B35A 5HV0A 5C3SA 5CADA 3H3UA 3DKQA 4QGMA 2YC2A 5DAWA 3SHRA 3GHNA 3ECQA 4CRQA 4LNVA 2R7EB 1C8NA 2W47A 2HJIA 5FUIA 1RITA 2PHTA 1LU2A 5BXXA 3MIDA 3URFA 3WF3A 2W3JA 4M4PA 2VNOA 1NYWA 5IW0A 3UGFA 2WO7A 4RR3C 2BBVA 4QQHA 4W6WA 1S0BA 5EXOA 4DNYA 1VMFA 1QF3A 3WP5A 3T0DA 2GMMA 4YYOA 1ULDA 3SC7X 3ACLA 5DUWA 5F3EA 1UPSA 1HX6A 4XOGA 1LAJA 2OX0A 1EPZA 1WZXA 3NNJA 4NPMA 1DHKB 2XOMA 1ULCA 2HEVF 2RR11 3DUIA 1AYN3 2VBBA 3KT4A 3MIBA 4A42A 1IHMA 1W6OA 1UMZA 3POFA 4XBNA 1K12A 1ZA4A 1HRV1 4IGPA 4KGQA 4YVWB 1QWRA 2NMOA 3HEIA 1YLLA 4LBJA 2VOXA 1YFWA 1ASJ3 3WEZA 4LIUA 5FZ1A 5EFUA 3RI8A 1I3HA 3IWZA 2OVUA 1KRIA 3OBTA 2A5ZA 4RSUA 4ZPIA 1CAWA 1N1YA 2R0FA 1GNZA 1W03A 5L36A 5J7MA 3WP6A 3KV4A 4KG8A 3SH4A 4CDXA 2WN2A 4IEWA 4RHV1 5FP3A 3OGJA 3VBOB 3VHNA 3O1UA 1TEIA 2VECA 4URTA 3ZIWA 4D3WA 5FY5A 5C8CC 5F37A 1CGPA 1QY4A 1GQGA 5ACA3 1W2TA
chains in the Genus database with same CATH topology
4KBBA 2MEV2 2F4PA 1KS4A 4Q2FA 2ZGKA 3U10A 5I8YA 1QXJA 3CJIC 3POYA 3MF6A 3EHKA 1V6IA 2RJKA 1WD3A 3LB9A 4CP1A 5BNPB 4HKOA 2WA3A 1SBFA 4PDWC 5CVRA 3QOPA 4N53A 2PQQA 2R6QA 1D4M1 3AYDA 1QJU1 3VBFB 4YW2A 4D7SA 1EV12 1DQ5A 1CQ9A 1C4RA 3K51A 2DFBA 3V65A 5T50A 4ASLA 4EN8B 3WP4A 2NP0A 5BV6A 4AK3A 3VDDC 1C3HA 5AVPA 3JCIA 3WCRA 2D6LX 3NAPA 1U5YA 4B4RA 4QQ2A 5TSWA 4FPKA 5BNOA 3MF9A 1YJKA 2A6VA 2R073 1AXZA 1IZ3A 1PVC3 2WC2A 1MZ6A 1YFXA 5DG1A 2EA7A 4B4PA 5BPXA 1BKZA 1YJLA 3AP9A 5CFCB 3HIFA 2BGCA 3WX5A 1RUE1 1UU4A 3AYAA 1AX2A 1XE7A 1FMD1 2I74A 2JXAA 1LODA 3MPBA 1G9AA 3VHPA 4HKLA 1M06G 3I7DA 1H4GA 4XF0A 2P37A 2V5YA 3KT1A 4P9IA 4AGVA 4N90A 4IEUA 1FOD2 2Y0IA 4DB5A 1QJX3 1OI6A 3ZXGA 4BQ1A 4M0NA 4OHXA 1J59A 3APBA 4U2AA 1KFUL 4ZXKA 3KCCA 2FZ1A 2RE9A 3S30A 4YZ2A 3AMPA 1W6MA 3ZDSA 5FDBA 3ZFFB 2ETEA 1VAKA 2DWRA 1CAWB 3SCGA 1VB2A 1B09A 1AR91 4QT6A 3LAGA 4FOYA 4HANA 1HDKA 3N7JA 5SV8A 2H6CA 2FMDA 1RUI3 1CN1A 3BODA 3GALA 1FNZA 3VZOA 4FQZA 1FPN3 2B42B 3LSDA 4XIKA 5GJ6A 3VBOC 4DFSA 4RA0A 5K8SA 1N1TA 5CU1A 1X33A 4E27A 3ZMNA 2A6XA 1RUH1 2BVVA 4D69A 1WLDA 4PIXA 5JOZA 4FCAA 4LBQD 4LO5B 3HT1A 4DY3A 1RUF1 2B39A 2ZGSA 3WW2A 3WG1A 3WDYA 2A73B 1CD3G 3M7AA 1B35C 4R4XA 3ZXKA 5FMOS 2BNNA 2JJ6A 1CONA 5DZFA 4FTSA 4LBMA 2WNUB 3V56A 2BWAA 5D8AB 1LOGA 1ZRDA 2RMU2 4ATFA 3B7MA 4BE3A 4JGYB 1XXNA 4Y20B 1ZBA1 1AR93 2WZR1 2D97A 4KGGA 1F8VA 2XG3A 3E5QA 3ZVXA 2JKBA 3RQ0A 2KA3A 3WW1A 1EAH1 1UZZA 1DF0A 1RUF3 1ZRFA 2DV9A 4XMIA 4Q4Y2 4CEYB 2IFWA 2RS53 2XWBB 4Q4Y1 1DQ6A 2JG8A 4YG3A 1GFF2 1UD1A 4XIOA 3AP5A 2ZX0A 4EWEA 1XNDA 1DBNA 4KU7A 5ABJA 2X29A 5IT6A 4F3JA 4YZ4A 1YIFA 4AEKA 1PK6C 5HBAA 3OBRA 4XQWA 5LRSA 1QH7A 1WUVA 1YNAA 1MQTA 3QBQA 5C8CA 4COWA 5JOXA 3V0BA 1CJPA 3M3OA 1VALA 4XE9A 4UW4A 2GALA 2D5FA 1W6OB 1W39A 5ACA1 2R071 1VRH3 4DOUA 3ZYIB 2CY6A 4QMAA 1DZTA 1NCRB 2ZGNA 4PQ9A 4FTBA 1PVXA 4COYA 2FHRA 2PN5A 3AMQA 1YWKA 3TNQA 1EV13 4AHYA 5FBZA 3ZSLA 3DPRB 3PVOA 4R4ZA 3SNMA 1MR5A 2YPJA 5EWSA 4WM7A 3VKFC 1AL0G 3U11A 1H2MA 2IXCA 1NE4A 3EBRA 1RC6A 2TEPA 4AHXA 2OUHA 2XBO1 2Y0OA 4YGBA 1RL3A 1JXNA 4R9AA 3ZSKA 5AFEA 5FREA 1VAVA 1WW7A 5JDBA 2ZKLA 3ROUA 1YFYA 1DQ0A 2YYOA 1V9U2 3AX4A 1GV9A 4AVBA 4RFT0 1BQPA 4U36A 4FPFA 5LK5A 4WVMB 2WZPP 1SLLA 4FPCA 4FPLA 2D5HA 4OHZA 4CDXB 4BM8A 3I54A 1FX5A 2JG9A 4IV1B 5A32B 5C8CB 3B94A 1TMF1 3NAPC 1AYN2 3WHUA 3MYXA 1HRI1 1RUI1 1SFNA 1VRH2 2PLV2 1SBEA 1MS1A 4I3GA 1XU1A 2B45X 3GF6A 4Y1VA 1AR92 3HQXA 1C8M2 1U5ZA 2ZAAA 5D8AC 1RUE2 3QCWA 2GMPA 1Z7S1 4ES8A 3W58A 3TOJA 1PO23 1R081 3ES4A 4RHV3 3ZFEA 2YV8A 2BYVE 3INAA 3OD0A 1VR3A 1YHFA 1CPNA 1LECA 1ZBA3 1AL21 1AR83 3VBUC 1UPIA 1PK6B 5GLVA 2WFF1 4TYSA 4LT5A 2QZ3A 1RB8G 1CAVB 1MS5A 4PCRA 1JHNA 4IEVA 4RD7A 2VVFA 1HQNA 1XNCA 5FPXA 3MICA 2B46X 5A3MA 1UU6A 4L9BA 5KXBA 5AFBA 5BNPC 4KU8A 1GLHA 4QQLA 4XFBA 3AJYA 4Q4V2 5BNNB 4AFDA 4OFGA 4HSLA 4XFCA 4XW3A 5DDJ3 1ZRCA 3S7IA 2PFWA 4W65A 1R092 3AJZA 1PO13 2D6OX 4ITCA 4GMP1 1MVEA 4W6XA 4E4SA 3NSTA 4LEJA 2VU9A 4RR3A 3SCFA 1VBD2 3VKLA 4HK9A 4BMEA 1C8M1 4AFMA 5T5PA 3NKGA 1SLBA 1HRV2 2RM23 3JUUA 2YGMA 5CBLA 3L2YA 1H8TB 1UX6A 1XYOA 3ZFGC 2ZHLA 1JUIA 2B7YA 5K7PA 2W52A 3BOPA 1TMF3 4BWOA 4G9SB 1LU1A 3WQ7A 1DZRA 1ZYBA 1JUHA 1GSLA 1Q8VA 1FATA 4AVTA 3CLPA 3DL3A 2GNDA 3AYEA 1UU5A 3OGGA 5JPNB 1AR62 3H1WA 3MFAA 1RUC3 1MS9A 1DDLA 4N9IA 4AEDB 1OOPB 2CV6A 4IV1C 1H1IA 3NW4A 1BMV2 1S0FA 4J1WA 1HV0A 3WV6A 1AR82 3GZTB 5JIUA 4MXWA 1QJX1 4E2GA 4Q4X2 5JZGB 4LULA 3AKPA 1ULFA 1O3TA 1QJU3 1IS4A 1FOD3 4XILA 2R30A 3JU9A 4XFAA 5CFCA 1JTZX 2JEMA 3AZZA 1KS5A 4HLTA 3B9IA 4I0BA 3TBDA 2EXJA 3WW4A 1C57A 4L2NA 2RJLA 3GZUC 4N43C 5CFDB 2WNUA 3BALA 3M3EA 1O3QA 1FNYA 4NWWA 2DVGA 4WM7C 3ZYRA 2LALA 2UYAA 4MH0E 1G6NA 4Y5Z0 2ZBJA 1Z78A 3FC0A 4CP2A 1IS5A 1CVNA 1ULGA 2WLQA 3M3QA 4Y22A 3ZSJA 1OD5A 2HWF1 2AREA 3X29B 1X36A 1SMVA 2R072 3C2UA 2WT1A 2PAMA 3VBHB 4JV4A 2P3IA 5KBFA 3O0WA 4ZKTB 1ZZCA 1F9KA 3S0MA 1TQ5A 3DN7A 4BYYA 4YG0A 2E63A 3O0XA 3TN91 4BMBA 3VBRA 4RR3B 2TUNA 3ZFEB 2RMU1 2A6ZA 4GULA 2ILMA 4MGIE 2UYBA 2BTVC 1IPKA 1EAH3 2W68A 1LGCA 5EYXA 4YFWA 4E4ZA 4PBPA 1X7NA 2RM21 3VV1A 5DZEA 1APNA 1S55A 4HL0A 5LEKA 1NCQB 2ZZQA 1WA4A 5D1IA 1F31A 1O4ZA 2G4IA 4XFGA 3PVEA 4FAGA 1IKQA 2GNBA 1SFYA 1GZCA 4PIZA 1O3RA 2HWD1 2GZWA 2PHDA 4YVWA 2C9AA 1HLCA 5K0UA 1LOFA 1YIPA 3HT2A 5KHKA 1RUC1 3CU7A 1FYUA 1COV1 4X8NA 4KWKA 4DRVA 1LOAA 4DRRA 2I2SA 4WVWA 3R4UA 4CDUC 2D6NA 1RUH3 2DVBA 3DPRA 3T2TA 4Q26A 3H50A 1TME3 3E97A 2SLIA 3I4IA 1EY2A 4EJRA 4O9GA 2GC0A 4FPEA 4Q27A 4BIOA 3CNAA 3WD5A 1ASJ2 2BNOA 1VBE1 3N3HA 1DU3D 1ENQA 1HRV3 1LR5A 1N1VA 1UL9A 2RM22 1K5MB 3JD72 1OA2A 1HW5A 1H8TC 4XZPA 1ZREA 2VW2A 4JGZB 2O0OA 2CL2A 1RUD2 4IERA 2VULA 5AVAA 4PDWB 4AEJA 3ZXFA 2ZKNA 1J3RA 4AI8A 5FQ0B 1O3SA 4YRDA 2Z69A 3HBZA 4I0WB 5LRRA 1X82A 4N53B 3FMGA 2GNTA 3JQWA 4XXAA 4I2OA 4LR4A 4Q4X1 1H2NA 1BVVA 1S2KA 4Y1UA 2NYYA 2NZ9A 3GNEA 3Q9OA 1VLNA 2HWF2 4FXKB 1REEA 4A7ZA 3R4SA 3A0KA 3OY8A 2KM2A 5J96B 1OOPA 3IM0A 3LKJA 5EV7A 2UWAA 4I02A 1TNFA 4XQ4A 1G9BA 5JSOA 4LLOA 4GH4A 4MGKE 3FLTA 1N3QA 1WCDJ 4LHKA 1CIWA 4XFIA 2IXIA 1Y43B 4OI0A 3RNSA 5IK5A 3AK0A 1AZDA 3VBFC 3OPZA 2PTMA 3UL2A 3L9JT 1GICA 1RUG1 4L97A 4AXOA 1RMU1 3VGIA 1WW5A 4TWTA 3IMNA 1VBB2 3N4MA 1PO21 3M8LA 2QE3A 1ENSA 5KHHA 4IEYA 1DGRN 1NXMA 4NHKA 1UIJA 2D3PA 4LTAA 1PM7A 2D6KA 3J8F3 2ZX1A 1OA3A 4YLZA 1RUI2 3PVBB 4LE3A 4WM8B 5L19A 1W6NA 1RGSA 5L7OB 4B7KA 1I9RA 4H3WA 4YVSC 2PHFA 1R093 2WS93 5FLIA 3VBSC 2EALA 5KC5A 1C5HA 5DDJ2 4GA9A 4HPKA 4D7TA 1DGWA 3SH5A 4Z92B 1Q8SA 4KQ7A 2A7AA 1VBA2 2DCKA 2X53S 3J8F1 3ZXJA 5A32A 3MW3A 4PLMA 4XXPA 1Y9QA 3VHRA 1MS4A 1DG6A 2GDFA 3VHOA 3EO6A 3NVCA 1SLAA 5CFCC 1QJZA 3C3VA 3JD71 3AKTA 3PJQA 3VZLA 1S0IA 3ZFGB 4UW6A 5BNNC 3WUCA 3ZMOA 3GBFA 4RHV2 4PLNA 2WQ4A 1ND3A 3IDBB 3WW3A 4AQTA 3LA7A 4S2DA 1PGW2 4CEWC 1W0OA 2MHFA 3RG0A 4GB32 4Q4Y3 2GC1A 1LEDA 1FV3A 1BXHA 1ZRRA 4R9CA 1K5MC 1O7FA 1OMIA 4I0AA 4COZA 2R062 1CAVA 2ZGQA 2XGXA 4XHBA 4AFBA 4LHLA 1V6KA 1Q8QA 3KS7A 3AKQA 4JDOA 1JYCA 5GALA 2JX9A 3SMHA 2GH2A 2Y26A 4XTMA 1W0PA 4E9KA 4WM8A 4OVEA 3USUB 1H2KA 1WD4A 4RGGA 4QPIC 3RMXA 1AR71 1H9WA 1YCIA 1ND2A 1NA1C 4IV3C 2DVDA 4XFFA 1Q5OA 5A33A 2XVKA 2JENA 4QX5A 4XF9A 5HCBA 3WY6A 5FO8B 4F7ZA 1FV2A 1UCXA 2CTVA 4YM0A 1FPN2 2CNAA 5AC93 1HQWA 4LBOA 1NXD1 2P3KA 4LUMA 2QJVA 3VDDB 4UBGA 1M4WA 1LRHA 2NPIA 1CJDA 3TRSB 4Z07A 3FLPA 3UKTA 2VGDA 3VBHC 4DINB 4O9EA 2WSVA 4LBKA 3IPVB 3MLKA 3D4KA 1MZ5A 2VQ0A 1WCKA 4GALA 4AGRA 4FPGA 1BEV1 4AVCA 2WZR2 4P9XA 3FBYA 4X6RB 1YO8A 1N47A 1SBDA 3U4XA 1QKQA 4ZU7A 1BCXA 1RMU3 3FUOA 5I93A 2IXLA 2GMEA 2Z2SB 1KJLA 5GZGA 5JOYA 4OHWA 1GYKA 4QHBA 1VBE2 4JDNA 3H3ZA 5FMOL 4P9LA 4AVVA 3AP4A 3QH6A 3V0BB 1MEC1 1SACA 5T55A 1VBB3 2YMZA 4CDWA 4CDQA 4HBNA 5J3UA 4FSJA 1SQ4A 3WVJA 1I1EA 2HWB1 4COVA 1RVF1 4AHWA 4DY5A 2XWJB 1U5IA 5I8SA 4WV8A 1S0CA 5C9AB 4JDMA 1Q56A 1BYHA 4META 1JN2P 4QGLA 4XF3A 2BEOA 3WNXA 5H9RA 1AYM1 1S0DA 5KXEA 1R1ZA 2QUOA 2ZGRA 1Y3TA 4Q8KA 2LM3A 1LJ7A 4XPVA 4WZFA 3HD8B 3KCXA 1E57A 1RUF2 5JMCA 4MX3A 1QJX2 4NWVA 3KCYA 1QXPA 2VG9A 4EN0A 4UBHA 1NCRC 3KSCA 1GR3A 5CG8A 1ND2B 1AXKA 1CR7A 2DCYA 1X8EA 3NL1A 4QQPA 4HFSA 4ISRA 4XQDA 3ZN6B 1H0BA 4E4DX 2ZJCA 4B3NA 4OZXA 1UAIA 2D44A 4EWDA 3VUOA 1MVQA 3TYJA 1QOTA 4YW4A 2GC3A 3TN93 4PJYA 1WW6A 2HYKA 2H6BA 3BPZA 3VBOA 4AQ2A 3DV8A 1CAXA 3LA2A 4XBLA 3MIEA 4CTEA 2WFPA 2B8MA 1LHNA 1AR61 3IBMA 3A4UA 1UF2C 1DLLA 5GLWA 1ZZ9A 1SLIA 1WLTA 3PMSA 1A3KA 1LOEA 4MSVA 2B9UA 5JPMB 4QQOA 4IEQA 4AG4A 1FOD1 4HMZA 4NHMA 4LA3A 4LBNA 1I6XA 4BOWA 4ZU4A 4QPGC 5FCCA 3ZFFA 2UWBA 3V0AA 2UURA 3AB0A 5C9AA 4LUKA 2PHXA 1R1A1 3UK9A 3VBUB 2CGPA 1MACA 5FTTC 2RR13 4HPKB 3WOGA 5CG9A 2R061 1W6QA 3N36A 2V73A 4CDWB 5C33A 1QMJA 1QQP3 2MEV3 4AFAA 1PIV3 4K7JA 3MZHA 2EXIA 3E5XA 4L8QA 4P9JA 3TWIA 1CAUA 1H1MA 3GZAA 1U5XA 4N7IA 5T5OA 1ZM1A 3MLLA 5C4WC 2R32A 4IETA 1WLCA 5L7OC 3H1YA 4JGYC 2HEYF 1XNBA 2XJUA 3V0AB 2UY8A 3R05A 1IKPA 1R091 4NVPA 5A3LA 3KD4A 3HAGA 3KLSA 1PVC2 2ZGPA 4XF1A 3ZN4A 1D0HA 3OD4A 2EXKA 4DXZA 3DGTA 3WR0A 1BBT1 2AH2A 4BIFA 4IEOA 3ALQA 3CJIB 1B35B 2A70A 2TBVA 5K0UC 1OPMA 1GZ9A 2ZMNA 1QHDA 2OA2A 3VKOA 1POV0 2XJRA 1COV3 1ND2C 5CIRA 2E7AA 3K48A 1SDWA 5DUUA 2E9QA 1PK6A 2ZA9A 2HWE2 1ND3B 5DXDA 1V6NA 2XJPA 4BZ4A 3TAYA 4AI3A 1IGOA 1U0AA 1AX1A 1XYPA 2WNVA 4H7LA 2VQAA 3B5LB 3AP6A 4S2GA 2A71A 1YRZA 1BZWA 3EXUA 4JRLA 1URXA 4Y22B 4HN1A 1RINA 1OLQA 1AL22 1NQDA 3MPPG 5EZWA 4CDWC 1LHWA 3WDWA 1POV1 1D4M2 1ZX5A 2JECA 3RSJA 3B00A 4BH9A 1QDOA 2H0VA 3SLIA 5GKAC 4D7YA 3AMMA 2BFUL 3MI8A 4IXLA 2ERFA 2AENA 2PELA 3E6CC 4P9YA 3ZPYA 3ZXDA 3H7JA 1AVBA 2DURA 2MEV1 4GH4B 1UN1A 1OA4A 5KWRA 4YZ1A 2AYHA 4Y4YA 1A6CA 1Q43A 4CDQB 3QACA 3GYDA 3I59A 1XNKA 1HRI3 1NCRA 1LCLA 2CAVA 3VKMA 3ETQA 1WLWA 5FQ0A 4I01A 1HIXA 4M00A 1JH5A 3AZYA 3WP3A 1ZBE3 1KJRA 2UY9A 4XBQA 1IOAA 1NG0A 2G9GA 1EPWA 3BIWE 3ZFEC 3N7MA 2Q1MA 4Y1YA 2IZWA 4WM7B 3ZIXA 2HWD2 3EQEA 4F83A 1ZNPA 4OI2A 3VBUA 2GH8A 1DQ4A 3N7LA 2BNMA 4AF9A 2ZX3A 4NR1A 4PIYA 4QM9A 1Q8PA 3MIGA 2HWC3 1PIV1 2XL9A 2IWGB 3S7EA 3A0NA 4ONUA 3J26N 1C1LA 1GBGA 5FLJA 5I91A 1LHVA 4AI1A 4FP2A 5JZGA 3AZWA 1ULEA 4D94A 1S1AA 5GZCA 2WLPA 5CNAA 3SH3A 3UKVA 4YZ5A 4J6GA 5IUQA 1UKGA 4XF4A 4TLFA 5C9AC 2XLAA 2IC1A 2WINB 1QDCA 3R0RA 2WSUA 5KC6A 1HXS1 1IS3A 2ZX2A 1K5MA 2ZOEB 1LHOA 1OQEA 2BWCA 1D4M3 4I09A 4YGEA 3ES1A 3UKNA 3VZMA 1CX4A 3NWKA 2G9FA 4CYDA 2YC0A 1JYIA 4Q4W2 4A2UA 1RUG3 2D6MA 5BNOC 2R041 2D3RA 2XJQA 2ZGTA 3SISA 2D40A 1NE6A 1Z0HA 2DVFA 2XBO3 2HWC1 5C4WA 3D0JA 4LO7A 3J4UH 3AFGA 2ZHKA 5B2GB 2B5HA 2DUOA 4FPHA 2ATFA 1C28A 3PJYA 3FFZA 4PBOA 3PLQA 1MQTB 2DCJA 2WWSA 3N35A 1MEC2 4HN0A 4IV3A 2ZACA 2MNGA 3E6DA 3WHTA 2JICA 4K9SA 2DUPA 3ZYJB 3M4FA 5J09A 3B02A 3H8UA 4XTPA 2Q4SA 1D0GA 2ARBA 3JB4C 5GLZA 3TB0A 1LENA 1A8MA 3RWNA 3GBGA 4FOWA 1R083 3LSEA 4QPIA 3LWCA 2E53A 1LGNA 4P9GA 3VBFA 1OKQA 1QJY3 3L2HA 3HMYA 3SXWA 4MV2A 4UW5A 4K8FA 1V6JA 3CO2A 5IK4A 1ENRA 1VB4A 1VBC2 4YGCA 2CAUA 3QD6A 3HR9A 4L92A 3KGLA 1RUOA 3ZXLA 3B3QE 1SLCA 1S0GA 5KXDA 4OLLA 4GB31 2SBAA 2VOWA 1MS3A 1PZ8A 1QJY1 1S2BA 2VNGA 3BOWA 2RS32 2AGSA 5BNOB 1IPJA 3WXPA 5BNNA 1LGBA 4S2HA 2WFF2 4XHXA 4AGGA 4NO4A 3VZNA 5F9TA 2A3XA 4K21A 4Q4V1 4M0HA 3VBRB 4GMP3 3ZYPA 4Z8BA 2I45A 2K9ZA 2HWE1 2P3JA 5FLHA 1O5UA 4Q0QA 1OLRA 2Q0AA 5DDJ1 2GN3A 1RUG2 4AVSA